https://pages.htgaa.org/2026a/andrei-vasilan/homework/week-05-homework-protein-design-part-ii/index.htmlProtein Design Part II Homework: Part 1 protein sequence (with A4V mutation): ATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGATSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLAAGVIGIAQ Part 2: Firstly, I want to highlight a few hallmarks of the human protein SD01: The N-terminus is located near the C-terminus The residues 3 to 9, thus including the A4V mutation, form a beta-strand. Human SD01 is rich in beta-strands The peptide appears to bind on the surface of the protein in the opposite part of the N-terminus.Hugoen