Homework

Weekly homework submissions:

  • Week 1 HW: Principles and Practices

    1.Biological engineering tool/application I am trying to develop a dyeing method for fabrics and surfaces by using Physarum Polycephalum, or the slime mould as an activator. The aim is to let the slime mould create one-of-one designs by growing on the surface, letting a level of unpredictabiity of growth control the outcome. Slime moulds are very good at creating pathways while expanding in search of optimum survival conditons. During this travel, they tend to leave behind residual pigment, usually yellow in colour. After drying it looks something like this. In this bioengineered application, physarum polycephalum expresses a pigment forming enzyme(tyrosinase/laccase-type oxidase) that catalyzes the oxidation of benign phenolic or cathechol precursors into reactive quinones that polymerize into and insoluble melanin-like pigment.

  • Week 2 HW: DNA read-write-edit

    Part 1: Gel Electrophoresis Due to no access to equipment and space for gel electrophoresis I simulated the same to understand the process on https://www.labxchange.org/library/items/lb:LabXchange:9548bee3:lx_simulation:1?fullscreen=true Workflow Design plasmid DNA with protein of interest →Transform bacteria with plasmid DNA→Get many copies of plasmid DNA→introduction of plasmid DNA to cells

Subsections of Homework

Week 1 HW: Principles and Practices

cover image cover image

1.Biological engineering tool/application

I am trying to develop a dyeing method for fabrics and surfaces by using Physarum Polycephalum, or the slime mould as an activator. The aim is to let the slime mould create one-of-one designs by growing on the surface, letting a level of unpredictabiity of growth control the outcome. Slime moulds are very good at creating pathways while expanding in search of optimum survival conditons. During this travel, they tend to leave behind residual pigment, usually yellow in colour. After drying it looks something like this. cover image cover image In this bioengineered application, physarum polycephalum expresses a pigment forming enzyme(tyrosinase/laccase-type oxidase) that catalyzes the oxidation of benign phenolic or cathechol precursors into reactive quinones that polymerize into and insoluble melanin-like pigment.

The target surface/fabric is to be first coated with a reservoir layer (mild binder+humectant) that is stable and non-coloured when dry. As the plasmodium (active foraging stage of slime mould), it leaves back a hydrateed, anionic extracellular slime film (acidic polysaccharide rich) that locally rehydrates the layer and provides a high water, ionically active environment for the reaction to take place. Enzyme delivered at the surface via organism converts the reservoir layer into pigment only with the trail’s footprint, and the newly formed polymer precipitates in place. The slime’s polyanionic matrix and the binder layer together act as immobilizing scaffold, physically and electrostatically retainining the pigment on fibres so the organism still moves while the dyed path remains as a persistent spatial record of its presence.

2.Next, describe one or more governance/policy goals related to ensuring that this application or tool contributes to an “ethical” future, like ensuring non-malfeasance (preventing harm). Break big goals down into two or more specific sub-goals. Below is one example framework (developed in the context of synthetic genomics) you can choose to use or adapt, or you can develop your own. The example was developed to consider policy goals of ensuring safety and security, alongside other goals, like promoting constructive uses, but you could propose other goals for example, those relating to equity or autonomy.

2.Safety + Non-malfeasance

Exposure:

Ensuring rigourous quality tests ensuring the engineered organism/pigment polymer/enzyme does not create risks like allergens/irritation, sensitizers, or use unsafe binders/precursors with result in volatile+unpredicatble by-products. Developing narrow function envelope for the to curb new emergent pathways that may produce undocumented results. Create a timeline documenting the processes that have been enacted and by which actors. Ensure “program changes” cannot be done by end-users (e.g., no easy swapping of genetic payloads or addition of external DNA to redirect production).

Containment and handling:

Developing systems that prevent accidental spread/mishandling of the GMO from the process of R&D to Distribution to end-of -life. (Develop clear handling protocols, containment during demonstrations and training, maintaining workspaces etc.) Ensuring design features that reduce aerosolization/smearing (sealed edges, protective breathable membranes, simple decontamination steps for handlers). Making failure modes public will also ensure the same errors are not repeated

Environmental safety:

Ensuring all the agents used in the process especially the GMO go through assess,,emt of whether it can sporulate in local environments and accordingly come up with stronger safeguarding.

Assessing toxicity levels for precursors and binders to avoid accumulative compounds post end-of-life. Ensuring biological activity is terminated before disposal and the waste is integrated with local waste stream systems.

