Week 2 HW: DNA read, write and edit

Part 1: Benchling & In-silico Gel Art

Here is a simulation with the Restriction Enzyme Digestion on Benchling.com:

image
Part 3: DNA Design Challenge
3.1. Choose your protein.

I chose the Green Fluorescent Protein (GFP) because it naturally glows green when exposed to UV light. This revolutionized cell biology by allowing scientists to see proteins inside living cells and it won the 2008 Nobel Prize in Chemistry. This protein has been isolated from the jellyfish Aequorea victoria and forms a beta-barrel structure (like a protective can). Inside the barrel is the chromophore — the light-producing part.

image

The GFP visible in Aequorea victoria. Source: https://www.universityofcalifornia.edu/news/how-glow-dark-jellyfish-inspired-scientific-revolution

Sequence from https://www.uniprot.org/uniprotkb/P42212/entry:

sp|P42212|GFP_AEQVI Green fluorescent protein OS=Aequorea victoria OX=6100 GN=GFP PE=1 SV=1 MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

3.2. Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.

GFP DNA Sequence from https://www.bioinformatics.org/sms2/rev_trans.html:

atgagcaaaggcgaagaactgtttaccggcgtggtgccgattctggtggaactggatggcgatgtgaacggccataaatttagcgtgagcggcgaaggcgaaggcgatgcgacctatggcaaactgaccctgaaatttatttgcaccaccggcaaactgccggtgccgtggccgaccctggtgaccacctttagctatggcgtgcagtgctttagccgctatccggatcatatgaaacagcatgatttttttaaaagcgcgatgccggaaggctatgtgcaggaacgcaccattttttttaaagatgatggcaactataaaacccgcgcggaagtgaaatttgaaggcgataccctggtgaaccgcattgaactgaaaggcattgattttaaagaagatggcaacattctgggccataaactggaatataactataacagccataacgtgtatattatggcggataaacagaaaaacggcattaaagtgaactttaaaattcgccataacattgaagatggcagcgtgcagctggcggatcattatcagcagaacaccccgattggcgatggcccggtgctgctgccggataaccattatctgagcacccagagcgcgctgagcaaagatccgaacgaaaaacgcgatcatatggtgctgctggaatttgtgaccgcggcgggcattacccatggcatggatgaactgtataaa

3.3. Codon optimization.

GFP DNA Sequence with Codon-Optimization from https://punnettsquare.org/codon-optimizer/:

ATGTCTAAAGGCGAGGAACTGTTCACCGGCGTTGTTCCGATTTTAGTGGAACTGGATGGCGATGTGAACGGCCACAAATTTAGCGTGTCTGGCGAGGGTGAGGGCGACGCAACTTACGGTAAACTGACCCTGAAGTTCATTTGTACTACCGGTAAACTGCCAGTGCCATGGCCAACCCTGGTGACCACCTTTTCTTATGGCGTGCAGTGTTTCTCTCGTTATCCGGATCATATGAAACAGCACGACTTCTTCAAAAGCGCGATGCCAGAAGGCTATGTGCAGGAGCGTACCATTTTTTTTAAAGATGACGGTAACTATAAAACCCGTGCAGAAGTTAAATTCGAAGGCGATACCCTGGTGAACCGTATTGAACTGAAAGGTATTGACTTCAAGGAAGATGGCAACATTTTAGGTCACAAATTAGAATATAATTATAACTCTCACAACGTTTACATTATGGCAGATAAACAGAAGAACGGTATCAAAGTTAACTTCAAGATCCGCCATAATATTGAGGATGGTAGCGTGCAATTAGCGGATCATTACCAGCAAAATACCCCGATTGGCGATGGCCCGGTGCTGCTGCCAGATAACCATTACTTAAGCACCCAAAGCGCGTTAAGCAAGGATCCAAATGAAAAACGTGACCATATGGTGTTACTGGAGTTTGTGACCGCAGCGGGCATTACCCACGGTATGGATGAACTGTATAAA

3.4 Technologies for producing the Green Fluorescent Protein.

To produce the Green Fluorescent Protein (GFP), a gene encoding GFP will be necessary. This gene contains a promoter, coding sequence and terminator.

A: Cell-Dependent Method.

The GFP gene is inserted into a plasmid with a bacterial promoter. The bacteria (E.coli) transcribes and translates the gene and the protein accumulates in the cytoplasm. It can be purified using chromatography. This method is cheap and fast.

Another cell-dependent method would be when the plasmid with GFP is introduced via transfection in yeast or mammalian cells. Through this method, cells express GFP for microscopy studies or protein assays. Therefore, it is useful if GFP needs to fold properly in eukaryotic environments.

graph LR;
DNA-->mRNA-->Protein-->Fluorescence

B: Cell-Free Method.

