Charles Naney — HTGAA Spring 2026

cover image cover image

About me

HTGAA Committed Listener (CL) Agreement

I am a HTGAA Committed Listener, my responsibilities are:

Watching class lectures and recitations Participating in node reviews Developing and documenting my homework Actively communicating with other students and TAs on the forum Allowing HTGAA and BioClub to share my work (with attribution) Honestly reporting on my work, and appropriately attributing and citing the work of others (both human and non-human) Following locally applicable health and safety guidance Promoting a respectful environment free of harassment and discrimination Signed by committing this file to my documentation page/repository,

Charles (Charley) C. Naney

2Mar2026

Contact info

Homework

Labs

Projects

Subsections of Charles Naney — HTGAA Spring 2026

Homework

Weekly homework submissions:

  • Week 1 HW: HTBAA Homework

    (Arche-Warder-Landschaftstier-Park)[content/homework/Week-01-HW-HTBAA26/IMG_8785.jpeg] This semester, for my project, I am tackling the problem of soiled hay on the goat farm. Yep, I have had it up to here with all this sh*#. It’s not a bad problem for a biomanufacturing course like HTBAA, though. Let me back up a bit. My name is Charley Naney, and I am a goat and sheep farmer and a Ph.D. in Bioscience at North Carolina Agricultural and Technical State University. In the lab, I study bidirectional interactions between Metazoan host physiology and Microbiomes related to oxidative stress in aging and spaceflight (Naney, 2026). On the farm, I push hay and shovel waste from my goats and sheep. I also have chickens and turkeys, but cycling their waste is an entirely different challenge that I will not be addressing this semester.

  • Week 1 HW: Principles and Practices

    Class Assignment — DUE BY START OF FEB 10 LECTURE Question 01 First, describe a biological engineering application or tool you want to develop and why. This could be inspired by an idea for your HTGAA class project and/or something for which you are already doing in your research, or something you are just curious about. According to the well-regarded popular science writer Matthew Cobb (2022), since the Asilomar conference in 1975, molecular biologists have been the vanguard in self-regulating when playing God. This means we refrain from conducting our research irresponsibly by deploying unnecessarily hazardous experimental methods. Alas, this also means that some of the most exciting genetic engineering is no longer done. Consider Dr. Oswald Avery’s transforming principle experiment. Blindly take a population of virulent pneumonia bacteria and feed them harmless kin until they lose their aggressive function and magically adapt into weak and indifferent pneumonia. Since Asilomar, this is indeed one kind of experiment that trustworthy principal investigators must abstain from. I get it, and still I contemplate. Wasn’t Avery the best of us, though? Between Schrodinger and Watson, Crick, and Franklin – Dr. Avery intuited DNA into existence with his transforming principle and used it effectively. Surely I didn’t name my oldest son after this man for nothing?

  • Week 2 HW: DNA Read Write and Edit

    Table of contents Software used: Terminal, git, xcode, hugo, benchling, rcdonovan website, twist website. Objective: This week explores the read–write–edit toolkit: sequencing and synthesis workflows, restriction digests and gel electrophoresis, and early genome-editing frameworks.

  • Week 3 HW: Lab Automation

    Homework for HTGAA 2026 (Week 03): Lab Automation Table of contents Software used: Terminal, git, Opentrons, rcdonovan website, Google Colab. Objective: This week we get hands-on (or at least code-on) with pipetting robots.

  • Week 4 HW: Protein Design Part I

    Homework: Protein Design I Assignment Objective: Learn basic concepts: amino acid structure, 3D protein visualization, and the variety of ML-based design tools. Brainstorm as a group how to apply these tools to engineer a better bacteriophage (setting the stage for the final project).

  • Week 5 HW: Protein Design Part ii

    [] Homework — DUE BY START OF MAR 10 LECTURE Part A: SOD1 Binder Peptide Design (From Pranam) Superoxide dismutase 1 (SOD1) is a cytosolic antioxidant enzyme that converts superoxide radicals into hydrogen peroxide and oxygen. In its native state, it forms a stable homodimer and binds copper and zinc. Mechanis Mutations in SOD1 cause familial Amyotrophic Lateral Sclerosis (ALS). Among them, the A4V mutation (Alanine → Valine at residue 4) leads to one of the most aggressive forms of the disease. The mutation subtly destabilizes the N-terminus, perturbs folding energetics, and promotes toxic aggregation.

  • Week 6 HW: Genetic Circuits Part i

    []Homework — DUE BY START OF MAR 17 LECTURE Week 6 HW: Genetic Circuits Part 01 Assignment: DNA Assembly Protocol and Study Questions What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose? A proprietary gold standard heat-stable DNA polymerase alternative to Taq reagent synthesized and sold by Thermo Fisher Scientific. Unlike Taq which was isolated from thermophilic bacteria, Phusion emulates an archaea-based enzyme that evolved in the hydrothermal vents from extremeophile species. They function as DNA polymerases essentially in a form biomimickry with minimal replication error. The purpose of Phusion is to amplify target DNA sequences in the PCR protocol. Phusion PCR is more expensive but worth the investment to increase the accuracy of the run.

  • Week 7 HW: Genetic Circuits Part 2

    []Homework — DUE BY START OF MAR 31 LECTURE at 2PM ET Week 7 HW: Genetic Circuits Part 2 Assignment Part 1: Intracellular Artificial Neural Networks (IANNs) What advantages do IANNs have over traditional genetic circuits, whose input/output behaviors are Boolean functions? IANNs are ideal for the continuous transcriptomic-driven change observed in cells that are constantly moving and communicating in their intracellular environment – through analog computations. In contrast, much of the early synbio genetic circuit engineering was digital, with discrete logic gate switch programming or perhaps even through gene knock out (present versus absent) if such a connection would be permitted.

  • Week 9 HW: Cell Free Systems

    [] Homework — DUE BY START OF Apr 7 LECTURE Homework Part A: General and Lecturer-Specific Questions General homework questions Explain the main advantages of cell-free protein synthesis over traditional in vivo methods, specifically in terms of flexibility and control over experimental variables. Name at least two cases where cell-free expression is more beneficial than cell production. Describe the main components of a cell-free expression system and explain the role of each component. Why is energy provision regeneration critical in cell-free systems? Describe a method you could use to ensure continuous ATP supply in your cell-free experiment. Let it be noted, I really want to use George AI to engage this question, but I am running out of time, so I am just pitching shots up on the green to try and finish off with a putter and I also recognize metaphors are symptomatic of a weak mind, so there you have it. This is why we need AI too. Most people are susceptible to weak-minded syndrome. Therefore, since my overall understanding of what I am describing here is dulled, please do not try any of this at home. The bioenergetic cycles we wish to reconstruct in the cell-free environment literally resemble a water mill. I start with these two examples because one makes sense to me, and the other appears to be the same engineering concept but now there are some critical features missing that makes it more difficult to reconstruct the working order of things. I believe the same problem challenges us with cell-free systems. We have all the parts and experiments are clearly designed but what sustains them? There are clearly hidden variables that cannot be intuited at first glance. Now I am afraid if just put up my next image it will be swept away do to copyright infringement laws since I didn’t personally take a picture of this biochemical pathway. The irony of course is that the water mill and whatever mill above were invented when Newton was still alive if not before, likely long before, anyway the cellular aerobic respiration cycle was discovered inside of living organisms on Earth. In addition, we should note that the cellular cycle is part of many interacting open systems, and the other two mills are closed systems embedded in open living systems. Infact, is there anything sadder than a watermill without water for there in the bones of brick and iron is a functionless relic of a time before atomic energy had been harnessed. Perhaps a time we will return to in the end, but enough conjecture.

  • Week 10 HW: Imaging and Measurement

    Week 10 HW: Imaging and Measurement Homework: Final Project Homework is partly based on data that will be generated in the Waters Immerse Lab in Cambridge, MA. Students will characterize green fluorescent protein (eGFP, a recombinant protein standard) structure (primary, secondary/tertiary) in the lab using liquid chromatography and mass spectrometry, as well as Keyhole Limpet Hemocyanin (KLH) oligomeric states using charge detection mass spectrometry (CDMS). Data generated in the lab needed to do the homework is included both within this document and in the Appendix of the laboratory protocol. Please identify at least one (ideally many) aspect(s) of your project that you will measure. It could be the mass or sequence of a protein, the presence, absence, or quantity of a biomarker, etc. Please describe all of the elements you would like to measure, and furthermore describe how you will perform these measurements. There are many measurements that could be taken. The DNA of the mites and their larva is a target. In addition the bacteria and other microbiota and parasites that capitalize on the infestation damage to the host epidermis. This ofcourse brings up the geometry of the host tissue and biochemical molecules all of which can be measured quantiatively or qualitatively. Specifically, when it comes to host cells there are living and deceased keratinocytes and corneocytes and the odd hair follicle, especially in most heavily infested cases. There is superinfection residues full of bacterial cocci and rods or periods and semi colons as Dr. Betsy Dyer writes. There crushed and desciated erythrocytes, platelets, and leukocytes. In addition there will be scattering fluctuations of neturophils, eosinophils, macrophages, and lymphocytes. In addition, goats are always on the move grazing when they’re not cuddled up in hay or dirt. Therefore there will be pollen grains, plant frags, seed husks and hay chaff, and plant hairs in addition to other ecotoparasites. What I want to measure most though is stress.

  • Week 11 HW: Building Genomes

    Homework — DUE BY START OF APR 28 LECTURE Week 11 HW Overview Part A: The 1,536 Pixel Artwork Canvas | Collective Artwork [!info] Note that this homework is due a week later than it ordinarily would due to its release a week later than normal. [x] Contribute at least one pixel to this global artwork experiment before the editing ends on Sunday 4/19 at 11:59 PM EST.

  • Week 12 HW: Bioproduction and Cloud Labs

    Week 12 HW Overview Assignment Part 1: Work on individual final project Reading & Resources

  • Week 13 HW: Bio Design Living Materials

    Week 13 HW Overview Assignment Part 1: > Work on individual final project. Reading & Resources

  • Week 14 HW: Biofabrication

    Week 14 HW Overview Assignment Part 1: Work on individual final project. Reading & Resources

Subsections of Homework

Week 1 HW: HTBAA Homework

(Arche-Warder-Landschaftstier-Park)[content/homework/Week-01-HW-HTBAA26/IMG_8785.jpeg]

This semester, for my project, I am tackling the problem of soiled hay on the goat farm. Yep, I have had it up to here with all this sh*#. It’s not a bad problem for a biomanufacturing course like HTBAA, though.

Let me back up a bit. My name is Charley Naney, and I am a goat and sheep farmer and a Ph.D. in Bioscience at North Carolina Agricultural and Technical State University. In the lab, I study bidirectional interactions between Metazoan host physiology and Microbiomes related to oxidative stress in aging and spaceflight (Naney, 2026). On the farm, I push hay and shovel waste from my goats and sheep. I also have chickens and turkeys, but cycling their waste is an entirely different challenge that I will not be addressing this semester.

Week 1 HW: Principles and Practices

loomings loomings

Class Assignment — DUE BY START OF FEB 10 LECTURE

Question 01

First, describe a biological engineering application or tool you want to develop and why. This could be inspired by an idea for your HTGAA class project and/or something for which you are already doing in your research, or something you are just curious about.

According to the well-regarded popular science writer Matthew Cobb (2022), since the Asilomar conference in 1975, molecular biologists have been the vanguard in self-regulating when playing God. This means we refrain from conducting our research irresponsibly by deploying unnecessarily hazardous experimental methods. Alas, this also means that some of the most exciting genetic engineering is no longer done. Consider Dr. Oswald Avery’s transforming principle experiment. Blindly take a population of virulent pneumonia bacteria and feed them harmless kin until they lose their aggressive function and magically adapt into weak and indifferent pneumonia. Since Asilomar, this is indeed one kind of experiment that trustworthy principal investigators must abstain from. I get it, and still I contemplate. Wasn’t Avery the best of us, though? Between Schrodinger and Watson, Crick, and Franklin – Dr. Avery intuited DNA into existence with his transforming principle and used it effectively. Surely I didn’t name my oldest son after this man for nothing?

Unlike Dr. Avery, I am fortunate to be proposing my HTGAA 2026 project after the discovery of DNA and the Asilomar conference and the Once-in-a-Century Pandemic when mRNA Vaccines and CRISPR gene editing approaches were available. However, like Avery, with molecular biology, we can still take a population perspective to current wicked health problems. My first professional mentor, Dr. Paul Farmer, would often credit his milieu caring for the poorest of the poor as the center of his mission. Though I once aspired to that also, I now reflect that I am fortunate to just be an aspiring Molecular Biologist. In addition, when I marvel over everything that has been achieved since Avery, especially since the Human Genome Project and the advances of systems biology to synthetic biology, I see there are now viable alternatives in biological practice to help others and the living world.

This brings me to the project. I agree with Dr. Aubrey De Grey that biological aging is a vexing, immutable inequality in public health that must be solved. In fact, I am engaged in this research with my excellent Biology PHD mentors at North Carolina Agricultural and Technical State University (NCATSU), and one of them was on the team that first postponed senescence in Drosophila back when Star Wars movies were worthy of the hype.

Like Dr. De Grey, I believe exit velocity will be achieved in our lifetimes by engineering negligible senescence. The difference is that his model species are cohorts of robust, rejuvenated rodents centralized in a single laboratory, and I propose we develop many sites and open science approaches using goats instead. I also think that we will need to develop applied computational systems biology simulators (synthetic biology simulators too if they exist) and at the center of the approach needs to be the host-microbiome.

Why goats? They’re not even a monogastric species. Please hear me out.

According to ChatGPT, the oldest recorded goat in the Guinness World Records is McGinty (22 years, 5 months). The buck was a Brition, he was male, and from a Pygmy breed. My understanding is that Pygmy goats were originally bred to feed large cats. This record was set in 2003 and I assume it hasn’t been challenged since. Although I never had the pleasure of meeting McGinty, the general indifference evident by his nefarious name and the dusting of a few social media posts and overall absence of life-history information makes plain that likely society gave up on even understanding goat longevity decades ago. This means that despite living among Homo sapiens for more than 10,000 years and sustaining us in every challenging environment on Earth, we still know more about goats’ genomic diversity than life history. That’s not a bad thing, though, because goats’ genomes and immune systems are as infinitely fascinating as our own.

In addition to not being popular, goats live a life preoccupied by parasites, predators, and food insecurity that is only moderately improved by domestication, let’s be honest. I often reflect on the goats I met in the Galapagos Islands – the first example of extreme biological environments. Goats are not indigenous to the Galapagos. They are migrants. They didn’t migrate there on their own volition, though – instead they brought in rafts and boats a Century ago, and still to this few re-wilded stragglers refuse to go extinct. In fact it’s hard to find an island in the Galapagos that doesn’t have a pile of goat skulls on it. I understand the issue is complicated but either way you land on the issue, it’s hard to deny that goats are specialists in acclimating in extreme environments. Ironically, it’s Charles Darwin’s theory of Natural Selection that I would like to structure the computational systems biology goat longevity simulator around, particularly using Neo-Darwinian genetics and postponement of senescence work by Rose, Muller, Luckinbill, and Graves.

I propose a Long Term Experimental Evolution (LTEE) study that leverages synthetic biology and local animal husbandry to study the role of gut microbiomes on cellular senescence in goats. I hypothesize that understanding diversity and abundance in genetic circuitry constituting biological signaling pathways between adaptive, senescence-resistant microbes and Metazoan somatic tissues will yield the putative attractor switches we need to cure cellular senescence and put apoptosis on a toggle switch. Theoretically, though I certainly don’t plan to achieve this in 10 weeks or morally at all. The point is that once you understand that one contingent evolutionary endosymbiotic event transformed an alpha-proteobacteria into the power center for every Metazoan cell that came after, and then the effects of the mitochondria on oxidative stress accumulation and stabilization. Inevitably, we can trust that the solution to aging in somatic cells will never again be an if question.

Endpoints I will be investigating are biologically and statistically significant variation in “aging” host and microbe genes identified through differential gene expression. The study will be a multigenerational LTEE for Synthetic Biology 101, targeting the bidirectional interactions between living goat genes and pathways and the microbiota in their gut. My stakeholders are the American Milk Goat Breeding Association and Nanopore, and every isolated mountain village or homesteader that is still alive because of their goat herd.


Question 2

GPG01: Explore synthetic biology for goat life history for a putative Mitocarta or SASP gene and phenotypic pathways that may be useful in future studies to bioengineer negligible senescence in goats.

GPG02: Integrate aim 1 gene with OMICs data using computational model to explore molecule mediated bidirectional interactions between somatic host cells and microbes in goat microbiomes.

GPG03: Consider systems-level synthetic biology interventions for extreme environments that support goat metabolism and gut microbiome health.


Question 3

Next, describe at least three different potential governance “actions” by considering the four aspects below (Purpose, Design,

Assumptions, Risks of Failure & “Success”). Try to outline a mix of actions (e.g. a new requirement/rule, incentive, or technical strategy) pursued by different “actors” (e.g. academic researchers, companies, federal regulators, law enforcement, etc). Draw upon your existing knowledge and a little additional digging, and feel free to use analogies to other domains (e.g. 3D printing, drones, financial systems, etc.). Purpose: What is done now and what changes are you proposing? Design: What is needed to make it “work”? (including the actor(s) involved - who must opt-in, fund, approve, or implement, etc) Assumptions: What could you have wrong (incorrect assumptions, uncertainties)? Risks of Failure & “Success”: How might this fail, including any unintended consequences of the “success” of your proposed actions?

CN Answer Purpose: Humans have been artifically selecting phenotypes in goats to consume for our benefit for more than 10,000 years. I understand goat meat, milk, and fiber are necessary for human differential reproductive success and maintenance. I actualy have a working goat farm. My purpose is not adjudicate my species, or rescue another, my intention is to use this incredible opportunity to make ammends to another population of Metazoans by helping my peers use synthetic biology to help goats live longer, higher quality lives. I do not pursue this idea to make a more profitable goat commodity either. In summation my reasoning at HW 1 is: because I know postponing senescence in Metazoans is possible and I care about the welfare of all goats, I want to help others and myself advance negligible senesence in goat somatic cells safely and humanly too. The changes I am proposing for my HTGAA 2026 project though are only to expand fair, accurate, timely, accessible open science data about goat life history and genetics, so through synthetic biology we can help goats live longer, healthier lives.

Design: Based on what I know about Synthetic Biology today, which is far less than I care to admit without embarassment on a public website. What is needed to make it “work” is Dr. Aubrey De Grey brillance, vision, ability and a sincere heart for animal welfare. Eventually a sustainable research enterprise plan will be useful to achieve endpoints, quality benchmarks, and safety standards. Let me make a clear point first though, all I am proposing at this juncture is cast out net for data, reel it in and evaluate what I find. This review will require oversite from experts – can anyone put me in contact with Dr. George Church or Dr. Aubrey De Grey?

Assumptions: I love this question because I am a scientist and I think no other discipline is more pragmatic than us when it comes to how we manage uncertainty. This is the crux about assumptions. Uncertainty is dangerous. Case and point, because I care about goat welfare and recognize I do not understand enough about Synthetic Biology interventions to expect what I don’t understand about goat life-history, physiology, and genetics I would never do anything to disrupt in vivo what I am learning to explain and make predictions about – that being the bioengineering of negligible senesence in goats.

Risks of Failure & “Success”: Here risk communication and management are key. I was an Epidemiologist for 20 years before going back to school. In Epidemiology although all Pandemics are orphans, a breech in prevention is always the root cause. I say this to explain why I am so proactive about preventing failure, especially when it comes to public health. Another example, is part of my PhD training was working in a Molecular Microbiology lab on a LTEE for NASA. Here a significant portion of the job is monitor and improve protocols and practice to minimize contamination, especially on a 100 day LTEE study.


Stakeholders: Registry of Standard Biological Parts (RSBP), SAB Biotherapeutics (SABBio), World Health Organization (WHO), Rocky Hill Farm in WV (RHFWV)

Rating Scale: ♛ Most Effective ♞ Moderately Effective ♟ Minimally Effective

Does the option:RSBPSABBioWHO
Explore synthetic biology for goat life history for a putative MitoCarta or SASP gene and phenotypic pathways that may be useful in future studies to bioengineer negligible senescence in goats.
• By reducing uncertainty about the life history of goats.♞♞♛
• By reducing uncertainty about synthetic biology interventions for negligible senescence in goats.♞
Integrate aim 1 gene with OMICs data using computational model to explore molecule mediated bidirectional interactions between somatic host cells and microbes in goat microbiomes.
• By mapping major biological signaling pathways where communication goes from goat somatic cell to -> GIT microbiome♞
• By mapping major biological signaling pathways where communication goes from GIT microbe in GIT microbiome to goat somatic cell or system♞
Consider systems-level synthetic biology interventions for extreme environments that support goat metabolism and gut microbiome health.
• By cataloging goat metabolites and microbiota and their interactions♟♟♟
• By modeling seed to goat food webs for diverse local environments.♟♟♟
• By writing an aspirational study protocol.♟♟♟
Other considerations
• Minimizing costs and burdens to stakeholders♟♟♛
• Feasibility?♟♟♟
• Not impede research♛♛♛
• Promote constructive applications♛♛♛

Assignment (Week 2 Lecture Prep) — DUE BY START OF FEB 10 LECTURE

In preparation for Week 2’s lecture on “DNA Read, Write, and Edit," please review these materials: Lecture 2 slides. The associated papers that are referenced in those slides. In addition, answer these questions in each faculty member’s section:

Homework Questions from Professor Jacobson:

Question 1

Nature’s machinery for copying DNA is called polymerase. What is the error rate of polymerase? How does this compare to the length of the human genome. How does biology deal with that discrepancy?

