https://pages.htgaa.org/2026a/ade-larsen/homework/week-05-hw-protein-design-part-ii/index.htmlPart 1: Generate Binders with PepMLM The target for this study is the human SOD1 protein (UniProt P00441), specifically focusing on the A4V mutation, which is a common cause of Amyotrophic Lateral Sclerosis (ALS). Mutant SOD1 Sequence (A4V): ATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ Using PepMLM-650M, four peptides of 12 amino acids were generated and compared against the known SOD1-binding peptide FLYRWLPSRRGG.Hugoen