The cell-free method is the use of cell-free protein synthesis systems, which contain ribosomes, tRNAs, amino acids, nucleotides, ATP, GTP, and transcription/translation enzymes. Then, the DNA template will be added for GFP to the mixture. The protein is produced without living cells, often within a few hours. This method is rapid, avoids toxic effects of protein expression, easy to add modifications.

3.5. [Optional] How does it work in nature/biological systems?
  1. A single gene can produce multiple different proteins at the transcriptional level mainly through mechanisms that modify the RNA transcript before it becomes translated. This greatly expands protein diversity without increasing gene number. The key mechanisms are Alternative Splicing, Alternative Promoters, Alternative Polyadenylation and RNA Editing. The most crucial method is alternative splicing. During transcription, a gene is copied into pre-mRNA containing exons and introns. Before translation, introns are removed and exons are joined. In alternative splicing, different combinations of exons are included or excluded. Types of alternative splicing are exon skipping, alternative 5′ splice site, alternative 3′ splice site, intron retention and mutually exclusive exons.
  2. I used the site https://biomodel.uah.es/en/lab/cybertory/analysis/trans.htm to convert sequences from DNA to RNA to protein:

DNA sequence:

ATGTCTAAAGGCGAGGAACTGTTCACCGGCGTTGTTCCGATTTTAGTGGAACTGGATGGCGATGTGAACGGCCACAAATTTAGCGTGTCTGGCGAGGGTGAGGGCGACGCAACTTACGGTAAACTGACCCTGAAGTTCATTTGTACTACCGGTAAACTGCCAGTGCCATGGCCAACCCTGGTGACCACCTTTTCTTATGGCGTGCAGTGTTTCTCTCGTTATCCGGATCATATGAAACAGCACGACTTCTTCAAAAGCGCGATGCCAGAAGGCTATGTGCAGGAGCGTACCATTTTTTTTAAAGATGACGGTAACTATAAAACCCGTGCAGAAGTTAAATTCGAAGGCGATACCCTGGTGAACCGTATTGAACTGAAAGGTATTGACTTCAAGGAAGATGGCAACATTTTAGGTCACAAATTAGAATATAATTATAACTCTCACAACGTTTACATTATGGCAGATAAACAGAAGAACGGTATCAAAGTTAACTTCAAGATCCGCCATAATATTGAGGATGGTAGCGTGCAATTAGCGGATCATTACCAGCAAAATACCCCGATTGGCGATGGCCCGGTGCTGCTGCCAGATAACCATTACTTAAGCACCCAAAGCGCGTTAAGCAAGGATCCAAATGAAAAACGTGACCATATGGTGTTACTGGAGTTTGTGACCGCAGCGGGCATTACCCACGGTATGGATGAACTGTATAAA

RNA sequence:

AUGUCUAAAGGCGAGGAACUGUUCACCGGCGUUGUUCCGAUUUUAGUGGAACUGGAUGGCGAUGUGAACGGCCACAAAUUUAGCGUGUCUGGCGAGGGUGAGGGCGACGCAACUUACGGUAAACUGACCCUGAAGUUCAUUUGUACUACCGGUAAACUGCCAGUGCCAUGGCCAACCCUGGUGACCACCUUUUCUUAUGGCGUGCAGUGUUUCUCUCGUUAUCCGGAUCAUAUGAAACAGCACGACUUCUUCAAAAGCGCGAUGCCAGAAGGCUAUGUGCAGGAGCGUACCAUUUUUUUUAAAGAUGACGGUAACUAUAAAACCCGUGCAGAAGUUAAAUUCGAAGGCGAUACCCUGGUGAACCGUAUUGAACUGAAAGGUAUUGACUUCAAGGAAGAUGGCAACAUUUUAGGUCACAAAUUAGAAUAUAAUUAUAACUCUCACAACGUUUACAUUAUGGCAGAUAAACAGAAGAACGGUAUCAAAGUUAACUUCAAGAUCCGCCAUAAUAUUGAGGAUGGUAGCGUGCAAUUAGCGGAUCAUUACCAGCAAAAUACCCCGAUUGGCGAUGGCCCGGUGCUGCUGCCAGAUAACCAUUACUUAAGCACCCAAAGCGCGUUAAGCAAGGAUCCAAAUGAAAAACGUGACCAUAUGGUGUUACUGGAGUUUGUGACCGCAGCGGGCAUUACCCACGGUAUGGAUGAACUGUAUAAA