Based on the deck the error rate of polymerase is 1:10^6 or one error for every 1,000,000 base pairs. The size of the human genome according to the Molecular Biology of a Gene by Watson et al. (2007) the human genome is 3200 Mega base pairs in length which converts to 3,200,000,000 base pairs. Biology deals with the discrepancy through redundancy and replication forks moving from many different insertion sites at the same time. This way the redundancy offsets the discrepancy in the error rate. However errors still occur.


Question 2

How many different ways are there to code (DNA nucleotide code) for an average human protein? In practice what are some of the reasons that all of these different codes don’t work to code for the protein of interest?

There are two ways that I am aware of, Mass Spec and Edman Degredation. Both of these techniques identify amino residues that are synthesized as triple codons for a varity of lengths and structures. The total number of probable combinations is 3 codons multipled by 20 possible amino acids.


Homework Questions from Dr. LeProust: [Lecture 2 slides]

Question 1

What’s the most commonly used method for oligo synthesis currently?

Amplicon-Based Assays


Question 2

Why is it difficult to make oligos longer than 200nt via direct synthesis?

Turn-around time on results due to added complexity from higher Chimera rate, drop out rate, and uniformity constraints above 100nt


Question 3

Why can’t you make a 2000bp gene via direct oligo synthesis?

I couldn’t find an exact answer in the deck, but an article by Yin et al (2024) cited below, which is relatively up-to-date, reports that the current length record for direct oligo synthesis is between 800 mer - 1728 mer. This alone is an accomplishment since authors explain that the rate of errors increases significantly above 100nt. The article also discusses the original 1000nt ceiling due to the steric hindrance of the substrate macromolecule. Please forgive my answer being a little choppy; I am still learning how to converse in this language.

Yin, Y., Arneson, R., Yuan, Y., and Fang, S. (2025). Long oligos: Direct chemical synthesis of genes with up to 1728 nucleotides. Chemical Science, 16(4), 1966–1973. https://doi.org/10.1039/D4SC06958G


Homework Question from George Church: [Lecture 2 slides]

Choose ONE of the following three questions to answer; and please cite AI prompts or paper citations used, if any.

Question 1

[Using Google & Prof. Church’s slide #4] What are the 10 essential amino acids in all animals and how does this affect your view of the “Lysine Contingency”?


Question 2

[Given slides #2 & 4 (AA:NA and NA:NA codes)] What code would you suggest for AA:AA interactions?

Here I think you are asking me to provide an alternative code for the foundation of life? The irony is that is why I am here, I want you all to teach me how to rewrite code for AA:AA interactions. I know this because in preparing my answer I ran AA:AA interactions by AI for a second oppinion. My prompt was “what do you think Dr. George Church means by code for AA:AA interactions”. AI tells me that this code may need to demonstrate how sequences of amino acids influence physical interaction rules, which I interpret to be first order principles. Therefore what code would I suggest to influence AA:AA interactions that are able (if AI’s tip is correct) to perturb first order principles. My code as Dr. Nick Lane would say, should be efficient at turning the feedback loops of matter into biophysical waves of energy. In further prepartion I would turn to my greatest advisors in Natural Selection adaptation, bacteria and their metabolic motifs in Metazoans. I would need a coding system that respects phylogeny and doesn’t immagine I could ever devise a coding system more ingenious than the Krebs cycle or the molecularly machinery behind the deprotonation of hydrogen by Complex 5 in the Electron Transfer Chain. Still it’s a fascinating thought experiment if nothing else. To this end, I used your Acevodo-Rocha et al. (2016) paper and AI to find the Poliseno et al. (2024) paper and though I am not up-to-date on this team I do suspect there is an Epidemiologist among them, because their example of concordant and discordant pairing of coding and noncoding functions is what my coding system would be based on to optimize around the canonical rigidity of present AA:AA interaction.

Acevedo‐Rocha, C. G., & Budisa, N. (2016). Xenomicrobiology: A roadmap for genetic code engineering. Microbial Biotechnology, 9(5), 666–676. https://doi.org/10.1111/1751-7915.12398

Poliseno, L., Lanza, M., & Pandolfi, P. P. (2024). Coding, or non-coding, that is the question. Cell Research, 34(9), 609–629. https://doi.org/10.1038/s41422-024-00975-8

[(Advanced students)] Given the one paragraph abstracts for these real 2026 grant programs sketch a response to one of them or

devise one of your own:

https://arpa-h.gov/explore-funding/programs/boss https://www.darpa.mil/research/programs/smart-rbc https://www.darpa.mil/research/programs/go


Assignment (Your HTGAA Website) — DUE BY START OF FEB 10 LECTURE

Begin personalizing your HTGAA website in https://edit.htgaa.org/, starting with your homepage — fill in the template with

information about yourself, or remove what’s there and make it your own. Be creative! As with all assignments in HTGAA, be sure to

write up every part of this Homework on your HTGAA website in order to receive credit.


Important

For this week only, once your homework is complete and written up on your HTGAA website (and you’ve checked your published website at pages.htgaa.org and are happy with it), fill out the Homework 1 Completion form which David emailed out just after Lecture 1. This Google form expresses your interest in continuing with the course; without it you will not be accepted in HTGAA!

Week 2 HW: DNA Read Write and Edit

wk2_cover_image wk2_cover_image

Table of contents

Software used:

  • Terminal,
  • git,
  • xcode,
  • hugo,
  • benchling,
  • rcdonovan website,
  • twist website.

Objective:

This week explores the read–write–edit toolkit: sequencing and synthesis workflows, restriction digests and gel electrophoresis, and early genome-editing frameworks.

Background:

DNA Read (George Church), Write (Joe Jacobson), & Edit (Emily Leproust). In addition to recitation and Tokyo Biohub node lab meetings

Methods:

  • Start with touchpoint of Design stage of SynBio DBTL cycle with In-silico Gel Art
  • Build DNA fragments in Benchling with restriction digests for Testing with Gel Electrophoresis
  • Learn from Benchling work & In-silico Gel Art
  • Start to Design or
  • Gel Electrophoresis
  • Obtain protein sequences
  • Plasmid digestion with restriction enzymes,
  • Preparing Twist DNA Synthesis Order

Tasks:

  1. Documentation
  • Make sure to document every step of the in-silico and lab experiments. Make sketches, screenshots, notes, drawings… anything that helps you - and others - understand the experiment. Your documentation should help you - and others - to understand the topic. Don’t be afraid to add things that don’t work. Show your failures - and how you overcame them. Your Documentation should be a description of the amazing journey you are on!
  1. Part 0: Basics of Gel Electrophoresis
  • Attend or watch all the lectures and recitation videos. Optionally watch bootcamp.

Part 1: Benchling & In-silico Gel Art

See the Gel Art: Restriction Digests and Gel Electrophoresis protocol for details.

Overview:

  • The EcoRI RE is sourced from Escherichia coli> with palladrome cut at AATT 5’-GAATTC-3’ 3’-CTTAAG-5’ leaving a 5’ sticky end.
  • The BamHI RE is sourced from Bacillus amyloliquefaciens and scans for 5’-GGATCC-3’ 3’-CCTAGG-5’ to cut between G and G leaving a 5’ sticky end.
  • The HindIII RE is sourced from Haemophilus influenzae and scans for 5’-AAGCTT-3’ 3’-TTCGAA-5’ leaving a 5’ sticky end.
  • The KpnI RE is sourced from Klebsiella pneumoniae, it requires small molecule cofactors including Mg and Ca ions to complete cut with fidelity; uses 5’-GGTACC-3’ 3’-CCATGG-5’ and rather uniquely for this experimental RE set leaves a 3’ sticky end.
  • The EcoRV RE is sourced from Escherichia coli also and scans for 5’-GATATC-3’ 3’-GTATAG-5’ and leaves the blunt end for this RE set.
  • The SacI RE is sourced from Streptomyces achromogenes and scans for 5’-GAGCTC-3’ 3’-GTCGAG-5’ leaving a 5’ sticky end.
  • The SaII RE is sourced from Streptomyces albus and scans for 5’-GTCGAC-3’ 3’-CAGCTG-5’ leaving a 5’ sticky end.
  • Source: Recognition sequences and cleavage patterns were verified using the REBASE database (Roberts et al., 2015).
  • Create a pattern/image w/style of Paul Vanouse’s Latent Figure Protocol artworks.
  • Use Ronan’s website as a helpful tool for quickly iterating on designs! Here is the link [https://rcdonovan.com/gel-art].
Benchling_Virtual_Digest_Report Benchling_Virtual_Digest_Report

HW2 is structured purposefully to make us think like synbio engineers. For example, the reason we transition from Gel Electrophoresis to Restriction Digests is because we cannot move large strands of DNA and RNA through the GE matrix. We need small enough pieces of readable genetic material just to accomplish the lab assay. This makes RD a function necessary to achieve our design objectives. Benchling is a similar addition to the HW2 learning module, we need to see the restriction digests applied on our Lamba model and the computational ladder for converting the pieces of plasmid DNA in our GE matrix, it then helps that we can use Benchling in subsequent steps also.

Part 2: Gel Art - Restriction Digests and Gel Electrophoresis

Perform the lab experiment you designed in Part 1 and outlined in the Gel Art: Restriction Digests and Gel Electrophoresis protocol.

Now if your mind works like mine it might seem abrupt to leap from the movement of DNA through GE matrix to proteins but not if you understand the Central Dogma, sure, but even more the SynBio Design, Build, Test, Learn loop.

  • [https://doi.org/10.1371/journal.pbio.3002116]

Add a Bacterial chromosome and plasmid sequenced with Oxford Nanopore MiniON because I am annoyingly meticulous with discovery. In my HW2 discussion questions I am going to sing praises to Nanopore so also better to be consistent in DNA read inputs. I will download chromosome and plasmid DNA and load into Benchling. Please note the Genbank files do not play nicely with Benchling, so I will need to shift to FASTAs. Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775 > Chromosome GenBank: https://www.ncbi.nlm.nih.gov/nuccore/CP033092.2/ > CP033092.2 Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775 chromosome, complete genome > Plasmid GenBank: https://www.ncbi.nlm.nih.gov/nuccore/CP033091.2/ > CP033091.2 Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775 plasmid unnamed, complete sequence

Part 3: DNA Design Challenge

3.1. Choose your protein.

  • In recitation, we discussed that you will pick a protein for your homework that you find interesting. Which protein have you chosen and why? Using one of the tools described in recitation (NCBI, UniProt, google), obtain the protein sequence for the protein you chose.
  • [Example from our group homework, you may notice the particular format — The example below came from UniProt]
  • sp|P03609|LYS_BPMS2 Lysis protein OS=Escherichia phage MS2 OX=12022 PE=2 SV=1 METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLL EAVIRTVTTLQQLLT Considering: RpoS in E. coli K-12 will download Amino Acids for protein below and convert backwards to genome if I do not find an online reference that isn’t deleted.
83333_0:000b85 {"organism":"Escherichia coli K-12","genome_id":"GCF_000974885.1","pub_prot_id":"WP_000081588.1","pub_gene_id":"SF31_RS18190","description":"RNA polymerase sigma factor RpoS"}
MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEQEPSDNDLAEEELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE

https://www.ebi.ac.uk/interpro/result/InterProScan/iprscan5-R20260216-160122-0718-15835993-p1m/internal-1771257679016-348-1/ https://alphafold.ebi.ac.uk/entry/P13445 https://www.ncbi.nlm.nih.gov/datasets/gene/GCF_003697165.1/

Protien Code for RpoS Gene from NZ_CP033092.1:4177924-4178988 Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775 chromosome, complete genome

MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEEEPSDNDLAEEELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFREEVSICQKGQSQARLAFFLLVHGTC*

3.2. Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.

  • The Central Dogma discussed in class and recitation describes the process in which DNA sequence becomes transcribed and translated into protein. The Central Dogma gives us the framework to work backwards from a given protein sequence and infer the DNA sequence that the protein is derived from. Using one of the tools discussed in class, NCBI or online tools (google “reverse translation tools”), determine the nucleotide sequence that corresponds to the protein sequence you chose above.
  • [Example: Get to the original sequence of phage MS2 L-protein from its genome phage MS2 genome - Nucleotide - NCBI]
  • Lysis protein DNA sequence atggaaacccgattccctcagcaatcgcagcaaactccggcatctactaatagacgccggccattcaaacatgaggattacccatgtcgaagacaacaaagaagttcaactctttatgtattgatcttcctcgcgatctttctctcgaaatttaccaatcaattgcttctgtcgctactggaagcggtgatccgcacagtgacgactttacagcaattgcttacttaa
  • Nucleotide Sequence for my gene pick
>gnl|ECOLI|EG10510 rpoS RPOS-MONOMER (complement(2866559..2867551)) Escherichia coli K-12 substr. MG1655
atgAGTCAGA ATACGCTGAA AGTTCATGAT TTAAATGAAG ATGCGGAATT TGATGAGAAC
GGAGTTGAGG TTTTTGACGA AAAGGCCTTA GTAGAACAGG AACCCAGTGA TAACGATTTG
GCCGAAGAGG AACTGTTATC GCAGGGAGCC ACACAGCGTG TGTTGGACGC GACTCAGCTT
TACCTTGGTG AGATTGGTTA TTCACCACTG TTAACGGCCG AAGAAGAAGT TTATTTTGCG
CGTCGCGCAC TGCGTGGAGA TGTCGCCTCT CGCCGCCGGA TGATCGAGAG TAACTTGCGT
CTGGTGGTAA AAATTGCCCG CCGTTATGGC AATCGTGGTC TGGCGTTGCT GGACCTTATC
GAAGAGGGCA ACCTGGGGCT GATCCGCGCG GTAGAGAAGT TTGACCCGGA ACGTGGTTTC
CGCTTCTCAA CATACGCAAC CTGGTGGATT CGCCAGACGA TTGAACGGGC GATTATGAAC
CAAACCCGTA CTATTCGTTT GCCGATTCAC ATCGTAAAGG AGCTGAACGT TTACCTGCGA
ACCGCACGTG AGTTGTCCCA TAAGCTGGAC CATGAACCAA GTGCGGAAGA GATCGCAGAG
CAACTGGATA AGCCAGTTGA TGACGTCAGC CGTATGCTTC GTCTTAACGA GCGCATTACC
TCGGTAGACA CCCCGCTGGG TGGTGATTCC GAAAAAGCGT TGCTGGACAT CCTGGCCGAT
GAAAAAGAGA ACGGTCCGGA AGATACCACG CAAGATGACG ATATGAAGCA GAGCATCGTC
AAATGGCTGT TCGAGCTGAA CGCCAAACAG CGTGAAGTGC TGGCACGTCG ATTCGGTTTG
CTGGGGTACG AAGCGGCAAC ACTGGAAGAT GTAGGTCGTG AAATTGGCCT CACCCGTGAA
CGTGTTCGCC AGATTCAGGT TGAAGGCCTG CGCCGTTTGC GCGAAATCCT GCAAACGCAG
GGGCTGAATA TCGAAGCGCT GTTCCGCGAG taa

Nucleotide Code for RpoS Gene from NZ_CP033092.1:4177924-4178988 Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775 chromosome, complete genome (Forward 5’ to 3')

ATGAGTCAGAATACGCTGAAAGTTCATGATTTAAATGAAGATGCGGAATTTGATGAGAACGGAGTTGAGGTTTTTGACGAAAAGGCCTTAGTAGAAGAGGAACCCAGTGATAACGATTTGGCCGAAGAGGAACTGTTATCGCAGGGAGCCACACAGCGTGTGCTGGACGCGACTCAGCTTTACCTTGGTGAGATTGGTTATTCACCACTGTTAACGGCCGAAGAAGAAGTTTATTTTGCGCGTCGCGCACTGCGTGGAGATGTCGCCTCTCGCCGCCGGATGATCGAGAGTAACTTGCGTCTGGTGGTAAAAATTGCCCGCCGTTATGGCAATCGTGGTCTGGCGTTGCTGGACCTGATCGAAGAGGGCAACCTGGGGCTGATCCGCGCGGTAGAGAAGTTTGACCCGGAACGTGGTTTCCGCTTCTCAACATACGCAACCTGGTGGATTCGCCAGACGATCGAACGGGCGATTATGAACCAAACCCGTACTATTCGTTTGCCGATTCACATCGTAAAGGAGCTGAACGTTTACCTGCGAACCGCACGTGAGTTGTCCCATAAGCTGGACCACGAACCAAGTGCGGAAGAGATCGCAGAGCAACTGGATAAGCCAGTTGATGACGTCAGCCGTATGCTTCGTCTTAACGAGCGCATTACCTCGGTAGACACCCCGCTGGGTGGTGATTCCGAAAAAGCGTTGCTGGACATCCTGGCCGATGAAAAAGAGAATGGTCCGGAAGATACCACGCAAGATGACGATATGAAGCAGAGCATCGTCAAATGGCTGTTCGAGCTGAACGCCAAACAGCGTGAAGTACTGGCACGTCGATTCGGTTTGCTGGGGTACGAAGCGGCAACACTGGAAGATGTAGGTCGTGAAATTGGCCTCACCCGTGAACGTGTTCGCCAGATTCAGGTTGAAGGCCTGCGCCGTTTGCGCGAAATCCTGCAAACGCAGGGGCTGAATATCGAAGCGCTGTTCCGCGAAGAAGTAAGCATCTGTCAGAAAGGCCAGTCTCAAGCGAGGCTGGCTTTTTTTCTTTTGGTACATGGTACATGTTGA

Reverse Compliment Nucleotide Code for RpoS Gene from NZ_CP033092.1:4177924-4178988 Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775 chromosome, complete genome (Reverse 3’ to 5')

TCAACATGTACCATGTACCAAAAGAAAAAAAGCCAGCCTCGCTTGAGACTGGCCTTTCTGACAGATGCTTACTTCTTCGCGGAACAGCGCTTCGATATTCAGCCCCTGCGTTTGCAGGATTTCGCGCAAACGGCGCAGGCCTTCAACCTGAATCTGGCGAACACGTTCACGGGTGAGGCCAATTTCACGACCTACATCTTCCAGTGTTGCCGCTTCGTACCCCAGCAAACCGAATCGACGTGCCAGTACTTCACGCTGTTTGGCGTTCAGCTCGAACAGCCATTTGACGATGCTCTGCTTCATATCGTCATCTTGCGTGGTATCTTCCGGACCATTCTCTTTTTCATCGGCCAGGATGTCCAGCAACGCTTTTTCGGAATCACCACCCAGCGGGGTGTCTACCGAGGTAATGCGCTCGTTAAGACGAAGCATACGGCTGACGTCATCAACTGGCTTATCCAGTTGCTCTGCGATCTCTTCCGCACTTGGTTCGTGGTCCAGCTTATGGGACAACTCACGTGCGGTTCGCAGGTAAACGTTCAGCTCCTTTACGATGTGAATCGGCAAACGAATAGTACGGGTTTGGTTCATAATCGCCCGTTCGATCGTCTGGCGAATCCACCAGGTTGCGTATGTTGAGAAGCGGAAACCACGTTCCGGGTCAAACTTCTCTACCGCGCGGATCAGCCCCAGGTTGCCCTCTTCGATCAGGTCCAGCAACGCCAGACCACGATTGCCATAACGGCGGGCAATTTTTACCACCAGACGCAAGTTACTCTCGATCATCCGGCGGCGAGAGGCGACATCTCCACGCAGTGCGCGACGCGCAAAATAAACTTCTTCTTCGGCCGTTAACAGTGGTGAATAACCAATCTCACCAAGGTAAAGCTGAGTCGCGTCCAGCACACGCTGTGTGGCTCCCTGCGATAACAGTTCCTCTTCGGCCAAATCGTTATCACTGGGTTCCTCTTCTACTAAGGCCTTTTCGTCAAAAACCTCAACTCCGTTCTCATCAAATTCCGCATCTTCATTTAAATCATGAACTTTCAGCGTATTCTGACTCAT

RNA Nucleotide Code for RpoS Gene from NZ_CP033092.1:4177924-4178988 Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775 chromosome, complete genome

AUGAGUCAGAAUACGCUGAAAGUUCAUGAUUUAAAUGAAGAUGCGGAAUUUGAUGAGAACGGAGUUGAGGUUUUUGACGAAAAGGCCUUAGUAGAAGAGGAACCCAGUGAUAACGAUUUGGCCGAAGAGGAACUGUUAUCGCAGGGAGCCACACAGCGUGUGCUGGACGCGACUCAGCUUUACCUUGGUGAGAUUGGUUAUUCACCACUGUUAACGGCCGAAGAAGAAGUUUAUUUUGCGCGUCGCGCACUGCGUGGAGAUGUCGCCUCUCGCCGCCGGAUGAUCGAGAGUAACUUGCGUCUGGUGGUAAAAAUUGCCCGCCGUUAUGGCAAUCGUGGUCUGGCGUUGCUGGACCUGAUCGAAGAGGGCAACCUGGGGCUGAUCCGCGCGGUAGAGAAGUUUGACCCGGAACGUGGUUUCCGCUUCUCAACAUACGCAACCUGGUGGAUUCGCCAGACGAUCGAACGGGCGAUUAUGAACCAAACCCGUACUAUUCGUUUGCCGAUUCACAUCGUAAAGGAGCUGAACGUUUACCUGCGAACCGCACGUGAGUUGUCCCAUAAGCUGGACCACGAACCAAGUGCGGAAGAGAUCGCAGAGCAACUGGAUAAGCCAGUUGAUGACGUCAGCCGUAUGCUUCGUCUUAACGAGCGCAUUACCUCGGUAGACACCCCGCUGGGUGGUGAUUCCGAAAAAGCGUUGCUGGACAUCCUGGCCGAUGAAAAAGAGAAUGGUCCGGAAGAUACCACGCAAGAUGACGAUAUGAAGCAGAGCAUCGUCAAAUGGCUGUUCGAGCUGAACGCCAAACAGCGUGAAGUACUGGCACGUCGAUUCGGUUUGCUGGGGUACGAAGCGGCAACACUGGAAGAUGUAGGUCGUGAAAUUGGCCUCACCCGUGAACGUGUUCGCCAGAUUCAGGUUGAAGGCCUGCGCCGUUUGCGCGAAAUCCUGCAAACGCAGGGGCUGAAUAUCGAAGCGCUGUUCCGCGAAGAAGUAAGCAUCUGUCAGAAAGGCCAGUCUCAAGCGAGGCUGGCUUUUUUUCUUUUGGUACAUGGUACAUGUUGA

Source: https://biocyc.org/ECOLI/sequence-rc?type=GENE&object=EG10510

3.3. Codon optimization.

Lysis protein DNA sequence with Codon-Optimization ATGGAAACCCGCTTTCCGCAGCAGAGCCAGCAGACCCCGGCGAGCACCAACCGCCGCCGCCCGTTCAAACATGAAGATTATCCGTGCCGTCGTCAGCAGCGCAGCAGCACCCTGTATGTGCTGATTTTTCTGGCGATTTTTCTGAGCAAATTCACCAACCAGCTGCTGCTGAGCCTGCTGGAAGCGGTGATTCGCACAGTGACGACCCTGCAGCAGCTGCTGACCTAA

3.4. You have a sequence! Now what?

3.5. [Optional] How does it work in nature/biological systems?