3.Governance actions

image image

Matrix

Option 1: Tiered containment + targeted efficacy Option 2:DNA Synthesis screening + Dual genetic safeguard requirement Option 3:Standardizing end-of-life management

1 = strongest , 3 = weakest

Does the option:Option 1Option 2Option 3
Enhance Biosecurity
• By preventing incidents111
• By helping respond211
Foster Lab Safety
• By preventing incident113
• By helping respond213
Protect the environment
• By preventing incidents131
• By helping respond131
Other considerations
• Minimizing costs and burdens to stakeholders233
• Feasibility?232
• Not impede research232
• Promote constructive applications111

A radial graph to show the level of involvement of different actors in enforcing policies image image

5. Ideal combination

My choice of policies is to combine Dual safeguard and screening of developed application + Standardizing end-of-life management Choosing option 1 would reduce the scope of innovation, but Option 2 that ensures thourough assessment of the modified product whcih enables it to be replicated and scaled widely. It also mitigates concerns like pathogenic propogation risks, mutations in local environments, and/or any unintended consequences since a standardized model of development will be certified and followed.

Standardization of post-use processes also ensures responsible disposal of the product again, applied to the same scale.

Answers to questions from Professor Jacobson

  1. DNA Polymerase has an inherent error rate of 1 in (10^{5}) to (10^{6}) bases. Human genome’s size is (\approx 3\times 10^{9}) base pairs. If replication is 100 percent efficient 0 errors would occur. With mistakes at (10^{-5}) rate it would result in 30,000 to 50,000 errors. Due to post replication mismatch error the final error rate in human cells is reduced to less than 10 mutations per genome per replication. To deal with this, enzymes ((\delta ) and (\epsilon )) check each nucleotide as they go, removing mispaired bases instantly, increasing accuracy 100-fold. After replication fork passes special repair proeins scan newly synthesized DNA for mismatches that slipped past the proofreading step and throughout the cell cycle other mechanisms like base excision repair nucleotide excision repair fixes spontaneous damage that could possibly cause a failure.

  2. An average human protein (~450-500 amino acids) can be coded by different DNA sequences, potentially exceeding (10^{100}) possibilities, due to the genetic code’s degeneracy (61 codons for 20 amino acids). The reasons for failure to produce functional proteins are due to cases of improper protein folding, premature stop codons, incorrect splicing etc.

Answers to questions from Dr.LeProust

  1. The mist used method currently is solid-phase phosphoramidite chemistry.
  2. It is difficult due to exponential accumulation of minor chemical errors and significant drops in overall yield.
  3. It is again not possible due to the limitations of the phosphoramidite chemistry. While it is possible to make them assembling shorter, multiple, purified and error checked oligonucleotides of around 50-100 bases long, attempting to make it in one go may result in extremely low yields, high error rates, inability to purify long correct and single stranded molecule.

Answers to quesitons from Prof. George Church

  1. The 10 essential amino acids are lysine, methionine, tryptophan, threonine, valine, isoleucine, leucine, arginine, histidine and phenylalanine. 10 amino acids I think lysine contingency is not a failsafe biocontainment strategy, it is available in food. It is a good way to look at what started as an example from fiction, to understanding biocontainment in real -life scenarios. What will happen if a synthetic organism is released in the wild, or how will it evolve as natural forces act upon it.

Week 2 HW: DNA read-write-edit

Part 1: Gel Electrophoresis

Due to no access to equipment and space for gel electrophoresis I simulated the same to understand the process on https://www.labxchange.org/library/items/lb:LabXchange:9548bee3:lx_simulation:1?fullscreen=true

cover image cover image Workflow Design plasmid DNA with protein of interest →Transform bacteria with plasmid DNA→Get many copies of plasmid DNA→introduction of plasmid DNA to cells

Working in Benchling

After signing in I imported it into Benching and ran digests for EcoRI HindIII BamHI KpnI EcoRV SacI SalI

cover image cover image

And then ran digests on SalI SacI BamHI KpnI EcoRV BamHI KpnI SacI SalI

to create an Elephant! 🐘

cover image cover image

For this, I referred to an iGem video to understand how enzyme digesting works as well https://www.youtube.com/watch?v=7cGev-SKLao

DNA design challenge

Chosen protein : Actin

tr|D3BD07|D3BD07_HETP5 Actin OS=Heterostelium pallidum (strain ATCC 26659 / Pp 5 / PN500) OX=670386 GN=act10 PE=3 SV=1 MEGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQ SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLD LAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFENEMQTAASSSALEKS YELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVL SGGTTMFPGIADRMQKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK EEYDESGPSIVHRKCF