Protein sequence:

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Part 4: Prepare a Twist DNA Synthesis Order

Promoter:

TTTACGGCTAGCTCAGTCCTAGGTATAGTGCTAGC

RBS:

CATTAAAGAGGAGAAAGGTACC

Start codon:

ATG

Coding sequence:

ATGTCTAAAGGCGAGGAACTGTTCACCGGCGTTGTTCCGATTTTAGTGGAACTGGATGGCGATGTGAACGGCCACAAATTTAGCGTGTCTGGCGAGGGTGAGGGCGACGCAACTTACGGTAAACTGACCCTGAAGTTCATTTGTACTACCGGTAAACTGCCAGTGCCATGGCCAACCCTGGTGACCACCTTTTCTTATGGCGTGCAGTGTTTCTCTCGTTATCCGGATCATATGAAACAGCACGACTTCTTCAAAAGCGCGATGCCAGAAGGCTATGTGCAGGAGCGTACCATTTTTTTTAAAGATGACGGTAACTATAAAACCCGTGCAGAAGTTAAATTCGAAGGCGATACCCTGGTGAACCGTATTGAACTGAAAGGTATTGACTTCAAGGAAGATGGCAACATTTTAGGTCACAAATTAGAATATAATTATAACTCTCACAACGTTTACATTATGGCAGATAAACAGAAGAACGGTATCAAAGTTAACTTCAAGATCCGCCATAATATTGAGGATGGTAGCGTGCAATTAGCGGATCATTACCAGCAAAATACCCCGATTGGCGATGGCCCGGTGCTGCTGCCAGATAACCATTACTTAAGCACCCAAAGCGCGTTAAGCAAGGATCCAAATGAAAAACGTGACCATATGGTGTTACTGGAGTTTGTGACCGCAGCGGGCATTACCCACGGTATGGATGAACTGTATAAA

7*His tag:

CATCACCATCACCATCATCAC

Stop codon:

TAA

Terminator:

CCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGAACGCTCTCTACTAGAGTCACACTGGCTCACCTTCGGGTGGGCCTTTCTGCGTTTATA

This is the linear map:

image

The Plasmid:

image
Part 5: DNA Read/Write/Edit
5.1 DNA read

(i) I´d choose to sequence the gene TP53.

What is TP53?

➜ The gene TP53 provides instructions for making a protein called tumor protein p53 (or p53).

➜ This protein acts as a tumor suppressor, which means that it regulates cell division by keeping cells from growing and dividing (proliferating) too fast or in an uncontrolled way.

➜ It is often called the guardian of the genome because it prevents cells with damaged DNA from becoming cancerous.

➜ Thus, the TP53 gene is arguably the most important gene in cancer biology.

The p53 protein is located in the nucleus of cells throughout the body, where it binds directly to DNA. When the DNA in a cell becomes damaged by agents such as toxic chemicals, radiation, or UV rays from sunlight, this protein plays a critical role in determining whether the DNA will be repaired or the damaged cell will self-destruct. If the DNA can be repaired, p53 activates other genes to fix the damage. If the DNA cannot be repaired, this protein prevents the cell from dividing and signals it to undergo self-destruction. By stopping cells with mutated or damaged DNA from dividing, p53 helps prevent the development of tumors.

image

TP53: A central mediator of stress responses. Source: https://p53.fr/images/image_info/TP53_Knowledge/TP53_Pathtway_2.png

(ii) For sequencing, I would choose the Illumina Sequencing (Sequencing by Synthesis).

GenerationIt is second generation because it sequences millions of DNA fragments at the same time (massively parallel sequencing), requires PCR amplification first (cluster generation on a flow cell) and it produces short reads (usually 75-300 base pairs).
Input & PreparationThe biological input would be the human genomic DNA, like blood tissues or cultured cells, or molecular input like double stranded DNA fragments. How to prepare the input: DNA extraction ➜ Fragmentation ➜ End Repair and A-Tailing ➜ Adapter Ligation ➜ PCR Amplification ➜ Library Quantification
How it reads the DNAIllumina uses the fluorescent reversible terminator nucleotides. One labeled nucleotide (A, T, C, G) is incorporated, the terminator prevents further extension, the laser excites fluorophore and the camera detects the emitted color. This is how the base is identified and each color responds to one base.
OutputIllumina produces raw data files (BCL files) converted into FastQ files. This contains sequence reads and quality scores.
5.2 DNA Write

(i) If I could synthesize a gene, I would choose synthesizing nitrogen-fixation genes for crops.

Why are nitrogen fixating crops so powerful?