  1. Describe how a single gene codes for multiple proteins at the transcriptional level.
  2. Try aligning the DNA sequence, the transcribed RNA, and also the resulting translated Protein like a provided example at [https://2026a.htgaa.org/2026a/course-pages/weeks/week-02/index.html]

Reading DNA

Part 4: Prepare a Twist DNA Synthesis Order

4.1. Create a Twist account, and Benchling account…

  • create Twist and Benchling accounts
  • Pick our protein! I will pick a protein related to aging for final project, I am just trying to keep my head above water on HW2 so the protein I pick is the example provided. See below in codeblock but what sort of nucleotides are “M E T…”? Clearly those aren’t nucleotides they are single letter representatives of amino acids, known as codons, constructed from 3 nucleotides. Here we are given in a top-down Build of a protein, which we must run the Central Dogma in reverse to translate back to RNA and then transcribe back to DNA.
>sp|P03609|LYS_BPMS2 Lysis protein OS=Escherichia phage MS2 OX=12022 PE=2 SV=1 METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLL EAVIRTVTTLQQLLT
                     /note="unnamed protein product; L-protein"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="CAA23990.1"
                     /db_xref="GOA:P03609"
                     /db_xref="InterPro:IPR022599"
                     /db_xref="UniProtKB/Swiss-Prot:P03609"
                     /translation="METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFL
                     AIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT"
     CDS             1761..3398

Here is an example of what running backwards looks like crudely. In this instance we go all the way back (1996) to the original sequence of phage MS2 L-protein from its genome. This is an excerpt from the GenBank file: representing a “phage MS2 genome” GenBank record [https://www.ncbi.nlm.nih.gov/nuccore/V00642].

Please note this sequence doesn’t come from the bottom of the GenBank file instead the selected region is required which must be further trimmed to match the code provided below from the HW2 blog. With correct NCBI links we can now confirm this code from the blog actually came from this GenBank record [ https://www.ncbi.nlm.nih.gov/nuccore/NC_001417.2?from=1678&to=1905&report=genbank]. I will also move this GenBank file into Benchling instead of previous file.

          atggaaacccgattccctcagcaatcgcagcaaactccggcatctactaatagacgccggccattcaaacatgaggattacccatgtcgaagacaacaaagaagttcaactctttatgtattgatcttcctcgcgatctttctctcgaaatttaccaatcaattgcttctgtcgctactggaagcggtgatccgcacagtgacgactttacagcaattgcttacttaa

A closer match of genome nucleotides is obtainted through another NCBI lookup [https://www.ncbi.nlm.nih.gov/nuccore/NC_001417.2?report=fasta&from=1643&to=1938] though even here the resulting gene fragment must be further trimmed

>NC_001417.2:1643-1938 phage MS2 genome
GCTTATTGTTAAGGCA|
ATGCAAGGTCTCCTAAAAGATGGAAACCCGATTCCCTCAGCAATCGCAGCAAAC
TCCGGCATCTACTAATAGACGCCGGCCATTCAAACATGAGGATTACCCATGTCGAAGACAACAAAGAAGT
TCAACTCTTTATGTATTGATCTTCCTCGCGATCTTTCTCTCGAAATTTACCAATCAATTGCTTCTGTCGC
TACTGGAAGCGGTGATCCGCACAGTGACGACTTTACAGCAATTGCTTACTTAA|
GGGACGAATTGCTCACA
AAGCATCCGACCTTAG

Reflecting, since we need the gene that codes for the LYS_BPMS2 Lysis protein in the Escherichia phage MS2 we go back to a GenBank file from 1996 when virology was the approach in molecular biology for engineering tag segments of RNA strand with stems looped in the translation phase of the Central Dogma of molecular biology. Based on the orignal RNA virus from which MS2 was derived.

  • select Genes on the page with prompt “what can twist build for you?” for HW2
  • name the project “L protein” with “L” for “Lysis” for HW2.
  • select Clonal Genes order card and press “Order Now” when prompted to select gene type for HW2.
  • avoid my mistake, this next page is going to take us to an “Excel Like” worksheet that we will develop our request with. The old school way was to download and upload meticulously formatted Excel spreadsheets; we are advanced humans capable of using web forms. Before we enter the DNA we require into this order form we have to work through the DNA we were given to read in HW2 Completing the optimization process on Twist Website we now have a Codon-Optimized Lysis protein DNA sequence.
ATGGAAACCCGCTTTCCGCAGCAGAGCCAGCAGACCCCGGCGAGCACCAACCGCCGCCGCCCGTTCAAACATGAAGATTATCCGTGCCGTCGTCAGCAGCGCAGCAGCACCCTGTATGTGCTGATTTTTCTGGCGATTTTTCTGAGCAAATTCACCAACCAGCTGCTGCTGAGCCTGCTGGAAGCGGTGATTCGCACAGTGACGACCCTGCAGCAGCTGCTGACCTAA

Optional: If we were going to synthesize more of this protein we now have a set of genetic instructions to read to grow those proteins. However there are different methods from which we can Build those proteins. We can consider cell-dependent or cell-free approaches. Explain more about these when I pick my protein.

In preparation for next steps remember that my Codon-Optimized Lysis protein DNA sequence In Benchling instructions to transcribe gene to RNA “Highlight the DNA sequence of interest.” “Right-click and select Copy Special.” “Choose the Reverse Complement option to get the anti-sense strand (RNA equivalent).” “Create a New DNA/RNA Sequence and paste the sequence, ensuring the type is set to “RNA”.”

4.2. Build Your DNA Insert Sequence

  • Let’s first organize our directories in Benchling for the assembly line
  • Create folder for Registry of Standard Biological Parts [https://parts.igem.org/Part:BBa_J23106] In that folder create the following folders: > A_Promoter > B_RBS > C_Start Codon > D_Coding Sequence > E_7x His Tag > F_Stop Codon > G_Terminator

HW2 Objective of assembly: make a sequence that will make E. coli glow fluorescent green under UV light by constitutively (always) expressing sfGFP (a green fluorescent protein).

In Benchling, select New DNA/RNA sequence

Give your insert sequence a name and select DNA with a Linear topology (this is a linear sequence that will be inserted into a circular backbone vector of our choosing).

Go through each piece of the given DNA sequences highlighted below (Promoter, RBS, Start Codon, Coding Sequence, His Tag, Stop Codon, Terminator) and paste the sequences into the Benchling file one after the other (replacing the coding sequence with your codon optimized DNA sequence of interest!). Each time you add a new piece of the sequence, make sure to annotate by right clicking over the sequence and creating an annotation that describes what each piece (e.g., Promoter, RBS, etc.) is (see image below).

Promoter (e.g. BBa_J23106) TTTACGGCTAGCTCAGTCCTAGGTATAGTGCTAGC

RBS (e.g. BBa_B0034 with spacers for optimal expression) CATTAAAGAGGAGAAAGGTACC

Start Codon ATG

Coding Sequence (your codon optimized DNA for a protein of interest, sfGFP for example) AGCAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCCGTGGAGAGGGTGAAGGTGATGCTACAAACGGAAAACTCACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCGTGGCCAACACTTGTCACTACTCTGACCTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGACCTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAGGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACACAAACTCGAGTACAACTTTAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACGTTGAAGATGGTTCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAATCTGTCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAA

7x His Tag (Let’s add a 7×His tag at the C-terminus of the protein to enable protein purification from E. coli) CATCACCATCACCATCATCAC

Stop Codon TAA

Terminator (e.g. BBa_B0015) CCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGAACGCTCTCTACTAGAGTCACACTGGCTCACCTTCGGGTGGGCCTTTCTGCGTTTATA

Once you’ve completed this, click on Linear Map to preview the entire sequence. If you intend to have a TA review a sequence in the future, this is a good way to verify that all sections are annotated!

This is not required for this exercise, but to share your design with others, please ensure that link sharing is turned on! (Optional) Share your final sequence link with a TA for review!

This insert sequence you built is commonly referred to as an expression cassette in molecular biology (a sequence you can drop into any vector and it’ll perform its function). Go ahead and download the FASTA file for the sequence you made.

It’s helpful to visualize DNA designs using SBOL Canvas (Synthetic Biology Open Language) to convey your designs.

Here is my practice assembled copy of the HW2 gene fragment I will import in Twist. However, I will not submit an actual order to Twist because this is just my demonstration Clonal Gene fragment copy. I will repeat these steps with my own functional gene for official purchase order.

TTTACGGCTAGCTCAGTCCTAGGTATAGTGCTAGCCATTAAAGAGGAGAAAGGTACCATGAGCAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCCGTGGAGAGGGTGAAGGTGATGCTACAAACGGAAAACTCACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCGTGGCCAACACTTGTCACTACTCTGACCTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGACCTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAGGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACACAAACTCGAGTACAACTTTAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACGTTGAAGATGGTTCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAATCTGTCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAACATCACCATCACCATCATCACTAACCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGAACGCTCTCTACTAGAGTCACACTGGCTCACCTTCGGGTGGGCCTTTCTGCGTTTATA

Here is my final Twist purchase order, though I will not actually purchase this either until an experiment can be developed.

TTTACGGCTAGCTCAGTCCTAGGTATAGTGCTAGCC
ATTAAAGAGGAGAAAGGTACC
ATG
ATGAGTCAGAATACGCTGAAAGTTCATGATTTAAATGAAGATGCGGAATTTGATGAGAACGGAGTTGAGGTTTTTGACGAAAAGGCCTTAGTAGAAGAGGAACCCAGTGATAACGATTTGGCCGAAGAGGAACTGTTATCGCAGGGAGCCACACAGCGTGTGCTGGACGCGACTCAGCTTTACCTTGGTGAGATTGGTTATTCACCACTGTTAACGGCCGAAGAAGAAGTTTATTTTGCGCGTCGCGCACTGCGTGGAGATGTCGCCTCTCGCCGCCGGATGATCGAGAGTAACTTGCGTCTGGTGGTAAAAATTGCCCGCCGTTATGGCAATCGTGGTCTGGCGTTGCTGGACCTGATCGAAGAGGGCAACCTGGGGCTGATCCGCGCGGTAGAGAAGTTTGACCCGGAACGTGGTTTCCGCTTCTCAACATACGCAACCTGGTGGATTCGCCAGACGATCGAACGGGCGATTATGAACCAAACCCGTACTATTCGTTTGCCGATTCACATCGTAAAGGAGCTGAACGTTTACCTGCGAACCGCACGTGAGTTGTCCCATAAGCTGGACCACGAACCAAGTGCGGAAGAGATCGCAGAGCAACTGGATAAGCCAGTTGATGACGTCAGCCGTATGCTTCGTCTTAACGAGCGCATTACCTCGGTAGACACCCCGCTGGGTGGTGATTCCGAAAAAGCGTTGCTGGACATCCTGGCCGATGAAAAAGAGAATGGTCCGGAAGATACCACGCAAGATGACGATATGAAGCAGAGCATCGTCAAATGGCTGTTCGAGCTGAACGCCAAACAGCGTGAAGTACTGGCACGTCGATTCGGTTTGCTGGGGTACGAAGCGGCAACACTGGAAGATGTAGGTCGTGAAATTGGCCTCACCCGTGAACGTGTTCGCCAGATTCAGGTTGAAGGCCTGCGCCGTTTGCGCGAAATCCTGCAAACGCAGGGGCTGAATATCGAAGCGCTGTTCCGCGAAGAAGTAAGCATCTGTCAGAAAGGCCAGTCTCAAGCGAGGCTGGCTTTTTTTCTTTTGGTACATGGTACATGTTGA
CATCACCATCACCATCATCAC
TAA
CCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGAACGCTCTCTACTAGAGTCACACTGGCTCACCTTCGGGTGGGCCTTTCTGCGTTTATA

4.2. On Twist, Select The “Genes” Option

4.3. Select “Clonal Genes” option

For this demonstration, we’ll choose Clonal Genes. You’ll select clonal genes or gene fragments depending on your final project.

Historically, HTGAA projects using clonal genes (circular DNA) have reached experimental results 1-2 weeks quicker because they can be transformed directly into E. coli without additional assembly.

Gene fragments (linear DNA) offer greater design flexibility but typically require an assembly or cloning step prior to transformation. An advantage is If designed with the appropriate exonuclease protection, gene fragments can be used directly in cell-free expression.

4.4. Import your sequence

You just took an amino acid sequence of interest and converted it into DNA, codon optimized it, and built an expression cassette around it! Choose the Nucleotide Sequence option and Upload Sequence File to upload your FASTA file.

4.5. Choose Your Vector

Since we’re ordering a clonal gene, you will need to refer to Twist’s Vector Catalog to choose your circular backbone. You can think of this as taking your linear expression cassette for your protein of interest, and completing the rest of the circle!

The backbone confers many special properties like antibiotic resistance, an origin of replication, and more. Discuss with your node to decide on appropriate antibiotic options. At MIT/Harvard, you can use Ampicillin, Chloramphenicol, or Kanamycin resistance.

Twist vectors do not contain restriction sites near the insert fragment, so make sure to flank your design with cut sites if you are intending to extract this DNA insert fragment later.

For this demonstration, choose a Twist cloning vectors like pTwist Amp High Copy.

Click into your sequence and select download construct (GenBank) to get the full plasmid sequence:

Go back to your Benchling account. Inside of a folder, click the import DNA/RNA sequence button and upload the GenBank file you just downloaded.

This is the plasmid you just built with your expression cassette included. Congratulations on building your first plasmid!

Important

For your final projects, remember to include:

Fully annotated Benchling insert fragment Desired Twist cloning vector

Part 5: DNA Read/Write/Edit

It’s helpful to visualize DNA designs using SBOL Canvas (Synthetic Biology Open Language) to convey your designs. Here’s an example of what you just annotated in Benchling:

4.3. On Twist, Select The “Genes” Option

4.4. Select “Clonal Genes” option

For this demonstration, we’ll choose Clonal Genes. You’ll select clonal genes or gene fragments depending on your final project.

Historically, HTGAA projects using clonal genes (circular DNA) have reached experimental results 1-2 weeks quicker because they can be transformed directly into E. coli without additional assembly.

Gene fragments (linear DNA) offer greater design flexibility but typically require an assembly or cloning step prior to transformation. An advantage is If designed with the appropriate exonuclease protection, gene fragments can be used directly in cell-free expression.

4.5. Import your sequence

You just took an amino acid sequence of interest and converted it into DNA, codon optimized it, and built an expression cassette around it! Choose the Nucleotide Sequence option and Upload Sequence File to upload your FASTA file.

4.6. Choose Your Vector

Since we’re ordering a clonal gene, you will need to refer to Twist’s Vector Catalog to choose your circular backbone. You can think of this as taking your linear expression cassette for your protein of interest, and completing the rest of the circle!

The backbone confers many special properties like antibiotic resistance, an origin of replication, and more. Discuss with your node to decide on appropriate antibiotic options. At MIT/Harvard, you can use Ampicillin, Chloramphenicol, or Kanamycin resistance.

Twist vectors do not contain restriction sites near the insert fragment, so make sure to flank your design with cut sites if you are intending to extract this DNA insert fragment later.

For this demonstration, choose a Twist cloning vectors like pTwist Amp High Copy.

Click into your sequence and select download construct (GenBank) to get the full plasmid sequence:

Go back to your Benchling account. Inside of a folder, click the import DNA/RNA sequence button and upload the GenBank file you just downloaded.

This is the plasmid you just built with your expression cassette included. Congratulations on building your first plasmid!

Important

For your final projects, remember to include:

Fully annotated Benchling insert fragment Desired Twist cloning vector

Part 5: DNA Read/Write/Edit

Assignees for the following sections
MIT/Harvard studentsRequired
Committed ListenersRequired

5.1 DNA Read

(i) What DNA would you want to sequence (e.g., read) and why? This could be DNA related to human health (e.g. genes related to disease research), environmental monitoring (e.g., sewage waste water, biodiversity analysis), and beyond (e.g. DNA data storage, biobank).

I would like to use directed evolution in outbred goats to select my DNA to sequence. Therefore my plan is to stick with the HTGAA method until I have a Nanopore sequencer and reagents for genomic surveillance of my herd. My argument for why is still developing but essentially I have anecdotal observations to support a hypothesis. An example of the type of genes I would like to sequence is the second vector I uploaded – the RpoS gene in the K-12 strain of E. coli. The gene was sequenced with a Nanopore sequencer.

DNA-based digital data storage technology. Source: Archives in DNA: Workshop Exploring Implications of an Emerging Bio-Digital Technology through Design Fiction - Scientific Figure on ResearchGate. Available from: https://www.researchgate.net/figure/DNA-based-digital-data-storage-technology_fig1_353128454 [accessed 11 Feb 2025]

DNA-based digital data storage technology. Source: Archives in DNA: Workshop Exploring Implications of an Emerging Bio-Digital Technology through Design Fiction - Scientific Figure on ResearchGate. Available from: https://www.researchgate.net/figure/DNA-based-digital-data-storage-technology_fig1_353128454 [accessed 11 Feb 2025]

(ii) In lecture, a variety of sequencing technologies were mentioned. What technology or technologies would you use to perform sequencing on your DNA and why?

There is no substitute in my opinion for a Nanopore sequencer, with a distant second being a PacBio. Ofcourse, Nanopore sequencers are far less popular than Illumina, and despite the fact that I am a big fan of Craig Venter, I still prefer the scientific opportunities available with Nanopore. In fact a significant reason why I went back to school post reproductive fitness equals zero, is because when I graduated from college they still hadn’t completed the Human Genome Project. I learned about Nanopores during the COVID-19 Pandemic when I started one of the first wastewater surveillance programs in the U.S. I believe the accuracy, speed, and flexibility of pore facilitated single base sequencing reads in parallel multithreaded readings fits my future research goals exactly and I am on the cusp of becoming a Nanopore super user.

Also answer the following questions:

Is your method first-, second- or third-generation or other? How so? What is your input? How do you prepare your input (e.g. fragmentation, adapter ligation, PCR)? List the essential steps. What are the essential steps of your chosen sequencing technology, how does it decode the bases of your DNA sample (base calling)? What is the output of your chosen sequencing technology?

I am focused on deep time series sequencing data that is broad enough to include changes in diversity of microbiome and host metatranscriptomic, epigenetic, and metabolomic signals as well as metagenomic changes. I also want to develop pipelines that I always have the opportunity to contribute to but never want to own or primarily benefit from. I believe paywall science is an etiologic mechanism that favors contagion.

The first benefit of 3rd and 4th generation sequencers, particularly the Nanopore machines, is that they do not even require PCR amplification. Don’t get me wrong, I love PCR as a flexible assay, but as an Epidemiologist I have never been comfortable with making more copies of pathogens on principle. I realize this a bit of a semantic argument and there are plenty of bio safety measures in place. At the same time the same biosecurity measures are drivers of inequality in applied Molecular Biology capabilities. What does it mean when the technology itself becomes a driver of inequality to scientific techniques everyone in a generation should have access to? I believe it means it’s time to keep innovating.

In addition I think there is wisdom in sequencing the actual shoddy molecules collected from the field, particularly for my applications. This is a Biosecurity advantage and better fit to the Epi Triangle anyway. However I am not saying there are not scenarios where higher level Biosecurity reference labs with PCR pipelines are not necessary. I just think some sequencers should be managed and maintained by governments and smaller non-PCR-based Nanopores should be prioritized by individual field researchers, like I intend to be.

Now there is an elephant in the room, thoug,h and that’s data storage. I have been wrestling with data storage my entire career, and I know my interest in Nanopore sequencing isn’t going to make these challenges go away anytime soon. Therefore, I am all for DNA storage of genomic sequencing information about animals in plant DNA ideally. If a safe method is already available, storage in animal subjects would be incredible as well. What DNA storage is maintained in goat horns or sheep’s wool? I need to investigate the methodology further to see if this is even possible. I am ashamed to admit that until I read Dr. Church’s Epilogue in Regeneration, I had never even thought about this before.