Reverse translated

ATGGAAGGCGACGTTCAAGCGCTGGTGATCGACAATGGTTCTGGCATGTAAAGCGGGTTTCGCAGGCGACGACGCACCGCGCGCGCGCGTTCTTTCCTTCGATTGTGCGCCGTCGCCGTCATACCGGCGTGATGGTTGTGGGGATGCAGCAAGAGGACTCCTACGTGGGCGACGAGGCGCAGTCGAAAGGTGGGATCCTGACCCTGAAGTACCCGATCGAACACGGGATTGGTGACTAACAATGGGACGATATGAAGGAAATCTGGCACCACACGTTCTTATAACGAATTAAGAGTGGCGCCGGAAGAACCAGTTCCTGTGCTGCTGACCGAGGCGCCGCTGAACCCGAAAGCCAACCGTGAAGAAATGAAGACCAGGATTATGTTTGAACCTTTC AACACGCCGGCGATGTATGTGGCGATTCAAGCGGTGTTGTCGCTGTATGCCTCGGGTCGTACCACC GGTATTGTGATGGATTCTGGCGACGGCGTGTCCCATACGGTGCCCATCTATGAAGGTTATGCCTTACCGCACCGCATCCTCCGCCTGGATCTGGCGGGTCGCGATCTGACTGAC TATATGATGAAGATCCTGACTGAACGTGGTTATTCGTTTACGACCACCGCCGAAAGGGAaatcgtcgacatc aaagagaagctggcgtatgtggcacttgatttcgagaacgagatgcaaacggcggcgTCGTCGTCGTCGCGTTGAA AAGTCG TATGAACTGCCG GACGGCCAGGTCATCACTATCGGTAACGAACGTTTC CGCTGCCCTGCGCTTTCAACCGTCGTTCTTAGGCATGGAAAGCGCGGGCA TACACGAAACCACGTACAACAGCATTATGAAATGC GATGTCGACATT CGCAAGGATCTGTATGGTAACGTGGTCCTGGGCGGCACCACGATGTTCCCGGGCATCGCCGAACG CATGCAAGAAACTGACCACCGCGCTGGCGCCGTCGACCATGAAAATCAAGATCATTGCCGCGCCGGAACGTAAGTCTTGGGTCATCGGCGGC TCGTTGGCCTCGTCGACCTTC CAGCAGATG TGGATCAGCAAAGAAGAG TATGACGAAAGCGGTCCTTCGGTGATCCACCGTAAGTTCTTCGCGAAACCGCAAGATTAA

optimized codon sequence

Optimized DNA Sequence (1122 bp)

atggaaggcgatgtccaggcgctggtgatcgacaacggctccggcatgaaggccggcttcgccggcgatgatgcccccagggcggcggtgtcttcccctcgatcgtgggccgtccgcgtcacaccggtgtgatggtggtgggtatgcagcagaaagattcctatgtgggcgacgaagcgcaatcgaaagggcatcctgaccctgaagtatccgatcgagcatggcatcgtgaacaactgggacatggagaagatctggcaccacatgttctacaacgagctgcgtgtggcgccggaagaaccccacgtgctgctgaccgaggcgccgctgaacccgaaggccaaccgtgaacgcaagatgaagaccaggatcatgatgttcgaacagttcaacacgccggcgatgtatgtggcgattcaagcggtgctgtcgctgtatgcctcgggccgtaccaccggcatcgtgatggactccggcgatggcgtttcccacatcgtgcccatctatgaaggctatgcgctgccgcatgccatcctgcgcctggatctggcgggcagggatctgaccgactacatgatgaagatcctgaccgaacgcggttatagcttcaccaccaccgcggagaagatcgtccgggacatcaagaagaaactggcgtatgtggcgctcgatttcgaaaacgaaatgcaagcgaccgcgagctcgagcgccctggagaagtcgtatgagctgccggacggccaggtgatcaccatcggcaacgaacgcttccgttgccctgccgctgttccagccctcgttcggcatggagagcgccggcatccatgagaccacctacaacagcatcatgaagacctgcgatgtggacatccgcaaggacctgtatggcaacgtggtgctcggcggcaccaccatgttccccggcatcgccgacaggatgcaaaaggagctgaccgccgcgctgccgcccagcaccatgaagatcaagatcatcgcgccgccggagcgtaagtcgtgggtgatcggcggctcgctggcgagcctgagcacgttccagcagatgtggatcagcaaggaggaatacgacgagtcgggcccgagcatcgtgcaccgcaagtgcttcggcaagcgcaagatgaa