➜ Right now, only legumes (like beans and peas) form symbiosis with nitrogen-fixing bacteria such as Rhizobium

➜ Major crops (wheat, rice, maize) rely heavily on synthetic fertilizer

➜ Fertilizer production uses the Haber–Bosch process, which is extremely energy-intensive

➜ If cereal crops could fix nitrogen, there would be massive reduction in greenhouse gas emissions, lower farming crops, less nitrate pollution in rivers and improved soil health.

➜ Unfortunately, nitrogen fixation is a complex process because nitrogen requires ~15–20 genes (nifHDK and accessory genes), tight regulatory control and metal cofactors (Mo-Fe clusters).

➜ Key genes include nifH, nifD, and nifK.

(ii) I would use the Oxford Nanopore method (Longs-read sequencing)

1. Essential steps:

  • High-molecular-weight DNA extraction
  • Adapter attachment
  • DNA passes through nanopore protein
  • Electrical signal changes detected
  • Base calling via AI algorithms

It is essential for very long reads, it can sequence an entire nif cluster in one read and it detects structural variations easily.

2. Limitations:

The Oxford Nanopore method has raw accuracy, more insertion/deletion errors and it requires strong computational analysis.
5.3 DNA Edit

(i) If I could edit a gene, I would edit disease vectors (Gene Drives), specifically Mosquito Malaria Control.

Why did I choose this editing?

The main species targeted is the mosquito Anopheles gambiae. This species spreads malaria by transmitting the parasite Plasmodium falciparum. Malaria is a very problematic disease because it kills hundreds of thousands of people per year- mostly children.

By editing Anopheles gambiae with gene drives, the mosquito can be sterile and it would prevent transmitting the malaria parasite. I would edit a fertility gene (often doublesex) and attach a CRISPR-based gene drive. This will lead to the breeding of modified mosquitoes, the gene drive would copy itself into the partner chromosome and nearly all of the offsprings inherit it. But as good as this sounds, there are obstacles, such as arising new mutaions that break the CRISPR target site, preserve fertility and outcome the drive.

image

CRISPR technologies for the control and study of malaria. Source: https://media.springernature.com/lw685/springer-static/image/art%3A10.1186%2Fs13071-025-06905-w/MediaObjects/13071_2025_6905_Fig1_HTML.png

(ii) I would use CRISPR-Cas9 combined with a gene drive cassette as the technology to edit the gene.

How CRISPR edits DNA and the essential stepsCRISPR–Cas9 editing works in 3 core steps: Target recognition, DNA cleavage and Repair pathway determines outcome. For a gene drive, the inserted cassete includes a Cas9 gene, sgRNA gene and homology arms. After cutting the wild-type allele, the cell uses the gene drive allele as the repair template, the drive copies itself and the organism becomes homozygous. The essential steps are:

1. Target gene selection

Choosing a gene critical for female fertility or parasite transmission

2. Guide RNA design

Using bioinformatics tools to identify unique 20-nt target sequence, minimize off-target matches and avoid polymorphic regions

3. Construct Gene Drive Cassete

The components include Cas9 coding sequence, germline-specific promoter, sgRNA expression cassette and homology arms (~1 kb each side)

4. Embryo Microinjection

Inputs delivered into early embryos

5. Screening

6. Contained Population Testing

Input & Preparation

Input: Cas9 enzyme (or Cas9 expression plasmid), sgRNA sequence, donor DNA template with homology arms, promoter sequences, selectable marker, mosquito embryos, microinjection equipment and PCR primers for validation.

Design preparation ➜ whole genome sequence analysis, off-target prediction, population genetic modelling, ecological modelling

Limitaions in terms of efficiency or precision

1. Resistance Alleles

Mutations disrupt target site, the drive no longer cuts and it could lead to surviving of resistant mosquitoes

2. Off-target effects

Crispr may cut unintended sites and it can cause fitness defects and unpredictable phenotypes

3. Evolutionary Instability

The parasites may evolve resistance and the gene flow between populations complicates spread

References
  • https://www.universityofcalifornia.edu/news/how-glow-dark-jellyfish-inspired-scientific-revolution?
  • https://www.uniprot.org/uniprotkb/P42212/entry
  • https://medlineplus.gov/genetics/gene/tp53/#:~:text=The%20TP53%20gene%20provides%20instructions,or%20in%20an%20uncontrolled%20way.
  • https://pmc.ncbi.nlm.nih.gov/articles/PMC10030364/#:~:text=Sierra%20Mixe%2C%20a%20maize%20variety,exploited%20to%20increase%20crop%20productivity.
  • https://www.nature.com/articles/s41434-024-00468-8