5.2 DNA Write

(i) What DNA would you want to synthesize (e.g., write) and why? These could be individual genes, clusters of genes or genetic circuits, whole genomes, and beyond. As described in class thus far, applications could range from therapeutics and drug discovery (e.g., mRNA vaccines and therapies) to novel biomaterials (e.g. structural proteins), to sensors (e.g., genetic circuits for sensing and responding to inflammation, environmental stimuli, etc.), to art (DNA origamis). If possible, include the specific genetic sequence(s) of what you would like to synthesize! You will have the opportunity to actually have Twist synthesize these DNA constructs! :)

I am dazzled by DNA origamis for synthetic materials, but the complexity of the methods to achieve static outputs is not necessarily a tradeoff I would invest time in right now. Genetic circuits are different though, I am fully attentive to this revolution. Particularily like we see in the examples provided by the Elowitz Lab [https://www.elowitz.caltech.edu/research#!computationandsyntheticcircuits].

(ii) What technology or technologies would you use to perform this DNA synthesis and why? Also answer the following questions:

What are the essential steps of your chosen sequencing methods? What are the limitations of your sequencing method (if any) in terms of speed, accuracy, scalability?

I would like to learn more about the CHOMP (circuits of hacked orthogonal modular proteases) method to integrate binary logic into functional programming modules in biological circuitry. The CHOMP method can then be used to control regulatory cascades and even more exciting to me binary logic gates. My research interests are nonlinear models in aging and cellular senescence that utiilizes elucidated insights to improve areas of stasis with the potentional for rejuvination. Waves of molecular decisions all of which with decipherable underlying binary logic gates based on Boolean logic. The engineering methods focus on viruses and bacteria. The programming motif they target is incoherent feed-forward loops. The amino acid they interact with is the Nitrogen end of Tyrosine which they expand to a four protein circuit. They image their single-transcript adaptive pulse circuits using time-lapse images. The result of the engineering is a rachet to control intrinsic nonlierarity of input and output biological systems. The scalabity and accuracy are tunable by the application. The speed is slow to design and as fast as biological circuits once implemented. Another method I would be interested in investigating further is the Asish et al. (2026) lab’s noninvasive biosensor application using live-cell diffusion-weighted imaging to investigate the effect of Gly-Ser spacers in transcription.

  • Source: Xiaojing J. Gao et al. ,Programmable protein circuits in living cells.Science361,1252-1258(2018).DOI:10.1126/science.aat5062
  • Asish N. Chacko et al. ,A programmable genetic platform for engineering noninvasive biosensors.Sci. Adv.12,eaec1211(2026).DOI:10.1126/sciadv.aec1211

5.3 DNA Edit

(i) What DNA would you want to edit and why? In class, George shared a variety of ways to edit the genes and genomes of humans and other organisms. Such DNA editing technologies have profound implications for human health, development, and even human longevity and human augmentation. DNA editing is also already commonly leveraged for flora and fauna, for example in nature conservation efforts, (animal/plant restoration, de-extinction), or in agriculture (e.g. plant breeding, nitrogen fixation). What kinds of edits might you want to make to DNA (e.g., human genomes and beyond) and why?

I am for animals. I want to contribute to dextinction and life extinction of all endangered and vulnerable organisms I can serve. I will contribute to human longevity as an afterthought to Natural diversity and sustainability. I am not beholden to humans though. I believe in the sanctity of all life.

(ii) What technology or technologies would you use to perform these DNA edits and why? Also answer the following questions: How does your technology of choice edit DNA? What are the essential steps? What preparation do you need to do (e.g. design steps) and what is the input (e.g. DNA template, enzymes, plasmids, primers, guides, cells) for the editing? What are the limitations of your editing methods (if any) in terms of efficiency or precision?

The synthesis of DNA and OMIC ontologies starts with phylogeny, small molecules, and phenotypes like disease. Therefore my career plan is to build the throughput for molecule mediate bidrectional interactions between Host physiology and the microbes in the microbiome and metagenome around the host. This is the big tent vision. Now how do get there. Imagine if I lay it all out here step-by-step. How could I do what I aspire to do if 1000 people do it first before me. Still, I come to HTGAA a pleb at the stairs to the Temple of Zeus, with my goats. Not to sacrifice, though. I will not be a culling scientist. There is no scientific discovery in the text of life that is worth sacrificing a living thing. I am a builder by nature anyway, I want to observe life without intervention, well some intervention is necessary, but not like it’s currently done. Therefore what to do?

Here is what I can share at HW2. Everywhere an organism lives, say a goat, is a DNA and RNA wake of material. Much of it is waste material, residues from competing metabolic systems stacked and ready to be interpreted and transformed into data. With data comes constraints, especially OMIC data, it’s endless and massive in scale, randomized and chaotic. I like the idea of applied systems biology pipelines built around dead biological material. You can catalogue and reconstruct living systems from waste chemistry. Do you need an Almond in it’s shell to understand the life history of that nut, not really, a fragment of husk in a pile on the ground will tell you about the almond and the animal that consumed it.

COVID-19, as a front-line Epidemiologist, in the center of the maelstrom did not equivocate in its lessons. First and foremost, public health apparatuses like mRNA vaccination research and deployment infrastructure is useful when it’s available, accessible, and appropriately matched to the agent. The rest is wastewater. Especially, where the infrastructure of sewers is insufficient to remove waste from a community fast enough, can be used to trace outbreaks in near real time. Wastewater surveillance is harder where the water is plentiful, deep, and fast-flowing. The great news for wastewater epidemic surveillance is that the structural inequalities above the sewers, exist within the sewers, and drive disease transmission in Outbreaks. This isn’t a hunch; the data support it. This is why I will continue to be interested in wastewater surveillance also when I enter the workforce.

However, I will focus on much broader networks of waste than wastewater, which is what makes the intersection of gut microbiomes, microbes, and host physiology the biological nexus for me. Thus, applications, many options here – especially in agriculture. I like agriculture because soil is the ultimate biological pile of waste. I have watched animal waste turn into dirt for several years now, and from that waste, plants grow. The animals eat those plants and turn it into animal tissues using systems of heredity and variability that have nothing to do with anything I did. I just get the animal in front of a plant and they complete their reproductive and maintenance programs. If I keep the animals water clean and their housing dry they do not get sick. These animals and the environment are an engine that I can run passively – they make the world a better place.

At the same time, though, this natural experiment produces a lot of opportunities to study molecule-mediated bidirectional relationships between animal hosts and the microbes in their microbiome and metagenome. Fortunately, for my experimental milieu, my species is driving Earth to its extreme of the boundary conditions for habitability, which certainly makes science more interesting – especially when local interventions can be developed to support sustainability, health, and longevity.

The last sentence is key for the edits I would dare to make. Never blindly though. This is why I will structure my lab within evolution directed sythesis.

Resources

DNA Sequencing at 40: Past, Present, and Future (2017) Shendure, J., Balasubramanian, S., Church, G. et al. https://doi.org/10.1038/nature24286 DNA Synthesis Technologies to Close the Gene Writing Gap (2023), Hoose, A., Vellacott, R., Storch, M. et al. https://doi.org/10.1038/s41570-022-00456-9 Recombineering and MAGE (2021), Wannier T, et al. Nat Rev Methods Primers, https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9083505/ CRISPR Technology: A Decade of Genome Editing is Only the Beginning, Wang, Doudna, et al., https://www.science.org/doi/10.1126/science.add8643 Databases

GenBank overview: https://www.ncbi.nlm.nih.gov/genbank/ NCBI: https://www.ncbi.nlm.nih.gov/genome/ Ensembl: https://useast.ensembl.org/index.html UCSC Genome Browser: https://genome.ucsc.edu/ Protective and Enhancing Alleles: https://arep.med.harvard.edu/gmc/protect.html Editors and tutorials

CRISPR/Cas9 Short tutorial for designing gRNAs: https://blog.addgene.org/how-to-design-your-grna-for-crispr-genome-editing Benchling specific tutorial for designing gRNAs: https://www.benchling.com/blog/how-to-design-grnas-to-target-your-favorite-gene List of Cas editors and their PAM sites: https://www.synthego.com/guide/how-to-use-crispr/pam-sequence Base Editors Base editors contain a nicking or dead Cas9 enzyme fused to a deaminase. a.) PAM requirement: Base editors contain a nicking or dead Cas9 enzyme fused to a deaminase. For designing your guide RNA for base editing you will therefore have a PAM requirement like you would have for any Cas9 experiment. b.) Deamination window: An additional design constraint is that the sequence window in which deamination occurs is only a few base pairs long. You can find information on the deamination windows in the review below (even though some new editors are not included). BE4 and ABE7.10 are good starting points and both use SpCas9 with NGG Pam requirement. Base editors with other PAM sites have been constructed too. Review of base editors (2018) including a list of all base editors, their editing window and PAM requirement: https://www.nature.com/articles/s41576-018-0059-1?WT.feed_name=subjects_animal-biotechnology Other editors: Prime editor https://www.nature.com/articles/s41586-019-1711-4 Tutorials/tools: https://primeedit.nygenome.org/ https://www.nature.com/articles/s41551-020-00622-8 http://pegfinder.sidichenlab.org/ TALEN For TALENs, you can assume no sequence restrictions – One of the technology’s previous restrictions was a T starting base, but this has since been overcome. In contrast to the CRISPR/Cas technologies above, your DNA sequence is recognized through interactions between the DNA and the TALEN: each TAL in the array recognizes one base. (Note: In order to introduce a double strand break, you will need to design to TALENs targeting the opposing strands.) Short guide: https://www.addgene.org/talen/guide/ One of the available design resources: https://tale-nt.cac.cornell.edu/node/add/talen Directed evolution for overcoming starting base restriction:https://academic.oup.com/nar/article/41/21/9779/1276340 Additional Resources:

Gel Purification of DNA: after DNA gel electrophoresis, cutting a band of DNA out of the agarose gel allows isolation and purification of a specific DNA fragment: Addgene: Protocol - How to Purify DNA from an Agarose Gel Overview of synthetic, unnatural organisms using recoding: Synthetic genomes with altered genetic codes (2020) DNA recorders, Sense+Read+Write: Lineage tracing and analog recording in mammalian cells by single-site DNA writing (2021) Molecular electronics, integrating single molecules into electronic chips: Molecular electronics sensors on a scalable semiconductor chip: A platform for single-molecule measurement of binding kinetics and enzyme activity (2022) Review of genome editors (zinc finger nucleases, TALENs, CRISPR) at the time CRISPR was emerging as editing technology: https://www.cell.com/trends/biotechnology/pdf/S0167-7799(13)00087-5.pdf Clinical trials of genome-editing therapies: https://www.nature.com/articles/d41573-020-00096-y

Week 3 HW: Lab Automation

Homework for HTGAA 2026 (Week 03): Lab Automation

NIH_Bioart_Bacterium NIH_Bioart_Bacterium

Table of contents

Software used:

Objective:

This week we get hands-on (or at least code-on) with pipetting robots.

Background:

No lecture. Recitation and Tokyo Biohub node lab meetings. Submit three slides with ideas to our node by 24Feb2026.

Ideas for Tokyo Biohub Deck

  • GPG01: Identify transcription indicators in post reproductive goat life history indicative of alterations to NAD(H), ROS signaling, tissue specific oxidative stress and inflammation.
  • GPG02: Explore application of G-protein coupled receptors (GPCRs) in goats a method Chen et al. (2019) proposes more broadly to monitor bioactive microbial metabolites with associations to physiology.
  • GPG03: Consider systems-level synthetic biology agricultural interventions to improve yield of metabolite specific food-stuffs to support molecule mediated bidirectional interactions between goat hosts and microbiota.

Questions:

For this week, we’d like for you to do the following:

Find and describe a published paper that utilizes the Opentrons or an automation tool to achieve novel biological applications. Write a description about what you intend to do with automation tools for your final project. You may include example pseudocode, Python scripts, 3D printed holders, a plan for how to use Ginkgo Nebula, and more. You may reference this week’s recitation slide deck for lab automation details. While your description/project idea doesn’t need to be set in stone, we would like to see core details of what you would automate. This is due at the start of lecture and does not need to be tested on the Opentrons yet.

  • Child HT, Wierzbicki L, Joslin GR, Roper K, Haxhiraj Q, Tennant RK. Automated environmental metagenomics using Oxford nanopore sequencing. BMC Genomics. 2025 Sep 26;26(1):835. doi: 10.1186/s12864-025-11989-w. PMID: 41013192; PMCID: PMC12465296.

I propose using a cloud laboratory and automation tools to process environmental metagenomics samples with and by Oxford nanopore sequencers. Here is the problem I am attempting to address. I am only one person. My time is always constrained profoundly. This means I always am burning and undercooking items with all my pans in the fire. Still, personally and professionally I am comitted red tooth and claw to environmental protection of biodiversity and abundance of natural ecologies and agricultural middle corridors. In addition I am personally offended by inequality, especially when it comes to the allocation of scientific discovery capacity and supply lines. The most diverse places on Earth are the most imperiled and at the same time least equipped with tooling to achieve the scientific advacements they need to protect their habitats and communities. Allow me to also preface that HTGAA is a small example that the bottlenecks of which I speak are not in human capacity, it’s techology, energy, infrastructure, brick and mortar. I believe that cloud computing and automation tools are a stopgap measure urgently needed to fill the breech and provide platforms to the facilitate the synergies of natural and unnatural selection required to advance sustainability and biodiversity. However engineering these partnerships are going to be just as important as the technological capabilities. The great thing about HTGAA is that we are doing this work from the bottom-up by participating in these cohorts.

Aside from HTGAA, my work with goats actually comes from the same engineering aspiration. I never saw a goat in the U.S. until I became a community health worker and started working outside of my country. Once I left the U.S. goats were much more plentiful, especially in rural mountainous regions. I am raising goats now to learn animal husbandry of these critical animals so that I can better understand how to help raise goats anywhere, in any locale, with any resource constraint. Goats in my opinion are the first automation tool that humans partnered with to survive in extreme environments. Through this partnership goats and humans expanded their gene and environment match with the physical constraints they were encountering in their struggle to ensure their families thrived. Goats and humans share many strengths and weaknesses, mainly their dedication to their families and security of FDR’s essential freedom from uninhabitable temperature and violence, hunger, thirst.

Now to the assignment, but from this perspective, the paper I reviewed from Childs et al. (2025) compared manual and automated metagenomic workflows using Oxford nanopore sequencers and found minimal differences in outcomes assessed. The first reason I chose this paper is because it starts with a fundamental truth, long-read sequencing has transformed our understanding of the microbiome. In fact, metagenomic and microbiome catalogues were not even attempted reliably until these machines entered the OMICs revolution. Enter the pipetter. I can attest, this is monastic work. The challenge is not the tool, it’s the lab space, and the sheer magnitude of the wells that the pipetter must span. Experimental protocols require percise allocation of minute quanties of fluids over and over again. From a personal vantage I quite enjoy the process, for there are few activities more zen in my day but then I am also hyper-privleged. Again inequality rears its head into the hallways of science. Who enters the cloister of the dwindling lab spaces in the world to the shelter of the bench and how many minuites do they have to spend to achieve their objectives. Here too is another ineqality though, because let’s be honest, not their objectives but the objectives of their research supervisors–because labs are also part of the caste system.

How do we untangle all of these knots to do the do the critical work. Could it be automation is answer? This will depend on who has access to automation. Are we talking about robotic workflows that are accessible to anyone with curiosity about microbiomes and metagenomes. Likely not anytime soon. I guess it will be more about the workflows done by students with professors. This is where the revolution of OMICs and Next-Generation Sequencers must be fought. What about private start-ups, I don’t know enough to speculate here. I can ponder the task of expanding the paradigm so any student with want of bench exposure using sequencers can have it. Honestly, I think HTGAA is pursuing this admirably. The cause is certainly just. If students and professors with and without wetlab spaces can both access cloud platforms and automation labs then we can realize the type of contingent niche environment that theoretically at least could be scaled-up and that is far better than not having a foothold at all. The Childs lab (2026) certainly seems to understand this charge when they explain that automation is a game changer fit to improve throughput, reproducibility, and accuracy. What is less clear is if the solution is the automated workflow or the Oxford nanopore sequencers that true read the sample one base pair at a time very quickly and then write that information into a cloud library for template recognition against other long-read sequences with annotation.

I didn’t really leave myself enough time to do this properly, ironically because this is lambing season, but Child’s et al. (2025) do make some very interesting observations in their side-by-side comparison of manual and automated workflows. I will apply these to my project now as well.

Childs et al. (2025) explain that many of the current studies they reviewed for their article only contain high throughput amplicon from the COVID-19 Pandemic. I do not see this as a challenge at all. Instead, when I think about the COVID-19 Pandemic as front-line warrior for Metazoans I see the good we accomplished when political will was aligned with scientific aspirations, and trust that the only reason naysayers have any leeway now to gripe about the deluge of SARS-CoV-2 data and genetic contamination, is because they are alive because of mRNA vaccines and wastewater surveillance, which Oxford nanopore significantly supported.

The liquid handling robot arm of the Childs et al. (2025) study was a Bravo Automated Liquid Handing Platform. I want one. Is it worth the cost though. Apparently, the findings are not sufficient to justify a purchase, based on read length alone. In the study the manual and Bravo study arms both analyzed the same 24 samples from a range of environments across a 96-well plate. Except for read length, which was on average longer in the manual arm than the automated. We can assume, if we have ever pipetted, that the automated arm would be more consistent in the allocation of microfluidics but confounding from variation in diverse soil samples appears to have made this distinction difficult to show. Meanwhile, the manual arm included eludication of DNA samples that the automata didn’t replicate, that doesn’t seem fair to me. However, if the automated workflow literally is not able to do all of the workflow steps than that is a strong point for manual over automated arms until the landscape is level.

Here’s the big takeaway though for my project. Childs et al. (2025) did find that improved automated libraries reduced PCR artefacts and increased sensitivity provide a more accurate snapshot of the ecological taxa of the microbiota – in other words more families, species, sub-species in the samples of less abundant organisms. This is what I want to hear, because if this process was applied to five studies instead of one then we would have 5x’s the power in detection of rare organisms that contribute to the diversity of the soil ecosystems, which is what I aspire most to understand and preserve.

  • Final Project Ideas — DUE BY START OF FEB 24 LECTURE

Methods:

  • Cloud Computing

Tasks:

Assignment: Python Script for Opentrons Artwork — DUE BY YOUR LAB TIME!

  • Your task this week is to Create a Python file to run on an Opentrons liquid handling robot.
  • Review this week’s recitation and this week’s lab for details on the Opentrons and programming it.
  • Generate an artistic design using the GUI at opentrons-art.rcdonovan.com. Using the coordinates from the GUI, follow the instructions in the HTGAA26 Opentrons Colab to write your own Python script which draws your design using the Opentrons.
  • You may use AI assistance for this coding — Google Gemini is integrated into Colab (see the stylized star bottom center); it will do a good job writing functional Python, while you probably need to take charge of the art concept. If you’re a proficient programmer and you’d rather code something mathematical or algorithmic instead of using your GUI coordinates, you may do that instead. [!warning] Ask for help early! If you are having any trouble with scripting, contact your TAs as soon as possible for help. Do not wait until your scheduled robot time slot or you may not be able to complete this assignment! If the Python component is proving too problematic even with AI and human assistance, download the full Python script from the GUI website and submit that:
    Use the download icon pointed to by the red arrow in this diagram.

    Use the download icon pointed to by the red arrow in this diagram.

    If you use AI to help complete this homework or lab, document how you used AI and which models made contributions. Sign up for a robot time slot if you are at MIT/Harvard/Wellesley or at a Node offering Opentrons automation. The Python script you created will be run on the robot to produce your work of art! At MIT/Harvard? Lab times are on Thursday Feb.19 between 10AM and 6PM. At other Nodes? Please coordinate with your Node. Submit your Python file via this form. Post-Lab Questions — DUE BY START OF FEB 24 LECTURE

One of the great parts about having an automated robot is being able to precisely mix, deposit, and run reactions without much intervention, and design and deploy experiments remotely.

For this week, we’d like for you to do the following:

Find and describe a published paper that utilizes the Opentrons or an automation tool to achieve novel biological applications. Write a description about what you intend to do with automation tools for your final project. You may include example pseudocode, Python scripts, 3D printed holders, a plan for how to use Ginkgo Nebula, and more. You may reference this week’s recitation slide deck for lab automation details. While your description/project idea doesn’t need to be set in stone, we would like to see core details of what you would automate. This is due at the start of lecture and does not need to be tested on the Opentrons yet.

Example 1: You are creating a custom fabric, and want to deposit art onto specific parts that need to be intertwined in odd ways. You can design a 3D printed holder to attach this fabric to it, and be able to deposit bio art on top. Check out the Opentrons 3D Printing Directory.

Example 2: You are using the cloud laboratory to screen an array of biosensor constructs that you design, synthesize, and express using cell-free protein synthesis.

Echo transfer biosensor constructs and any required cofactors into specified wells. Bravo stamp in CPFS reagent master mix into all wells of a 96-well / 384-well plate. Multiflo dispense the CFPS lysate to all wells to start protein expression. PlateLoc seal the plate. Inheco incubate the plate at 37°C while the biosensor proteins are synthesized. XPeel remove the seal. PHERAstar measure fluorescence to compare biosensor responses. Final Project Ideas — DUE BY START OF FEB 24 LECTURE

As explained in this week’s recitation, add a slide in your Node’s section of this slide deck with an idea you have for an Individual Final Project. Be sure to put your name on your slide!

Opentrons API Documentation: https://docs.opentrons.com/python-api/ Opentrons Artwork GUI Website: http://opentrons-art.rcdonovan.com/ Opentrons Artwork Colab: HTGAA26 Opentrons Colab Automation Equipment: HTGAA 2026 Recitation: Lab Automation, Opentrons Art, Intro to Cloud Laboratories

HTGAA 2026: Opentrons Artwork Lab

By Eyal Perry, Laura Maria Gonzalez, Dominika Wawrzyniak, Alex Hadik, Suvin Sundararajan, Ronan Donovan

This notebook contains a few examples that demonstrates how the Opentrons OT-2 can be used to draw arbitrary patterns using the the Python Opentrons API. These examples can and should be used as your template as you try to pattern your own colorful, synthetically engineered bacteria.

To use this, make your own copy of this Colab, and in that copy you can run and edit the last section (and your work will be saved in your copy!).

Note: After learning about how to program designs using colab and python, you may choose to print more designs with automated tools like Opentrons Art Interface.

Each example consists of two blocks of code:

  1. The first code block is where the pattern is drawn using .aspirate(), .move_to(), and dispense_and_detach() (as a wrapper around .dispense()) commands (similar to G-code). This block will typically generate no output, as it’s just loading the code (but doesn’t run it yet). This block of code can later be copied as-is and saved as a .py file to be executed on a real Opentrons machine.
  2. The second code block runs a simple simulation that visualizes the pipetted pattern by executing your code in the simulator in this colab. This block will draw the state of the plate after running the robot code.

At the end is a section for you to code your design in, with the same two code blocks. Make your own copy of this Colab notebook and work in your copy. When ready, upload the link to your first block in this section to the linked google form a day before your lab date! Don’t edit the second block in this section, as only the first block will be run on the robot.

Several important notes:

  • All units are in mm
  • Never go beyond a radius of 40mm from (0,0). If you do, you might hit the walls of the petri dish and all hell breaks loose, or you might dispense onto the wall of or even outside the petri dish. (Some common “90mm” or “100mm” petri dishes only have an inner diameter of 84mm in the bottom plate, and the tip occupies a radius of a couple mm.)
  • For the Black Agar Plates, dispense 1 uL drops by default. (If you are trying for a particular effect, going slightly higher in some places may be acceptable.) While that may sound like a small quantity, the E.coli will still be visible (especially after growing) and small “pixel” sizes can produce more detailed patterns.
  • Be careful of dispensing samples too close to each other! They will move around slightly depending on the size of the drop. 1uL drops 2mm apart may sometimes run together or may stay mostly distinct even after incubation; 1uL drops 5mm apart will almost always stay distinct, but give you less than half the “resolution” for your art. Midway between those - 3.5mm separation - may be a happy medium. (See past year photos here and in the Lab Protocol and count dots along one axis; these of course show the ones which were lucky enough to mostly not run together…)
  • On the robot if you dispense and immediately move the tip 1cm to the left it will create a streak of bio-ink (shaped according to the viscosity of the liquid). The simulator accounts for this basic effect, and you will see spurious lines between your dots or to random locations in the visualization. We have provided a routine dispense_and_detach() that dispenses and moves the tip slightly up & down to fully clear the droplet; you can use this in your code both for the simulator and the robot to avoid streaking.
  • We have defined standard configuration for the robot deck for this lab, and our template code follows it. We plan to have Red-, Yellow-, Green-, Cyan-, and Blue-fluorescing bacteria (but no others) at all sites in the robot for your use, and have provided a routine location_of_color() you can use to retrieve our standardized configuration’s location of a named color (which you can pass to an aspirate() call).
  • Pay attention to any text output from the simulator (typically just above the plate image) - it can give useful diagnostics and statistics. Don’t get so focused on your beautiful drawing that you forget to check this every once and a while.
  • Remember not to waste any resources (here tips & reagents, as explained in the Lab Protocol – you can confirm via the “Volume Totals by Color” and “Tip Count” summaries shown after every successful run – but don’t cross-contaminate your color wells.
  • The visualization is not 100% accurate. We don’t model any flud dynamics, so any streaking if you don’t use dispense_and_detach(), any effects of dispensing from z>0, and even the droplet sizes in all cases are not physically realistic; and the simulator doesn’t have an awareness of the 3D positions of labware. (Feel free to contribute improvements to the simulator!)
  • The simulation is not even close to a 100% complete reimplementation of the Opetrons API. Some commands will work on the OT-2 but will cause errors in the simulation (Feel free to contribute!).

After your code is done, to submit it to be run on a robot:

  1. Make sure your code is accessible to us: in your colab click the “Share” icon in the upper right, set “General access” so that “Anyone with the link” can be a “Viewer”.
  2. Copy to the clipboard a link to your code: right-click in the first code block (which has the metadata = {...} section near the top and your code at the end) and choose “Copy link to cell”
  3. Paste this URL into the Google form for submitting to the OT-2 and submit at least a day before your robot time slot.
  4. Review the Instructions given in the Lab Protocol.

Prerequisite Code

The following block of code contains required installations and the simulation/visualization code. It only needs to be run once per runtime.

When run, it will output errors declaring “ERROR: pip’s dependency resolver does not currently take into account all the packages that are installed.” and list some package incompatibilities; that is expected, and is a result of the Opentrons API requiring an old version of some libraries. (No other errors are expected.)

This block can be re-run in a runtime without ill effect (but will show the same errors every time).

Run this block once per runtime to set up your environment

#@title Run this block once per runtime to set up your environment

The colab now comes with too new a version of numpy; opentrons still needs an older one.

So set up venv-like isolation of my pip installs (separated from colab packages) for all subsequent cells.

(Without doing this, colab would require restarting the runtime right after installing a different numpy version.)

import sys, os py = f"{sys.version_info.major}.{sys.version_info.minor}" PKG = f"/content/venv/lib/python{py}/site-packages" os.makedirs(PKG, exist_ok=True) if PKG not in sys.path: sys.path.insert(0, PKG) os.environ[“PIP_TARGET”] = PKG # routes !pip / %pip installs into the venv os.environ[“PYTHONNOUSERSITE”] = “1”

Install opentrons into the venv (and all its dependencies!) BEFORE any import numpy etc.

%pip install -q –upgrade –target “$PKG” opentrons

Now opentrons has been cleanly installed in its own venv-like environment with

versions of packages it likes; proceed to use it “normally” from here.

from opentrons import types import matplotlib.pyplot as plt plt.rcParams[“figure.figsize”] = (10,10)

Petri dish size constants

PETRI_INNER_DIAMETER = 84 # 84mm is hopefully a tight lower bound on inner diameter of “90mm” & “100mm” petri dishes MAX_DRAW_RADIUS = PETRI_INNER_DIAMETER/2 - 2 # leave 2mm margin for the tip size, drop size, miscalibration, etc.

Define some classes for our custom HTGAA Opentrons simulator/visualizer

nullLocation = types.Location(types.Point(x=250, y=250, z=250), None)

def same2DLocation(loc1, loc2): # ignores z (=> tests x, y, and labware) return loc1.point.x == loc2.point.x and loc1.point.y == loc2.point.y and loc1.labware == loc2.labware

def mock_print(str): #print("…\n" + str) pass

each PipetteSim instance tracks what it’s dispensed; if you have multiple, need to call visualize() on each.

(can’t unify multiple by making the instance variables into class variables; note this colab has at least

one instance per example, and we don’t want those sharing dispense states.)

class PipetteSim: # modeled after InstrumentContext in the opentrons api def init(self, instrument_official_name, mount_LR, tip_rack_list, well_colors): if instrument_official_name != “p20_single_gen2”: raise ValueError(f"Unsupported pipette {instrument_official_name} – should be p20_single_gen2") self.max_volume = 20 self.instrument_official_name = instrument_official_name

if mount_LR != "right":
  raise ValueError(f"Unsupported pipette mount {mount_LR} -- should be right")
self.mount_LR = mount_LR

if tip_rack_list[0].labware_official_name != "opentrons_96_tiprack_20ul":
  raise ValueError(f"Unsupported tip rack {tip_rack_list[0].labware_official_name} -- should be opentrons_96_tiprack_20ul")
self.tip_rack_list = tip_rack_list

self.well_colors = well_colors
self.droplets_x = []
self.droplets_y = []
self.droplets_size = []
self.droplets_color = []
self.smears = []                # list of 3-tuples: (xlist, ylist, color)
self.location = nullLocation    # used by dispense_and_detach()
self.justDispensedAt = None
self.current_volume = 0
self.aspirated_loc = None
self.totalAspirated = {}        # 'color' : total
self.totalDispensed = {}        # 'color' : total
self.curr_color = 'orange'
self.has_tip = False            # (in the opentrons api!)
self.tip_count = 0

def del(self): if self.has_tip: raise Exception("### ERROR: Run completed without dropping the tip!") # python prints but ignores exceptions in destructors

used by our dispense_and_detach() routine

def _get_last_location_by_api_version(self): # (in the opentrons api!) return self.location

use the well id to make up a location on the petri dish diagram:

D6 in the center, A1 lower left, H12 upper right (assuming 96-well, but will work for any)

def petriLocOfWell(self, well): # (NOT in opentrons api) assert(isinstance(well, WellMock)) x,y = well.get_row_col() return well.top().move(types.Point(x=(x-ord(‘D’)) * MAX_DRAW_RADIUS/4, y=(y-6) * MAX_DRAW_RADIUS/6, z=0))

but no smear if it’s just a z-move

def smearIfJustDispensed(self, loc): # (NOT in opentrons api) assert(isinstance(loc, (types.Location, WellMock))) if self.justDispensedAt is not None: newloc = loc if isinstance(loc, types.Location) else self.petriLocOfWell(loc) if not same2DLocation(self.justDispensedAt, newloc): line_end = self.justDispensedAt.move(0.5 * (newloc.point - self.justDispensedAt.point)) self.smears.append(([self.justDispensedAt.point.x, line_end.point.x], [self.justDispensedAt.point.y, line_end.point.y], self.curr_color)) self.justDispensedAt = None

def dispense(self, volume, location): # (in opentrons api) assert(isinstance(location, types.Location)) # not allowing dispensing into well or trashbin/wastechute for this lab – petri only! assert(isinstance(volume, (int, float))) if (location.point.x2 + location.point.y2 > MAX_DRAW_RADIUS**2): raise ValueError(f’Dispensing outside “safe” area: Point ({location.point.x}, {location.point.y}) is more than’ + f" {MAX_DRAW_RADIUS}mm away from the petri dish’s center.") if not self.has_tip: raise RuntimeError(“dispense() called when no tip was being held”) if self.current_volume < volume: raise ValueError(f"You dispensed {volume}uL, which is more than was in the pipette ({self.current_volume}uL).") if volume <= 0: raise ValueError(f"Dispensing {volume}uL – you should dispense a positive amount.") if location.point.z < 0: raise ValueError(f"dispense() passed a location with z={location.point.z} – do not go below z=0!") if location.point.z >= 10: print(f"Dispensing from a location with z={location.point.z} – do you really want to dispense from that high?") self.smearIfJustDispensed(location) self.current_volume -= volume self.droplets_x.append(location.point.x) self.droplets_y.append(location.point.y) self.droplets_size.append(volume * 100) # unprincipled scale factor (1uL->100 sq.pt), but it works self.droplets_color.append(’lime’ if self.curr_color.lower()==‘green’ else self.curr_color) # map green -> lime (looks more like GFP) self.totalDispensed.setdefault(self.curr_color, 0) self.totalDispensed[self.curr_color] += volume self.location = location self.justDispensedAt = location

def aspirate(self, volume, location): # (in opentrons api) assert(isinstance(volume, (int, float))) assert(isinstance(location, (types.Location, WellMock))) if not self.has_tip: raise RuntimeError(“aspirate() called when no tip was being held”) if volume + self.current_volume > self.max_volume: raise ValueError(f"Aspirating {volume}uL + {self.current_volume}uL already in pipette = {volume + self.current_volume}uL," f" which is more than the pipette can hold ({self.max_volume}uL).") if volume <= 0: raise ValueError(f"Aspirating {volume}uL – you should aspirate a positive amount.") if self.aspirated_loc is not None and self.aspirated_loc != location: raise RuntimeError(f"Cross-contaminating wells {self.aspirated_loc} and {location} with a single pipette") self.aspirated_loc = location self.smearIfJustDispensed(location) self.current_volume += volume if isinstance(location, WellMock): if location.well_id.upper() not in (id.upper() for id in self.well_colors.keys()): raise ValueError(f"aspirate() was passed well location {location} which hasn’t been configured to have a color.") color = location.color() newloc = location else: # legal for aspirate() but we should probably treat this as an error for this lab? right now marking it white… print(f"WARNING – aspirate() passed a Location rather than a well – are you sure you know what you’re doing?") if location.point.z < 0: raise ValueError(f"aspirate() passed a location with z={location.point.z} – do not go below z=0!") color = ‘white’ # we don’t know where they’re asiprateing from… use an unusual color to mark it. newloc = self.petriLocOfWell(location) self.curr_color = color self.totalAspirated.setdefault(color, 0) self.totalAspirated[color] += volume self.location = newloc

def pick_up_tip(self): # (in opentrons api) loc = types.Location(types.Point(x=-MAX_DRAW_RADIUS, y=MAX_DRAW_RADIUS, z=0), ‘Pickup Tip’) self.smearIfJustDispensed(loc) if self.has_tip: raise RuntimeError(“pick_up_tip() called when already holding a tip”) self.has_tip = True assert(self.aspirated_loc is None) self.tip_count += 1 self.current_volume = 0 self.location = loc

def drop_tip(self): # (in opentrons api) loc = types.Location(types.Point(x=MAX_DRAW_RADIUS, y=MAX_DRAW_RADIUS, z=0), ‘Drop Tip’) self.smearIfJustDispensed(loc) if not self.has_tip: raise RuntimeError(“drop_tip() called when no tip was being held”) self.has_tip = False self.aspirated_loc = None self.current_volume = 0 self.location = loc

def move_to(self, location): # (in opentrons api) if location.point.z < 0: raise ValueError(f"move_to() passed a location with z={location.point.z} – do not go below z=0!") self.smearIfJustDispensed(location) self.location = location

def visualize(self): # (NOT in opentrons api) print("\n=== VOLUME TOTALS BY COLOR ===") for color in self.totalAspirated.keys() | self.totalDispensed.keys(): comment = ’’ if self.totalAspirated.setdefault(color, 0) != self.totalDispensed.setdefault(color, 0): comment = “\t\t##### WASTING BIO-INK : more aspirated than dispensed!” print(f"\t{color}:\t\t aspirated {self.totalAspirated[color]}\t dispensed {self.totalDispensed[color]}{comment}") print(f"\t[all colors]:\t[aspirated {sum(self.totalAspirated.values())}]\t[dispensed {sum(self.totalDispensed.values())}]") print(f"\n=== TIP COUNT ===\n\t Used {self.tip_count} tip(s) (ideally exactly one per unique color)") print("\n") # plus prints its own newline

## uncomment (only) one of these corresponding to the background medium you're printing on
plt.gca().add_patch(plt.Circle((0, 0), radius=PETRI_INNER_DIAMETER/2, color='#000000', fill=True)) # petri dish - 84mm inner diam, black agar plate
#plt.gca().add_patch(plt.Circle((0, 0), radius=PETRI_INNER_DIAMETER/2, color='#000000', fill=False)) # petri dish - 84mm inner diam, paper insert
#plt.gca().add_patch(plt.Circle((0, 0), radius=PETRI_INNER_DIAMETER/2, color='#d7ca95', fill=True)) # petri dish - 84mm inner diam, agar plate

plt.scatter(self.droplets_x, self.droplets_y, self.droplets_size, c=self.droplets_color)

for xlist,ylist,color in self.smears:
    plt.gca().plot(xlist, ylist, color=color, linewidth=4, solid_capstyle='round')

plt.xlim((-(PETRI_INNER_DIAMETER/2 + 0.5), PETRI_INNER_DIAMETER/2 + 0.5))
plt.ylim((-(PETRI_INNER_DIAMETER/2 + 0.5), PETRI_INNER_DIAMETER/2 + 0.5))
plt.show()

class WellMock: def init(self, well_id, well_color, labware_official_name): self.well_id = well_id self.labware_official_name = labware_official_name self.well_color = well_color if well_color else ‘purple’

def get_row_col(self):          # (NOT in opentrons api)
    row = ord(self.well_id[0].upper())
    col = int(self.well_id[1:])
    return (row, col)

def set_row_col(self, row, col):# (NOT in opentrons api)
    self.well_id = chr(row) + str(col)

def color(self):                # (NOT in opentrons api)
    return self.well_color

def bottom(self, z):            # (in opentrons api)
    assert z >= 0
    return self

def center(self):               # (in opentrons api)
    return self

def top(self, z=0):             # (in opentrons api)
    assert(isinstance(z, (int, float)))
    return types.Location(types.Point(x=0, y=0, z=z), 'Well')
    # return self

def move(self, location):       # (NOT in opentrons api) -- why do we have this here? what do we think it should do, move a well?
    assert(isinstance(location, types.Location))
    return self

def __eq__(self, other):
    return self.__class__ == other.__class__ and self.__dict__ == other.__dict__

def __repr__(self):
    return self.well_id

class LabwareMock: def init(self, labware_official_name, deck_slot, display_name, well_colors): self.labware_official_name = labware_official_name self.deck_slot = deck_slot self.display_name = display_name self.well_colors = well_colors

# the opentrons api names these arguments: self, idx
def well(self, well_id):        # (in opentrons api, but deprecated -- use wells(int) or wells_by_name(str) instead)
    return WellMock(well_id, self.well_colors.get(well_id, ''), self)

def __getitem__(self, well_id):
    return WellMock(well_id, self.well_colors.get(well_id, ''), self)

def __repr__(self):
    return "Deck Slot %s - %s" % (str(self.deck_slot), self.display_name)

class ModuleMock: def init(self, module_official_name, deck_slot, well_colors): self.module_official_name = module_official_name self.deck_slot = deck_slot self.well_colors = well_colors

# the opentrons api names these arguments: self, name, label
def load_labware(self, labware_official_name, display_name):    # (in opentrons api)
    mock_print("Module " + str(self.module_official_name) + " loaded " + str(labware_official_name))
    return LabwareMock(labware_official_name, self.deck_slot, display_name, well_colors)

def set_temperature(self, celsius):     # (in opentrons api)
    assert(isinstance(celsius, int))
    assert(celsius >= 4 and celsius <= 110)
    mock_print("Setting temperature to " + str(celsius) + "C")

def open_lid(self):                     # (in opentrons api)
    mock_print("Opening lid")

def close_lid(self):                    # (in opentrons api)
    mock_print("Closing lid")

def set_lid_temperature(self, temperature):     # (in opentrons api, but only for Thermocycler)
    assert(isinstance(temperature, int))
    assert(temperature >= 4 and temperature <= 110)
    mock_print("Setting lid temperature to " + str(temperature) + "C")

def deactivate_lid(self):               # (in opentrons api, but only for Thermocycler)
    mock_print("Deactivate lid")

                                        # (in opentrons api, but only for Thermocycler)
def set_block_temperature(self, temperature, hold_time_minutes=0, hold_time_seconds=0, ramp_rate=0, block_max_volume=25):
    assert(isinstance(temperature, int))
    assert(temperature >= 4 and temperature <= 110)
    assert(isinstance(hold_time_minutes, int))
    assert(isinstance(block_max_volume, int))
    mock_print("Setting block temperature to " + str(temperature) + "C")
    if (hold_time_minutes > 0):
        mock_print("Holding for " + str(hold_time_minutes) + " minutes...")
    if (hold_time_seconds > 0):
        mock_print("Holding for " + str(hold_time_seconds) + " seconds...")

def execute_profile(self, steps, repetitions, block_max_volume):    # (in opentrons api, but only for Thermocycler)
    assert(isinstance(repetitions, int))
    assert(isinstance(block_max_volume, int))

    mock_print("Executing following protocol for " + str(repetitions) + " cycles")

    for step in steps:
        assert(isinstance(step, dict))
        assert(isinstance(step['temperature'], int))
        assert(isinstance(step['hold_time_seconds'], int))

        mock_print("Temperature: " + str(step['temperature']) + "C, Time: " + str(step['hold_time_seconds']) + " seconds")

hmm, this appears to be unused…

class InstrumentMock: def init(self, instrument_official_name, mount_LR, tip_rack_list): self.instrument_official_name = instrument_official_name self.mount_LR = mount_LR starting_tip = None

    if "p20" in instrument_official_name:
        self.display_name = "P20"
        self.vol_range = (1, 20)
    elif "p300" in instrument_official_name:
        self.display_name = "P300"
        self.vol_range = (20, 300)
    elif "p1000" in instrument_official_name:
        self.display_name = "P1000"
        self.vol_range = (100, 1000)
    else:
        mock_print("WARNING: UNSUPPORTED PIPETTE")
        assert false

def advance_tip(self):
    row, col = self.starting_tip.get_row_col()

    row += 1
    if row > ord('H'):
        row = ord('A')
        col += 1

    if col > 12:
        mock_print("WARNING: OUT OF TIPS!!!")
        assert false

    self.starting_tip.set_row_col(row, col)

def pick_up_tip(self):
    row, col = self.starting_tip.get_row_col()
    assert(row >= ord('A') and row <= ord('H'))
    assert(col >= 1 and col <= 12)
    mock_print(self.display_name + " is picking up a tip from " + str(self.starting_tip))
    self.advance_tip()

def drop_tip(self):
    mock_print(self.display_name + " is dropping a tip");

def aspirate(self, volume, well):
    assert(isinstance(volume, (int, float)))
    assert(isinstance(well, WellMock))
    assert volume >= self.vol_range[0] and volume <= self.vol_range[1]
    mock_print("##### " + str(well.labware_official_name) + " [" + str(well.well_id) + "] ---> (" + str(volume) + "uL)")

def dispense(self, volume, well):
    assert(isinstance(volume, (int, float)))
    assert(isinstance(well, WellMock))
    assert volume >= self.vol_range[0] and volume <= self.vol_range[1]
    mock_print("##### " + str(well.labware_official_name) + " [" + str(well.well_id) + "] <--- (" + str(volume) + "uL)")

def blow_out(self):
    mock_print(self.display_name + " blow out")

def mix(self, repetitions, volume, well):
    assert(isinstance(repetitions, int))
    assert(isinstance(volume, (int, float)))
    assert(isinstance(well, WellMock))
    assert volume >= self.vol_range[0] and volume <= self.vol_range[1]
    mock_print("##### " + str(well.labware_official_name) + " [" + str(well.well_id) + "] - Mixing - " + str(repetitions) + " times, volume " + str(volume) + "uL")

def move_to(self, location, force_direct=False):
    assert(isinstance(force_direct, bool))
    assert(isinstance(location, WellMock))
    mock_print(self.display_name + " is moving");

class OpentronsMock: def init(self, well_colors): self.well_colors = well_colors self.pipette = None #self.location_cache = None # unimplemented: opentrons api’s more canonical way to get last_location, but these protocols don’t need it

def home(self):
    mock_print("Going home!")

# the opentrons api names these arguments: self, load_name, location, label
def load_labware(self, labware_official_name, deck_slot, display_name):
    mock_print("Loaded " + str(labware_official_name) + " in deck slot " + str(deck_slot))
    return LabwareMock(labware_official_name, deck_slot, display_name, self.well_colors)

# the opentrons api names these arguments: self, module_name, location
def load_module(self, module_official_name, deck_slot=0):
    mock_print("Loaded module " + str(module_official_name) + " in deck slot " + str(deck_slot))
    return ModuleMock(module_official_name, deck_slot, self.well_colors)

# the opentrons api names these arguments: self, instrument_name, mount, tip_racks
def load_instrument(self, instrument_official_name, mount_LR, tip_rack_list):
    self.pipette = PipetteSim(instrument_official_name, mount_LR, tip_rack_list, self.well_colors)
    return self.pipette

def pause(self):
    mock_print("Robot pause")

def visualize(self):
    self.pipette.visualize()

Put your name in the ‘author’ field of the metadata near the top of the first block, give your protocol a ‘protocolName’ there, and fill in the ‘description’ of what the protocol will do Write code to create your design at the very end of the first block

DEVELOPMENT TIP: Write your code in short runnable chunks, and after you’ve written each one run both of your clode blocks (running the first one loads your code, running the second one executes it on the simulator) to see that it’s doing what you expect. Simulate often!

My Code

    from opentrons import types import math

    metadata = { “author”: “Charley Naney”, “protocolName”: “HTGAA Opentrons Lab”, “description”: “HW3 multi-color agar patterning (safe preview + batched dispense)”, “source”: “HTGAA 2026 Opentrons Lab”, “apiLevel”: “2.20”, }

    —————————-

    DECK CONSTANTS

    —————————-

    TIP_RACK_DECK_SLOT = 9 COLORS_DECK_SLOT = 6 AGAR_DECK_SLOT = 5 PIPETTE_STARTING_TIP_WELL = “A1”

    —————————-

    COLOR SOURCE WELL -> PATTERN NAME (for logging)

    —————————-

    What the TA mock/visualizer uses for plotting colors (must be matplotlib-valid)

    well_colors = { “A1”: “#FFBF00”, # mko2 “B1”: “#FF4500”, # mrfp1 “C1”: “#FF2400”, # mscarlet “D1”: “#32CD32”, # sfgfp “E1”: “#7DF9FF”, # electra2 “F1”: “#4A4B43”, # mjuniper

    }

    What YOU use for printing nice names in the log

    well_color_names = { “A1”: “mko2”, “B1”: “mrfp1”, “C1”: “mscarlet”, “D1”: “sfgfp”, “E1”: “electra2”, “F1”: “mjuniper”, }

    mko2_points = [(7, 29),(11, 29),(13, 29),(17, 29),(21, 29),(7, 27),(9, 27),(11, 27),(15, 27),(17, 27),(19, 27),(21, 27),(25, 27),(1, 25),(3, 25),(5, 25),(7, 25),(9, 25),(11, 25),(13, 25),(17, 25),(19, 25),(23, 25),(25, 25),(27, 25),(-1, 23),(1, 23),(5, 23),(7, 23),(9, 23),(11, 23),(13, 23),(21, 23),(23, 23),(27, 23),(29, 23),(-9, 21),(-5, 21),(-3, 21),(-1, 21),(1, 21),(3, 21),(5, 21),(23, 21),(27, 21),(29, 21),(-13, 19),(-9, 19),(-7, 19),(-3, 19),(-1, 19),(23, 19),(25, 19),(27, 19),(29, 19),(-17, 17),(-13, 17),(-11, 17),(-7, 17),(-5, 17),(-3, 17),(25, 17),(-21, 15),(-17, 15),(-15, 15),(-13, 15),(-11, 15),(-9, 15),(-7, 15),(25, 15),(27, 15),(29, 15),(31, 15),(-25, 13),(-23, 13),(-21, 13),(-19, 13),(-17, 13),(-15, 13),(-13, 13),(25, 13),(29, 13),(-27, 11),(-25, 11),(-23, 11),(-21, 11),(-19, 11),(-17, 11),(25, 11),(27, 11),(31, 11),(-27, 9),(-23, 9),(-21, 9),(25, 9),(27, 9),(-27, 7),(-25, 7),(-23, 7),(25, 7),(27, 7),(29, 7),(-29, 5),(-27, 5),(-25, 5),(-23, 5),(23, 5),(27, 5),(-29, 3),(-27, 3),(-25, 3),(-23, 3),(23, 3),(25, 3),(27, 3),(-29, 1),(-27, 1),(-25, 1),(-21, 1),(21, 1),(23, 1),(-27, -1),(-25, -1),(-23, -1),(-21, -1),(-19, -1),(-15, -1),(17, -1),(19, -1),(23, -1),(-23, -3),(-21, -3),(-19, -3),(-3, -3),(5, -3),(7, -3),(11, -3),(13, -3),(15, -3),(19, -3),(-21, -5),(-19, -5),(-15, -5),(-13, -5),(-11, -5),(-9, -5),(-7, -5),(-5, -5),(-3, -5),(-1, -5),(1, -5),(3, -5),(7, -5),(11, -5)] mrfp1_points = [(19, 29),(1, 27),(23, 27),(-3, 25),(3, 23),(7, 21),(25, 21),(31, 21),(-17, 19),(5, 19),(-9, 17),(27, 17),(31, 17),(-11, 13),(-7, 13),(31, 13),(29, 11),(-25, 9),(-19, 9),(29, 9),(31, 9),(33, 9),(-33, 7),(-31, 7),(-21, 7),(31, 7),(29, 5),(-23, 1),(25, 1),(-31, -1),(-17, -1),(15, -1),(21, -1),(-27, -3),(-25, -3),(1, -3),(3, -3),(9, -3),(17, -3),(-17, -5),(5, -5),(13, -5),(-23, -7),(-19, -7),(-17, -7),(-15, -7),(-7, -7),(3, -7),(5, -7),(-3, -9),(-17, -11),(-15, -11),(-3, -11),(3, -13),(-21, -15),(-21, -19)] mscarlet_i_points = [(-21, 5),(19, 5),(-33, 3),(-31, 3),(-21, 3),(-19, 3),(-35, 1),(-37, -3),(-37, -5),(-37, -7),(-35, -9),(-33, -11),(-27, -13),(-25, -13),(-23, -15),(-21, -17),(-19, -23),(-17, -27),(-13, -29),(-11, -29)] sfgfp_points = [(13, 17),(15, 17),(1, 15),(9, 15),(11, 15),(13, 15),(15, 15),(3, 13),(11, 13),(13, 13),(15, 13),(17, 13),(-5, 11),(-3, 11),(1, 11),(3, 11),(7, 11),(11, 11),(13, 11),(15, 11),(-9, 9),(-7, 9),(-5, 9),(-1, 9),(1, 9),(7, 9),(9, 9),(13, 9),(15, 9),(-11, 7),(-7, 7),(-3, 7),(-1, 7),(1, 7),(3, 7),(7, 7),(9, 7),(13, 7),(15, 7),(19, 7),(-7, 5),(-5, 5),(-3, 5),(-1, 5),(3, 5),(5, 5),(9, 5),(-15, 3),(-13, 3),(-7, 3),(-11, 1),(3, 1)] electra2_points = [(17, 21),(19, 19),(7, 17),(17, 17),(21, 15),(-3, 13),(9, 13),(9, 11),(17, 11),(-15, 9),(-13, 9),(5, 9),(21, 9),(-5, 7),(17, 7),(-15, 5),(-13, 5),(-11, 5),(11, 5),(-5, 3),(3, 3),(13, 3),(17, 3),(-13, 1),(9, 1),(11, 1)] mjuniper_points = [(17, 19),(9, 17),(19, 17),(17, 15),(5, 11),(-3, 9),(3, 9),(11, 9),(17, 9),(19, 9),(-13, 7),(-9, 7),(5, 7),(-9, 5),(1, 5),(13, 5),(-11, 3),(9, 3),(11, 3)]

    colors_to_points = { “A1”: mko2_points, “B1”: mrfp1_points, “C1”: mscarlet_i_points, “D1”: sfgfp_points, “E1”: electra2_points, “F1”: mjuniper_points, }

    def run(protocol): def safe_comment(msg): if hasattr(protocol, “comment”): protocol.comment(str(msg)) else: print(str(msg))

    def safe_pause(msg):
        if hasattr(protocol, "pause"):
            try:
                protocol.pause(str(msg))
            except TypeError:
                protocol.pause()
                print(f"[PAUSE] {msg}")
        else:
            print(f"[PAUSE] {msg}")
    
    def reset_mock_aspirated_loc(pipette):
        if hasattr(pipette, "aspirated_loc"):
            pipette.aspirated_loc = None
    
    tips_20ul = protocol.load_labware(
        "opentrons_96_tiprack_20ul",
        TIP_RACK_DECK_SLOT,
        "Opentrons 20uL Tips",
    )
    
    try:
        pipette_20ul = protocol.load_instrument(
            "p20_single_gen2",
            "right",
            tip_racks=[tips_20ul],
        )
    except TypeError:
        pipette_20ul = protocol.load_instrument(
            "p20_single_gen2",
            "right",
            [tips_20ul],
        )
    
    pipette_20ul.starting_tip = tips_20ul.well(PIPETTE_STARTING_TIP_WELL)
    
    temperature_module = protocol.load_module(
        "temperature module gen2",
        COLORS_DECK_SLOT,
    )
    
    temperature_plate = temperature_module.load_labware(
        "opentrons_96_aluminumblock_generic_pcr_strip_200ul",
        "Cold Plate",
    )
    
    color_plate = temperature_plate
    
    agar_plate = protocol.load_labware(
        "htgaa_agar_plate",
        AGAR_DECK_SLOT,
        "Agar Plate",
    )
    
    center_location = agar_plate["A1"].top()
    
    DRY_RUN_ONLY = False
    DOT_UL = 1.0
    PIP_MAX_UL = 20.0
    HEADROOM_UL = 1.0
    PREVIEW_Z_MM = 10.0
    DETACH_Z_MM = 5.0
    
    X_MAX = 40.0
    Y_MAX = 40.0
    
    origin = center_location  
    
    max_dots_per_asp = int(math.floor((PIP_MAX_UL - HEADROOM_UL) / DOT_UL))
    if max_dots_per_asp < 1:
        raise ValueError("Invalid aspiration volume configuration.")
    
    def optimize_path_scanline(points):
        buckets = {}
        for (x, y) in points:
            buckets.setdefault(float(y), []).append(float(x))
        ys = sorted(buckets.keys(), reverse=True)
        out = []
        flip = False
        for y in ys:
            xs = sorted(buckets[y], reverse=flip)
            out.extend([(x, y) for x in xs])
            flip = not flip
        return out
    
    def bounding_box_check(mapping):
        for src, pts in mapping.items():
            for (x, y) in pts:
                if (float(x) < -X_MAX or float(x) > X_MAX or
                    float(y) < -Y_MAX or float(y) > Y_MAX):
                    raise RuntimeError(f"Point outside safety bounds for {src}: ({x}, {y})")
    
    def preview_move(pipette, location):
        high = location.move(types.Point(z=location.point.z + PREVIEW_Z_MM))
        pipette.move_to(high)
    
    def dispense_and_detach(pipette, volume, location):
        above = location.move(types.Point(z=location.point.z + DETACH_Z_MM))
        pipette.move_to(above)
        pipette.dispense(volume, location)
        pipette.move_to(above)
    
    bounding_box_check(colors_to_points)
    
    safe_comment("Starting dry run preview.")
    pipette_20ul.pick_up_tip()
    
    for src_well in sorted(colors_to_points.keys()):
        pts = optimize_path_scanline(colors_to_points[src_well])
        safe_comment(
            f"Preview {src_well} ({well_color_names.get(src_well, src_well)}): {len(pts)} dots"
        )
        for (x, y) in pts:
            target = origin.move(types.Point(x=float(x), y=float(y)))
            preview_move(pipette_20ul, target)
    
    pipette_20ul.drop_tip()
    
    if DRY_RUN_ONLY:
        safe_comment("Preview only mode complete.")
        return
    
    safe_pause("Dry run complete. Resume to dispense.")
    
    safe_comment("Starting dispense.")
    
    for src_well in sorted(colors_to_points.keys()):
        source = color_plate[src_well]
        pts = optimize_path_scanline(colors_to_points[src_well])
    
        safe_comment(
            f"Pattern: {well_color_names.get(src_well, src_well)} | Source well: {src_well} | Dots: {len(pts)}"
        )
    
        pipette_20ul.pick_up_tip()
        reset_mock_aspirated_loc(pipette_20ul)
    
        remaining = list(pts)
        while remaining:
            batch = remaining[:max_dots_per_asp]
            remaining = remaining[max_dots_per_asp:]
    
            volume_needed = len(batch) * DOT_UL
            pipette_20ul.aspirate(volume_needed, source)
    
            for (x, y) in batch:
                target = origin.move(types.Point(x=float(x), y=float(y)))
                dispense_and_detach(pipette_20ul, DOT_UL, target)
    
        pipette_20ul.drop_tip()
        reset_mock_aspirated_loc(pipette_20ul)
    
    safe_comment("Run complete.")
    
    Execute Simulation / Visualization – don’t change this code block

    protocol = OpentronsMock(well_colors) run(protocol) protocol.visualize()

Week 4 HW: Protein Design Part I

Homework: Protein Design I

Assignment


Objective:

Learn basic concepts: amino acid structure, 3D protein visualization, and the variety of ML-based design tools. Brainstorm as a group how to apply these tools to engineer a better bacteriophage (setting the stage for the final project).

HTGAA Protein Engineering Tools, HTGAA Protein Engineering Feedback​


Part A. Conceptual Questions

Answer any of the following questions by Shuguang Zhang:

1. How many molecules of amino acids do you take with a piece of 500 grams of meat? (on average an amino acid is ~100 Daltons)

Used George AI on this question. First, we begin by equating 1 Dalton (Da) to 1.66 x 10⁻²⁴ grams so that we could compute 100 Da amino acid weighs 100 grams. We decided to go with Fermi estimation instead of foundational biochemistry. Since skeletal muscle is roughly 20-25% protein by mass we decided 500g x 0.25 = 125 g protein. Then Georgeai explained that in polypeptide chains every amino acid residue loses one H₂O during peptide bond formation which is why the average residue weight is closer to 110 Da than the free amino acid weight of 128 Da. average molecular weight of approximately 110 Da. Next 125 g ÷ 110 g/mol ≈ 1.14 mol. We then assume that the average amino acid has a molecular formula of C₃H₇NO₂ has 13 atoms per residue (3C + 7H + 1N + 2O = 13), and multiplying by the number of residues gives you total atoms: 7.53 × 10²³ residues × 13 atoms/residue = 9.789 × 10²⁴ atoms.

2. Why humans eat beef but do not become a cow, eat fish but do not become fish?

Although the saying goes we are what we eat, our genomes disagree. The genes preserve function against infinite intrinsic and extrinsic stresses or other organisms’ genes. Vertically inherited animal genomes from ancestors, parents, and offspring are protected in the germ line but there also exists the functional genes that create proteins in specialized tissue mosaics that also selfishly persist as long as constituent cells survive – all cells are selfish like that. These specialized cells are sustained, though by new macromolecules which is likely why the human eat the cow in the first place. Here though Natural Selection has again preserved the reproductive programs of each species genome – starting with the taste buds and olfactory centers of the human brain. A carnivore has a digestive tract that can disassemble and denature raw muscle protein very efficiently, largely because they have different enzymes. Are lions susceptible to prion diseases? That question will make more sense in a moment, but a quick search of the internet indicates they are highly resistant (particularily to Chronic Wasting Disease). Again the enzymes in their gut protect them against 97-98% of CWDs they are exposed to. The risk to humans is different, but then so is the type of prion disease. Human also have digestive tracts though that denature the proteins and lipids of the cow before it even enters the digestive tract. Unfortunately humans also have large scale industrial agriculture and rampid inequality in access to cuts and quality of cow meat. This means that economics largely determines what parts of cows humans will be exposed and how concentrated the cows on the feed lots will be along with the condition of slaughter floor. It’s hard to know today because enzymes outside of niches are fragile things, but once humans started cooking their cow meat before shredding and emulsification in their digestive systems maybe they had more of the lion’s enzymes. The loss of those enzymes is no more felt than in the epidemiological triangle between prion in cow and the prion in man, here not gene-to-gene but protein-to-protein interaction between these two animals and the zoonotic pathogen adds a new layer of complexity.

3. Why there are only 20 natural amino acids? > This is such a great question. Likely it was because Earth is a special planet, at least the most exceptional planet we have any knowledge about, thus far, for forming these 20 amino acids. Foundational to this question is what I love most about the study of Earth life. Evolution is change in matter in response to energetic landscapes in constant motion. Everything in biology is nested in this evolutionary onion through which cosmic evolution begets planetary evolution all the way down to the sub-atomic particles of atoms and back up to cells-within-cells. All this evolutionary change, as my astrobiologist friends tell me, started with the creation of our Universe 13.8 billion years ago. Therefore, as I learned from Dr. Graves to Dr. Lane, single-celled organisms evolved into multicellular organisms through Natural Selection and biochemical pathways that can be traced back from the 20 natural amino acids and other macromolecules that then formed single-celled organisms and multicelled organisms. We can trace origin of individual atoms in those micromolecules to macromolecules, one element at a time or in families. Throughout all evolutionary nesting, from the Cosmos to the Microcosmos, there is the unifying story of energy flowing and matter cycling. This is the root cause of the first tradeoff in Natural Selection – the struggle for existence of living organisms constrained by dynamic environmental conditions. Life, or the 20 natural amino acids, thus formed from elemental particles flowing from energy sink to energy sink over the vast horizon of evolutionary time in one long continuous chain reaction. If anyone doubts this, break every natural amino acid down to elemental atoms, starting with Hydrogen the most abundant element in the Universe.

6. Can you make other non-natural amino acids? Design some new amino acids. We sure can but we have to be heretical and leave the canonical 2o natural amino acids behind. The process then becomes a matter of what your trajectory will be through the process. Are you going to design new amino acids within cells or externally and then from the bottom up or top down? You can make cell-free systems that include canonical and novel amino acids. However, without a hydrothermal vent underlying your invention for evolutionary scales of time, it’s hard to harness those molecules in the engine of living organisms and environmental niches through Natural Selection. Of course, we are pursuing a cell-free life, which will put the onus of selection on the creator. Do you want Elon Musk designing your child’s spouse? I digress, though. We are long from that point, RIP Dolly.

7. Where did amino acids come from before enzymes that make them, and before life started. > Earth was formed from the same cosmic evolutionary process that formed the other planets and their moons over 4 billion years ago. Cells are an administrative variable today. What is less understood is the abiotic chemistry of the primordial oceans, could the hydrothermal vents Infact we know that orginally, when the Earth was first formed, it didn’t even have a moon. Then there was movement of Jupiter and Mars was forever changed and a giant piece of rock hit Earth which led to the formation of our Moon. Again, all this was over 4 billion years ago, and there were no amino acids or enzymes at this time. Now, I am going to throw a bunch of science at you, but just remember when I do – the Earth and Moon are a twin study. The simple answer is that when Amino Acids are synthesized in a lab, outside of a cell, they form a racemic mixture of both L-amino acids and D-amino acids. However, when they are synthesized within cells between genes and proteins for specific functions, they are almost exclusively L-amino acids. This is because cells use enzymes to speed up biological synthesis, and this contributes to the preponderance of L-amino acids. Samples of the moon’s surface from the Apollo missions contained glycine, alanine, glutamic acid, aspartic acid, serine, and threoine. This indicates that there was life generating amino acids on the moon, but the process stopped. Coincidentally, that over 4 billion years ago when the Earth was forming, a huge rock collided with it, leading to the formation of the orbiting Moon body. This allows us to deduce that some simple R-group amino acids left Earth and entered the vacuum of space where they essentially were frozen in time. Meanwhile, more natural L-amino acids continued to evolve on Earth. Where did they evolve? In bacterial and archaeal cells, the central dogma of molecular biology tells us that genes cannot transcribe and translate proteins without enzymes. Now knowing that ontogeny recapitulates phylogeny the question now becomes, who is the index bacterium, Earth life’s original synthesizer? Several months later, nearing end of course, predictions about amino acids must be made using their structural properties. There is jurisprudence in their design. At the center of every essential amino acid is an alpha carbon that holds the pivot between a reducer and an oxidizer. On the reducer end we start with a single H in the smallest AA (I dare not recall it now in case I say the wrong name, guess is leucine). On the other end of the scale is the oxidizing COO-. We call the complete molecule a zwitterion, I think. Each end of each amino acid is signal of pka roughly between 2 and 9 and in the middle the pH balances at around 7. Simple numbers have significant consequences in the most eloquent manner. Because of the Krebs Cycle, and the metabolism of living organisms that produce amino acids their growth remains balanced in advance and retreat. The balance of amino acid design maintains the goverance of chirality that ensures the assembly of living macromolecules through the geometry underlying the Central Dogma of Molecular Biology is conserved at the foundation and divergent at the periphery. Both ends of all of these continuums maintain a clockwork universe regardless of your faith system.

8. If you make an alpha-helix using D-amino acids, what handedness (right or left) would you expect?

The 20 primary amino acids are all L-amino acids, as are most protein building blocks of cells. Alpha-helices here will be the B-DNA, favoring right-handedness. Thus by the power of deduction that leaves D-amino acids, the exceptions, to the way of left-handedness. Now, the cool science here is that B-DNA favors right-handedness on Earth, but because of complementary strand synthesis, the pattern of right-handedness carries over to the A-form RNA during transcription, but not exclusively! This means that our converse hypothesis was correct, and there is another handedness in RNA, also known as Z-RNA. Furthermore, there are specific conditions that generate the Z-RNA form.

9. Can you discover additional helices in proteins?

Yes, there are primary, secondary, tertiary, and quaternary forms in proteins based on the structural chemistry of the bonding molecules. The ⍺-helix is the most ordinary secondary protein structure but in biology there are already exceptions. Examples of these exceptional helices include the pi helix or coiled coil.

10. Why most molecular helices are right-handed?

Most life on Earth is evolutionary rooted in B-DNA helices with a right-handed confirmation due to origin in saltwater oceans, passed on to self-replicating cells synthesized from macromolecules shaped by complementarities in form dominated by non-covalent weak interactions. source,

11. Why do beta-sheets tend to aggregate?

Two ways to answer this question: Hysteresis and Natural Selection. This is a why question after all, and that’s what evolution shines light on, the why behind biological structure. If you dig to the bottom of the fossil pile or record you find energetic attractor conditions for the clumping of polypeptides. Let’s start with the canonical amino acid ingredients of beta-sheet secondary structures. Every amino acid from the natural 20 is capable of contributing to beta-sheets but some are very improbable to be represented, including: Proline, Glycine, Asparatic acid, Glutamic acid, and Lysine. Conversely, some frequent amino acid suspects and properties favor beta-sheet formation. For example, the alternating chain pattern of hydrophobicity and polarity. Therefore, high probability beta-sheet producers include: Valine, Isoleucine, Phenylalanine, Serine, and Tyrosine.

12. What is the driving force for b-sheet aggregation? betastranddeepdive betastranddeepdive

β-sheet aggregation is driven by a symphony of free-energy minimization building from a backbone hydrogen-bond stability, hydrophobic desolvation, solvent entropy crescendo, and percussion of highly repetitive intermolecular packing tempo characteristic of extended peptide conformations.

13. Why many amyloid diseases form b-sheet?

first, we must understand the protein continuum. At the foundation, amino acids are connected with peptide bonds, hence peptides ennumerate from the stringing together of amino acids in chains with specific amide donor and carbonyl acceptors adding the structure. The first line of proteins are primary, and then there are the secondary proteins that have two main branches the alpha-helices and the beta-sheets or beta-pleated sheets with beta strands on the end. The b-sheets form parallel and antiparallel patterns that lead to superstructures or globular proteins, also known as tertiary and quaternary proteins. Anyway, the beta-sheets are the predominate stabilizing structure in amyloid diseases and there are many include progeriod diseases like Huntington’s disease, or neural-degenerative diseases like Alzheimer’s disease, or Parkinson’s disease, or even Amyotropic Lateral Sclerosis (ALS) as well as the growing threat through confined area agriculture of prion diseases. The even deeper dive, or physics of the amyloid beta-sheet formation, is the bioenergetic stabilization of backbones with so much hydrogen-bond stability networking, hydrophobic desolvation, steric zipper packing, and conformational self-templating, which provides an easily exploitable kinetic trap for the native protein state that amyloid formation can co-opt.

14. Can you use amyloid b-sheets as materials? A good scientist can use anything to make the world a better place, and amyloid b-sheets are no exception. For example, like nucleotide bases, these molecular scaffolds enforce a planar geometry, which any Minecraft artist knows makes an excellent array of possible forms with a bit of imagination. Geometry is highly underrated these days. Beta sheets are uniformly stackable and scalable with the functionality that follows such capabilities in material.

15. Design a b-sheet motif that forms a well-ordered structure. Copied from Wikipedia


Part B: Protein Analysis and Visualization

In this part of the homework, you will be using online resources and 3D visualization software to answer questions about proteins.

I summon mTOR for my protein (including 4JSV, 4JSN, 4DRH, 4DRI, 3ML9, 5WBH, 5GPG, 5H64, 5FLC, 6BCX, 6BCU, 6SB0, 6SB2, 6ZWM, 7PE7, 7PEC, 8ERA, 9ED4, 9ED6, 9ED7, 9ED8).

mTor mTor
Pick any protein (from any organism) of your interest that has a 3D structure and answer the following questions.
  1. Briefly describe the protein you selected and why you selected it. The protein I am now selecting now that I better understand the exercise and tooling is the mighty mTOR TOR mechanistic target of Rapamycin protein kinase. I pick this protein because just trying to write the name is challenging. In add there is conserved and then there is mTOR conserved, it’s as common as Cytochrome C. Also I like the puzzle of navigating all of the codes just to plug it into the codebase – the combinations are amazing as my son’s Pokomon characters would say. Lastly, it has a lot of wiring for considering circuitry as a quintessential regulator of Natural Selection programs for growth, maintenance, and metabolism under stress.
  2. Identify the amino acid sequence of your protein.

My protein is human mTOR, which like everything in biology, must be extremely complicated. Thus the one entity has many partial constructs shown below in the table. The full human mTOR sequence from Uniprot with accession number P42345

MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW

ProteinPDB_APDBj_LinkAA Sequence
Serine/threonine-protein kinase mTOR4JSV4JSV
Serine/threonine-protein kinase mTOR4JSN4JSN
Serine/threonine-protein kinase mTOR4DRH4DRH
Serine/threonine-protein kinase mTOR4DRI4DRI
Serine/threonine-protein kinase mTOR3ML93ML9
Serine/threonine-protein kinase mTOR5WBH5WBH
Serine/threonine-protein kinase mTOR5GPG5GPG
Serine/threonine-protein kinase mTOR5H645H64
Serine/threonine-protein kinase mTOR5FLC5FLC
Serine/threonine-protein kinase mTOR6BCX6BCX
Serine/threonine-protein kinase mTOR6BCU6BCU
Serine/threonine-protein kinase mTOR6SB06SB0
Serine/threonine-protein kinase mTOR6SB26SB2
Serine/threonine-protein kinase mTOR6ZWM6ZWM
Serine/threonine-protein kinase mTOR7PE77PE7
Serine/threonine-protein kinase mTOR7PEC7PEC
Serine/threonine-protein kinase mTOR8ERA8ERA
Serine/threonine-protein kinase mTOR9ED49ED4
Serine/threonine-protein kinase mTOR9ED69ED6
Serine/threonine-protein kinase mTOR9ED79ED7
Serine/threonine-protein kinase mTOR9ED89ED8
  1. How long is it? What is the most frequent amino acid? You can use this notebook to count most frequent amino acid - https://colab.research.google.com/drive/1vlAU_Y84lb04e4Nnaf1axU8nQA6_QBP1?usp=sharing

    There are 2549 amino acids in human mTOR. I am going to use the revert back to the surfeit locus protein 2 for the remaining questions and answers. The sequence for surfeit locus protein 2 is: MDEPPSDVLAFLRQHPSLRLLPNTRKVRCSLTGHELPCRLPELQEYTRGKKYQRLSSSFSNFDYAAFEPHIVPSTKNRHQLFCKLTLRHINKSPEHVLRHTQGRRYQRALHQYEECQKQGVEYVPACLLHKRKKREDQTNSDELPGQRTGFWEPASSDEEDALSDDSMTDLYPPELFTKRELGKPKNDDTPEDFLTDQQDEKPEHSEEKSFREREEARVGHKRGRKLRKKQLTSLTKKFKSYHHKPKNFSSFKQLGR My old protein show below in current analyses is surfeit locus protein 2 protein is: 257 amino acids. The most common amino acid is: L, which appears 27 times. All Amino Acid Frequencies: Total Sequence Length: 257


Amino Acid | Count | Frequency (%)

L | 27 | 10.51% K | 25 | 9.73% E | 24 | 9.34% R | 24 | 9.34% S | 20 | 7.78% P | 18 | 7.00% D | 15 | 5.84% Q | 15 | 5.84% T | 14 | 5.45% H | 13 | 5.06% F | 12 | 4.67% G | 10 | 3.89% A | 8 | 3.11% Y | 8 | 3.11% V | 7 | 2.72% N | 7 | 2.72% C | 5 | 1.95% M | 2 | 0.78% I | 2 | 0.78% W | 1 | 0.39% 6. How many protein sequence homologs are there for your protein? Hint: Use the pBLAST tool to search for homologs and ClustalOmega to align and visualize them. Tutorial Here

  1. Does your protein belong to any protein family?
  2. Identify the structure page of your protein in RCSB
  3. When was the structure solved? Is it a good quality structure? Good quality structure is the one with good resolution. Smaller the better (Resolution: 2.70 Å)
  4. Are there any other molecules in the solved structure apart from protein?
  5. Does your protein belong to any structure classification family? SURF2
  6. Open the structure of your protein in any 3D molecule visualization software:
  • PyMol Tutorial Here (hint: ChatGPT is good at PyMol commands)
    • Visualize the protein as “cartoon”, “ribbon” and “ball and stick”.
    • Color the protein by secondary structure. Does it have more helices or sheets?
    • Color the protein by residue type. What can you tell about the distribution of hydrophobic vs hydrophilic residues?
    • Visualize the surface of the protein. Does it have any “holes” (aka binding pockets)?

Part C. Using ML-Based Protein Design Tools

aaprob aaprob fps fps 3dtsne 3dtsne

In this section, we will learn about the capabilities of modern protein AI models and test some of them in your chosen protein. Copy the notebook below and set up a colab instance with GPU for this section: HTGAA_ProteinDesign2026.ipynb Choose your favorite protein from the PDB. We will now try multiple things, report each of those results in your homework page: Protein Language Models: Deep Mutational Scans Use ESM2 to generate an unsupervised deep mutational scan of your protein based on language model likelihoods. Can you explain any particular pattern? (choose a residue and a mutation that stands out) (Bonus) Find sequences for which we have experimental scans, and compare the prediction of the language model to experiment Latent Space Analysis Use the provided sequence dataset to embed proteins in reduced dimensionality Analyze the different formed neighborhoods: do they approximate similar proteins? Place your protein in the resulting map and explain its position and similarity to its neighbors Attention Maps Analyze the attention maps of ESM2. Investigate if its layers correlate to the 2D map of residue distances of your protein Protein Folding: Folding a protein Fold your protein with ESMFold. Do the predicted coordinates match your original structure? Try changing the sequence, first try some mutations, then large segments. Is your protein structure resilient to mutations? Protein Generation: Inverse-Folding a protein Let’s now use the backbone of your chosen PDB to propose sequence candidates via ProteinMPNN Analyze the predicted sequence probabilities and compare the predicted sequence vs the original one Input this sequence into ESMFold and compare the predicted structure to your original

newmaaprob newmaaprobnewpdb newpdb

Last step in my copy of HTGAA_ProteinDesign2026.ipynb script

Generating sequences… tmp, score=2.2338, fixed_chains=[], designed_chains=[‘A’], model_name=v_48_020 MDEPPSDVLAFLRQHPSLRLLPNTRKVRCSLTGHELPCRLPELQEYTRGKKYQRLSSSFSNFDYAAFEPHIVPSTKNRHQLFCKLTLRHINKSPEHVLRHTQGRRYQRALHQYEECQKQGVEYVPACLLHKRKKREDQTNSDELPGQRTGFWEPASSDEEDALSDDSMTDLYPPELFTKRELGKPKNDDTPEDFLTDQQDEKPEHSEEKSFREREEARVGHKRGRKLRKKQLTSLTKKFKSYHHKPKNFSSFKQLGR T=0.1, sample=0, score=1.1620, seq_recovery=0.2568 MPPLPPEVVAFLAQHPHLVALPGQPLVRCTLTGEELPAELPVLRAHVATPRHQALAAREKNFDFSKYEPHIVPSRWDPDKLFCRLCLKEIPKTPEAVEAHVNSKEHQEALKEYEEAKKRGKRYIPKRLRKRRRRRRRRRRRRRGRRKRRKRRPPPPRRRPRRKRRRRRRRLVPREWLRRRRRRRRRRRRRRRPRRRRRPPRRVVGAAPEPAVAALAEAPAPPAPPAPPPPPEERPEPPPPPPERREPPPEELEEEEE

New Sequence:MPPLPPEVVAFLAQHPHLVALPGQPLVRCTLTGEELPAELPVLRAHVATPRHQALAAREKNFDFSKYEPHIVPSRWDPDKLFCRLCLKEIPKTPEAVEAHVNSKEHQEALKEYEEAKKRGKRYIPKRLRKRRRRRRRRRRRRRGRRKRRKRRPPPPRRRPRRKRRRRRRRLVPREWLRRRRRRRRRRRRRRRPRRRRRPPRRVVGAAPEPAVAALAEAPAPPAPPAPPPPPEERPEPPPPPPERREPPPEELEEEEE

Part D. Group Brainstorm on Bacteriophage Engineering

Find a group of ~3–4 students Review the Bacteriophage Final Project Goals: Increased stability (easiest) Higher titers (medium) Higher toxicity of lysis protein (hard) Brainstorm Session Choose one or two main goals from the list that you think you can address computationally (e.g., “We’ll try to stabilize the lysis protein,” or “We’ll attempt to disrupt its interaction with E. coli DnaJ.”). Write a 1-page proposal (bullet points or short paragraphs) describing: Which tools/approaches from recitation you propose using (e.g., “Use Protein Language Models to do in silico mutagenesis, then AlphaFold-Multimer to check complexes.”). Why you think those tools might help solve your chosen sub-problem. One or two potential pitfalls (e.g., “We lack enough training data on phage–bacteria interactions.”). Include a schematic of your pipeline This resource may be useful: HTGAA Protein Engineering Tools Individually put your plan on your website page Each group’s short plan for engineering a bacteriophage Schedule time ( HTGAA Protein Engineering Feedback) to get feedback/discuss your ideas, and put the feedback on your website [Optional] Part E. Find a drug for an oncology target

Week 5 HW: Protein Design Part ii

  • [] Homework — DUE BY START OF MAR 10 LECTURE

Part A: SOD1 Binder Peptide Design (From Pranam)

Superoxide dismutase 1 (SOD1) is a cytosolic antioxidant enzyme that converts superoxide radicals into hydrogen peroxide and oxygen. In its native state, it forms a stable homodimer and binds copper and zinc. Mechanis

Mutations in SOD1 cause familial Amyotrophic Lateral Sclerosis (ALS). Among them, the A4V mutation (Alanine → Valine at residue 4) leads to one of the most aggressive forms of the disease. The mutation subtly destabilizes the N-terminus, perturbs folding energetics, and promotes toxic aggregation.

  • [] Task A

Your challenge:

    Background: Design short peptides that bind mutant SOD1 and then decide which ones are worth advancing toward therapy. You will use three models developed in our lab:
  • PepMLM: target sequence-conditioned peptide generation via masked language modeling.
  • PeptiVerse: therapeutic property prediction.
  • moPPIt: motif-specific multi-objective peptide design using Multi-Objective Guided Discrete Flow Matching (MOG-DFM)
  • Part 1: Generate Binders with PepMLM

                      Begin by retrieving the human SOD1 sequence from UniProt (P00441) and introducing the A4V mutation.
    

    🟢🟤🟡P00441

    Here is fully translated superoxide dimutase protein P00441 in uniprot with the initiator methionine included. We need to cleave that M off before we apply our requested mutation to progress with a mature enzyme.

    So not this… 1 2 3 4 M A T K

    But this.. 1 2 3 4 A T K A

    To create our A4V SOD (love the rhyme) mutant… 1 2 3 4 A T K V

    The savvy student who fails to cleave the first methionine (M) can intuit the actual amino acid to change without thinking through any of the previous steps, but it’s nice to have a why in all things, since this is biology after all and we have evolution and ChatGPT. Please note that we will not want to use a protein sequence with any sort of truncation or wrapping on the sequence so here are my sequences for PPMLM-650M.

                      Using the PepMLM Colab linked from the HuggingFace PepMLM-650M model card: 
    

    🤗pepmlm650mlink

                      Generate four peptides of length 12 amino acids conditioned on the mutant SOD1 sequence.
    

    To create our A4V SOD (love the rhyme) mutant… 1 2 3 4 A T K V

    Mutant A4V SOD for PepMLM-650 There are two options, full protein sequence and a 12-Sequence input which I settled on in later runs.
    MATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ

    colabcode

    MATKVVCVLKGD

    Within the PepMLM-650 codebase in Google Colab Notebook, there are sliders and input fields to parameterize individual runs. However, these parameters didn’t seem to encode, so I finally hard-coded changes, as I will show below as a series of excerpts pulled from the codebase.

    single_sequence = True #@param {type:"boolean"} protein_seq = "MATKVVCVLKGD" #@param {type:"string"} # Initial value for num_binders num_binders = 4 # Initial values for top_k and peptide_length top_k = 3 peptide_length = 12

    code_constrained_step

    Initial_4in1_SequenceSet

    BinderPseudo_Perplexity_Score
    WVVVLVAGVVGE35.014933
    LTLVVAVGEVGE25.582245
    SVTEEVEDVDPV21.336863
    LPTVVVEGVDPE17.079494

    To your generated list, add the known SOD1-binding peptide FLYRWLPSRRGG for comparison.

    Scores above, I think. I feel like I’m in Gulliver’s Travels returning this exercise cold after 2 months so I am going to try and piece together memory using a peers homework. For the next phase I am now going to find the amino acid sequence for my SOD1 sequence. Now I’m not copying information because I just went to uniprot site myself and searched for SOD1 on the splash page and scrolling down on first page I found human sodc but I skipped over that one and found the sod for sheep

    P09670 · SODC_SHEEP
    MATKAVCVLKG
    DGPVQGTIRFE
    AKGDKVVVTGS
    ITGLTEGDHGF
    HVHQFGDNTQG
    CTSAGPHFNPL
    SKKHGGPKDEE
    RHVGDLGNVKA
    DKNGVAIVDIV
    DPLISLSGEYS
    IIGRTMVVHEK
    PDDLGRGGNEE
    STKTGNAGGRL
    ACGVIGIAP

    Record the perplexity scores that indicate PepMLM’s confidence in the binders.

    Given confusion perplexity scores are likely very high. The model confidence according to UniProt is spot on though, specifically model confidence is very high (pLDDT > 90). This is generated by AlphaFold as a per-residue confidence score (pLDDT) between 0 and 100. Now I am prepared to transition to part 2. SheepSODC SheepSODC

    What about my mutants, though? I do not want to disrupt folding randomly, need an appropriate target region for mutation logic so I will leverage the MobiDB website.

    SheepSODCmutant SheepSODCmutant

    Enumerated Amino Acids with position and highlighted for subsequent mutagenesis based on encode segment flexibility, disruptability, and functional consequences

    PositionAmino Acid
    1M
    2A
    3T
    4K
    5A
    6V
    7C
    8V
    9L
    10K
    11G
    12D
    13G
    14P
    15V
    16Q
    17G
    18T
    19I
    20R
    21F
    22E
    23A
    24K
    25G
    26D
    27K
    28V
    29V
    30V
    31T
    32G
    33S
    34I
    35T
    36G
    37L
    38T
    39E
    40G
    41D
    42H
    43G
    44F
    45H
    46V
    47H
    48Q
    49F
    50G
    51D
    52N
    53T
    54Q
    55G
    56C
    57T
    58S
    59A
    60G
    61P
    62H
    63F
    64N
    65P
    66L
    67S
    68K
    69K
    70H
    71G
    72G
    73P
    74K
    75D
    76E
    77E
    78R
    79H
    80V
    81G
    82D
    83L
    84G
    85N
    86V
    87K
    88A
    89D
    90K
    91N
    92G
    93V
    94A
    95I
    96V
    97D
    98I
    99V
    100D
    101P
    102L
    103I
    104S
    105L
    106S
    107G
    108E
    109Y
    110S
    111I
    112I
    113G
    114R
    115T
    116M
    117V
    118V
    119H
    120E
    121K
    122P
    123D
    124D
    125L
    126G
    127R
    128G
    129G
    130N
    131E
    132E
    133S
    134T
    135K
    136T
    137G
    138N
    139A
    140G
    141G
    142R
    143L
    144A
    145C
    146G
    147V
    148I
    149G
    150I
    151A
    152P

    Amino acids selected for mutation

    PositionWTCandidateReason
    71GAReduce flexibility
    72GAFlexible glycine region
    76EPPotential structural disruption site

    Final mutant sequence with three changes

    MATKAVCVLKGDGPVQGTIRFEAKGDKVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHAAPKDPERHVGDLGNVKADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGGRLACGVIGIAP
    Sequence TypeAmino Acid Sequence
    G71A/G72A + E76P Mutant
    firstalphafoldserverrun firstalphafoldserverrun

    Part 2: Evaluate Binders with AlphaFold3

    Navigate to the AlphaFold Server: [alphafoldserver](https://alphafoldserver.com/welcome) WTSheepSODC WTSheepSODCFor each peptide, submit the mutant SOD1 sequence followed by the peptide sequence as separate chains to model the protein-peptide complex. MUTSheepSODC MUTSheepSODCRecord the ipTM score and briefly describe where the peptide appears to bind. Does it localize near the N-terminus where A4V sits? Does it engage the β-barrel region or approach the dimer interface? Does it appear surface-bound or partially buried?MATKVVCVLKGDGPVQGTIRFEAKGDKVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVKADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGGRLACGVIGIAP
    Sequence TypeAmino Acid Sequence
    A4V Mutant
    A4V_Mutant A4V_MutantIn a short paragraph, describe the ipTM values you observe and whether any PepMLM-generated peptide matches or exceeds the known binder.

    There were two mutation pathways considered in this section the A4V change resulted in a 0.1 ipTM drop. I can comment on the mutation I engineered above, which introduces a three-residue change (G71A/G72A + E76P). The predicted template modeling (pTM) score and interface predicted template modeling (ipTM) scores are based on the template modeling (TM) score which are all metrics available in the AlphaFold Server visualization. The TM was originally proposed by Zang_&_Skolnick based on the Global Distance Test (GDT) and MaxSub. The scores are evaluated using a statistical association, measured by a correlation coefficient, after adjusting for differences in protein size. An interesting observation in Abramson et al. (2024) methods article they do not resport statistical tests of association due to small n populations paper. The paper describes pTM and ipTM as global ranking variables that can increase rates of disorder in model. In addition chain ranking can be performed with a variation of the pTM metric and pLDDT can be averaged for putative residues.

    FirstChange_G71A FirstChange_G71A FirstChange_G72A FirstChange_G72A ThirdChange_E76P ThirdChange_E76P

    Part 3: Evaluate Properties of Generated Peptides in the PeptiVerse

    Structural confidence alone is insufficient for therapeutic development. Using PeptiVerse, let’s evaluate the therapeutic properties of your peptide! For each PepMLM-generated peptide:

    PeptiVerse PeptiVerse

    Paste the peptide sequence. PeptiVersewt PeptiVersewt Paste the A4V mutant SOD1 sequence in the target field.

    MATKVVCVLKGDGPVQGTIRFEAKGDKVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVKADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGGRLACGVIGIAP
    Sequence TypeAmino Acid Sequence
    A4V Mutant
    PeptiVerseA4Vmutant PeptiVerseA4Vmutant

    Check the boxes Predicted binding affinity Solubility Hemolysis probability Net charge (pH 7) Molecular weight Compare these predictions to what you observed structurally with AlphaFold3. In a short paragraph, describe what you see. Do peptides with higher ipTM also show stronger predicted affinity? Are any strong binders predicted to be hemolytic or poorly soluble? Which peptide best balances predicted binding and therapeutic properties?

    Choose one peptide you would advance and justify your decision briefly.

    There can be alignment between the computational prediction scores from AlphaFold Server, specifically ipTM rank score, which are both “significant” because they are larger than 0.80 but the wild type ipTM score is 0.01 larger than the mutant ipTM. In regards to the thermodynamics expressed in the PeptiVerse datasheets. Solubility and penetrance increase in the WT as hydrophobicity declines, compared to the mutant, which has greater hydrophobicity and lower solubility and penetrance. The explanation for the thermodynamic differences between the wild type and the mutants is the exposure of hydrophobic bases to the solution, leading to more water cages forming around them in the mutant than in the wild type.

    Part 4: Generate Optimized Peptides with moPPIt

    Now, move from sampling to controlled design. moPPIt uses Multi-Objective Guided Discrete Flow Matching (MOG-DFM) to steer peptide generation toward specific residues and optimize binding and therapeutic properties simultaneously. Unlike PepMLM, which samples plausible binders conditioned on just the target sequence, moPPIt lets you choose where you want to bind and optimize multiple objectives at once.

    Open the moPPit Colab linked from the HuggingFace moPPIt model card Make a copy and switch to a GPU runtime. In the notebook: moPPItA4V_mutant moPPItA4V_mutant ~Make sure to switch De Novo to enter manual sequence

    Paste your A4V mutant SOD1 sequence. Choose specific residue indices on SOD1 that you want your peptide to bind (for example, residues near position 4, the dimer interface, or another surface patch). Set peptide length to 12 amino acids. Enable motif and affinity guidance (and solubility/hemolysis guidance if available). Generate peptides. ~Set target for affinity to original WT: MATKAVCVLKGDGPVQGTIRFEAKGDKVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVKADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGGRLACGVIGIAP After generation, briefly describe how these moPPit peptides differ from your PepMLM peptides. How would you evaluate these peptides before advancing them to clinical studies? It doesn’t stay connected to the necessary server to run.

Part B: BRD4 Drug Discovery Platform Tutorial (Gabriele)

[] Task B - Boltz Document

https://docs.google.com/document/d/18Vd9TQL2FjpEU0QdlGCgHe1D0BDoMzcfPRiFEXQIAas/preview

Boltz Lab BRD4 Drug Discovery Platform Tutorial Introduction This exercise walks you through a real drug discovery workflow using the Boltz Lab platform - from predicting how known drugs bind a cancer target, all the way to running AI-generated molecule libraries and interpreting the results. You will work on BRD4 (Bromodomain-containing protein 4), an epigenetic reader protein and validated oncology target. BRD4 has been the subject of intense medicinal chemistry effort in recent years. What you will learn • How to use Boltz Lab to predict protein-ligand binding structures • How to interpret Binding Confidence and Optimization Score metrics • How to set up a virtual screening project in Boltz Lab • How to compare known drugs and AI-generated molecules in a single workflow • How to critically evaluate computational predictions from a drug discovery perspective

Background: BRD4 and BET Bromodomains BRD4 is a member of the BET (Bromodomain and Extra-Terminal) family of epigenetic reader proteins. It recognises acetylated lysine residues on histone tails and recruits transcriptional machinery to gene promoters, driving expression of oncogenes including c-Myc. Dysregulated BRD4 activity is implicated in haematological malignancies, solid tumours, and inflammatory disease. This exercise inspects the example of JQ1 - the landmark BRD4 inhibitor reported by Filippakopoulos et al. in Nature 2010. The three compounds below capture a hit-to-candidate optimisation journey, including a deliberately instructive stereochemical twist. Stage Compound SMILES Hit Stripped
Back Core CC1C2C(=C(SC=2NCCN=1)C)C Lead Triazole +
Acid O=C(C[C@@H]1N=C(C)C2C(=C(SC=2N2C1=NN=C2C)C)C)O Candidate (+)-JQ1 O=C(C[C@H]1C2=NN=C(N2C3=C(C(C4=CC=C(C=C4)Cl)=N1)C(C)= C(S3)C)C)OC(C)(C)C

�� Note: Reference: Filippakopoulos P. et al. Selective inhibition of BET bromodomains. Nature 468, 1067-1073 (2010). Crystal structure PDB: 3MXF (BRD4 BD1 complexed with (+)-JQ1). 3MXF 3MXF source Tutorial designed by Geoffrey Smith Boltz Lab | BRD4 Platform Tutorial — MIT Guest Lecture Part 0: Sign-up to Boltz Lab Go to lab.boltz.bio, click “Request Access”, add your name and email while specifying as organization name “HTGAA”, and click “Submit request”.
boltzrequest boltzrequest We will try to make sure to approve your request within a day or two, giving you credits for both the exercise as well as further exploration. If you plan to use Boltz Lab for your final project and need more credits, please reach out to me at gabriele@boltz.bio.
Part 1: Structural Predictions in the Sandbox

Start with three Boltz-2 predictions in the Sandbox to understand how the model scores protein– ligand interactions across a real drug discovery progression. 1.1 The Boltz-2 Metrics Explained Before you run your first prediction, understand these three key outputs: Metric Range What it means When to trust it Binding Confidence 0 - 1 How confidently Boltz-2 places the ligand in the binding site. Higher = predicted more likely to bind.

0.7 considered
reliable; > 0.8 high
confidence Optimization Score 0 - 1 A relative affinity for use in congeneric series, or between known binders. Higher = predicted to bind more tightly. Use for relative
ranking, Structure Confidence 0 - 1 Measures the confidence of the predicted structure Higher = more likely the structure predicted correctly. 0.8 considered high confidence.

You need all three to be high to trust a prediction. 1.2 Running Your Three Predictions Navigate to the Boltz Sandbox at lab.boltz.bio and log in to your account.

  1. Go to Sandbox → New Prediction
  2. Name this BRD4 binder JQ1
  3. Select ‘Complex’, add ‘Sequence from RCSB’, and add 3MXF
  4. Continue through Constraints (not needed for this example), and select Jq1 as the Binder for an affinity prediction.
  5. Submit the prediction.
  6. Use the ‘Duplicate Prediction’ in the results review, and remove the small molecule.
  7. Add in the SMILES for the Hit and Lead.
  8. When predictions complete, record your results in the table below whichsmallmoleculeremoveandhow whichsmallmoleculeremoveandhow Tutorial designed by Geoffrey Smith Boltz Lab | BRD4 Platform Tutorial — MIT Guest Lecture Compound Binding Confidence Optimization Score Structure Confidence Hit
CompoundBinding ConfidenceOptimization ScoreStructure Confidence
Hit
Lead
JQI

Discussion Questions
• Does Binding Confidence increase as you move from hit to clinical candidate? What would you expect, and why might it deviate? • Inspect the predicted binding pose for JQ1. Can you identify potential key binding interactions. • Compare the Optimization Scores. How do the scores compare for JQ1 vs the Lead. Part 2: Setting Up a BRD4 Design Project Now you will create a small molecule Design Project - the Boltz Lab workflow for virtual screening and lead optimisation. We will set up BRD4 as a target using the clinical candidate as our structural reference. 2.1 Creating the Target

  1. From the dashboard, create a Design Projects via ‘New Project’
  2. Name your project: ‘BRD4 Workshop '
  3. Select ‘Small Molecule’
  4. Click Add Target and add the protein structure as in the Sandbox using PDB code 3MXF 5. Continue and let the apo structure complete. Continue if the structure looks good. 6. Leave binding residue selection blank, the platform will auto-detect the pocket 7. In the Molecular Probe field, paste the JQ1 SMILES.
  5. Predict Pocket Structure and complete the Target Set-Up �� Note: Why no binding residue selection? Boltz Lab uses the probe SMILES to identify the relevant binding pocket automatically. What the Probe Does The probe compound defines the active site geometry for the target. Boltz-2 uses the cofolded probe structure as an internal reference when scoring your library compounds. This is equivalent to providing a crystallographic template in traditional docking - except the model generates the structure on the fly.

Tutorial designed by Geoffrey Smith Boltz Lab | BRD4 Platform Tutorial — MIT Guest Lecture Part 3: Running Your Virtual Screen BRD4 is a well validated target, and therefore we will generate a small Library of 1K small molecule binders. For typical exploratory targets, Boltz recommends 20K as a minimum number of binders. 3.1: Run a Generative Design Campaign We will utilize the Boltz Lab small-molecule generative workflow. This generates novel molecules optimised for BRD4 binding using Boltz-2 as the scoring function.

  1. After creating the design project, Boltz Lab will prompt you to Generate binders with AI. 2. Name your experiment, provide a relevant hypothesis, and Create the Experiment. 3. The New Virtual Screen will be pre-configured with a Generative screen using the Enamine REAL space.
  2. Keep ‘Normal Filtering’ selected. This will ensure we only generate molecules acceptable to a medicinal chemist.
  3. Decide if you would like to apply any Molecule Filters. We recommend the ‘Drug-Like’ Preset.
  4. Select a custom number of Binders and enter 1K.
  5. Start the Virtual Screen.
  6. Allow binders to be generated, and View Results in Experiment �� Note: 1k molecules is a very small screen, for real applications where you plan to synthesize the molecule (e.g. your final project) we would recommend running at least 10-20k molecules. Part 4: Analysis and Discussion As your experiment completes, use the ‘Quick Add Candidates’ on the experiment screen to add JQ1 as a benchmark for generated designs. 4.1 Interpreting Your Results As your experiment completes, use the ‘Quick Add Candidates’ on the experiment screen to add JQ1 as a benchmark for generated designs. From your screen output, identify three categories of molecules: Category Criteria Likely interpretation High confidence binders Binding Confidence > 0.80 Opt. Score > 0.40 Strong predicted hits - inspect poses carefully Moderate confidence Binding Confidence 0.65–0.80 Opt. Score 0.25–0.40 Plausible binders - additional validation needed Low confidence / non-binders Binding Confidence < 0.65 Opt. Score < 0.25 Likely incorrect pose or non binding chemotype

Tutorial designed by Geoffrey Smith Boltz Lab | BRD4 Platform Tutorial — MIT Guest Lecture Discussion: As the virtual screen completes, assess the following: • How does JQ1 in the Design Project screen alongside the library. Does it score as the top compound?
• How do the top scoring binders compare in binding pose to JQ1? • Try adding a second target to your project via the dropdown in the structure viewer, for example, BRD2 (PDB: 5UEN). Re-run the top scoring binders against BRD2 and compare which compounds score highly for BRD4 but not BRD2. This is a selectivity analysis - a key part of real BET inhibitor programs. Resources and Further Reading Resource Link / Reference Boltz Lab Platform docs.boltz.bio Key BRD4 Paper Filippakopoulos P. et al. Nature 468, 1067–1073 (2010) JQ1 PDB Structure rcsb.org/structure/3MXF

Tutorial designed by Geoffrey Smith

Part C: Final Project: L-Protein Mutants

This homework requires computation that might take you a while to run, so please get started early.

Tools

See HTGAA Protein Engineering Tools spreadsheet

Week 6 HW: Genetic Circuits Part i

[]Homework — DUE BY START OF MAR 17 LECTURE

Week 6 HW: Genetic Circuits Part 01

    Assignment: DNA Assembly

    Protocol and Study Questions

    What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose?
    

    A proprietary gold standard heat-stable DNA polymerase alternative to Taq reagent synthesized and sold by Thermo Fisher Scientific. Unlike Taq which was isolated from thermophilic bacteria, Phusion emulates an archaea-based enzyme that evolved in the hydrothermal vents from extremeophile species. They function as DNA polymerases essentially in a form biomimickry with minimal replication error. The purpose of Phusion is to amplify target DNA sequences in the PCR protocol. Phusion PCR is more expensive but worth the investment to increase the accuracy of the run.

    What are some factors that determine primer annealing temperature during PCR?
    

    I don’t know if a question will formally cover this, but PCR methods include initialization, annealing, and extension. Heat is first applied in the initialization step of a hot start PCR protocol. There are two temperature modalities with a typical run: 205 °F or 208 °F. Phusion polymerase would be a proper reagent for a hot start PCR run. The next phase, denaturation, again includes a 201-208 °F step to separate double-stranded DNA templates by breaking hydrogen bonds. The next temperature cycle is the annealing step where temperature drops to 122–149 °F. A key factor with temperature annealing is to be exact with temperature and time to avoid an off-target reaction mixture.

    There are two methods from this class that create linear fragments of DNA: PCR, and restriction enzyme digests. Compare and contrast these two methods, both in terms of protocol as well as when one may be preferable to use over the other.  How can you ensure that the DNA sequences that you have digested and PCR-ed will be appropriate for Gibson cloning?  
    

    Fundamentally, the first difference between restriction enzymes and PCR is the inventor. Bacteria invented restriction enzymes to decrease the size of their individual single chromosome genome through Natural Selection to adapt to environmental niches faster. A professor once explained it to me like the traveller who embarks into the desert. Why would they carry junk DNA they do not need when they can prioritize every ounce of storage space for genes they will need to survive in the desert? PCR is an entirely different angle. Now we, the scientists, are using a laboratory machine to initialize, anneal, and extend sections of DNA we are interested in replicating experimentally. In fact, it is the exact opposite mechanism, like the continuum between divestment and investment of DNA. In terms of protocols, restriction enzymes are more of a puzzle based on the actual information available genetically, and PCR can be applied to any segment of DNA anywhere on the genome that can be extracted. Additionally, there is a quality differential between approaches in the input DNA.

    How does the plasmid DNA enter the E. coli cells during transformation?
    

    Bacteria naturally use three methods to transfer genetic material, including conjugation, transduction, and transformation. Conjugation requires direct contact. Transduction uses phages as intermediates. Transformation occurs in nature when bacteria incorporate genetic material from dead bacteria in the environment. Scientists have learned how to leverage bacterial transformation using heat shock and electroporation.

    Describe another assembly method in detail (such as Golden Gate Assembly (GGA))
    

    Golden Gate is one of my favorite parks in Cali and GGA is a new (circa 1996) assembly method detailed by New England Biolabs. Key components are Type IIS restriction enzymes, T4 DNA Ligase, the “backbone”, and Transcription Activator Like Effectors (TALEs). Conceptually, GGA is revolutionary because it unites restriction enzymes and PCR amplicon assembly in an expedited way. The workflow for GGA has a two-modality kit for either BsaI or BsmBI directed assemblies, both are restriction enzymes with recognition sites that generate 4-bp overhangs when cut. The they have different recognition sites, BsaI is for standard assembly and uses GGTCTC and BsmBI is a hierarchical system mod that uses CGTCTC.

    Explain the other method in 5 - 7 sentences plus diagrams (either handmade or online).
    

    An alternative to GGA is Gibson Assembly. In this approach:

    1. Step01: The homologous DNA assembly fragments must overlap by 20-40 bps.
    2. Step02: The reaction mix with 5’ exonuclease is applied which chews back 5’ ends of both fragments.
    3. Step03: The matching x overlapping ends then anneal or base pair spontaneously which aligns the joined fragments in the correct order.
    4. Step04: The addition of a high-fidelity DNA polymerase (i.e., Phusion) then extends the missing bases to produce the 3’ ends.
    5. Step05: The Taq DNA ligase is then applied to fill in the gaps, and with that all fragmentary assembles continuous double-stranded DNA plasmid or linear construct.
    Model this assembly method with Benchling or a similar tool!
    

    Gibson Protocol in Benchling GibAssemb Adding Magenta Plasmid MagentaPlasmidDemo

    Repeating a similar Benchling workflow to BioClub Japan teammate Nourelden Rihan's notebook. Not only is Dr. Rihan a natural leader of excellence in the work but his formatting makes me wish I were Egyptian. 
    

    In the workflow is to stich a GFP Protein to a plasmid. I tried the ENA route with a different vector and GFP ideal for mitochondrial superfluorescence imaging. I then took a different course.

    1. First, I instead start with a eGFP protein without any additional fragments attached to it– shown here as U55761_EGFP_CDS translated into AA sequence for better artistic effect. U55761_EGFP_CDS

    Properties

    Position 1-239 Summary MVSK…ELYK 239 AAs Molecular weight 26941.36 Da Isoelectric point (pI) 5.58 Extinction coefficient Cys fully reduced 21890.00 M-1cm-1 Abs 0.1% (1 g/l) 0.813 Cys fully oxidized 22015.00 M-1cm-1 Abs 0.1% (1 g/l) 0.817 Instability index 29.06 (stable) Amino Acid Frequencies

    Amino acid Count Ala A 8 3.3% Arg R 6 2.5% Asn N 13 5.4% Asp D 18 7.5% Cys C 2 0.8% Gln Q 8 3.3% Glu E 16 6.7% Gly G 22 9.2% His H 9 3.8% Ile I 12 5.0% Leu L 21 8.8% Lys K 20 8.4% Met M 6 2.5% Phe F 12 5.0% Pro P 10 4.2% Ser S 10 4.2% Thr T 16 6.7% Trp W 1 0.4% Tyr Y 11 4.6% Val V 18 7.5% Pyl O 0 0.0% Sec U 0 0.0% Net Charge

    pH Charge 4 22.49 4.5 13.06 5 5.50 5.5 0.67 6 -3.06 6.5 -5.96 7 -7.70 7.5 -8.63 8 -9.31 8.5 -10.37 9 -12.81 9.5 -17.98 10 -26.38

    1. After wrestling with my pre-loaded mito_mGFP plasmid, I used ChatGPT to find the simplest, vanilla, mammalian expression vector with CMV promoter and selectable marker possible. Mission Accomplished – not quite, many more steps to follow after this. Also shown in this screenshot from the Benchling account is the primers that I had to create to guide the Gibson Assembly to follow. pcDNA31_plasmidwREIIandPCRPrimers

    Assignment: Asimov Kernel

    Protocol and Study Questions

    Create a Repository for your work
    
    Create a blank Notebook entry to document the homework and save it to that Repository
    
    Explore the devices in the Bacterial Demos Repo to understand how the parts work together by running the Simulator on various examples, following the instructions for the simulator found in the “Info” panel (click the “i” icon on the right to open the Info panel)
    
    Create a blank Construct and save it to your Repository
    
    Recreate the Repressilator in that empty Construct by using parts from the Characterized Bacterial Parts repository
    
    Search the parts using the Search function in the right menu
    
    Drag and drop the parts into the Construct
    
    Confirm it works as expected by running the Simulator (“play” button) and compare your results with the Repressilator Construct found in the Bacterial Demos repository
    
    Document all of this work in your Notebook entry - you can copy the glyph image and the simulator graphs, and paste them into your Notebook
    
    Build three of your own Constructs using the parts in the Characterized Bacterials Parts Repo
    
    Explain in the Notebook Entry how you think each of the Constructs should function
    
    Run the simulator and share your results in the Notebook Entry
    
    If the results don’t match your expectations, speculate on why and see if you can adjust the simulator settings to get the expected outcome
    

    Resources

    1. Primer Design: HTGAA’s Supplement to Gibson Assembly Recitation
    2. NEB’s (New England Biolabs) video Introduction to Gibson Assembly
    3. NEB’s (New England Biolabs) explanation & protocols for Gibson Assembly®

Week 7 HW: Genetic Circuits Part 2

muse muse

[]Homework — DUE BY START OF MAR 31 LECTURE at 2PM ET

Week 7 HW: Genetic Circuits Part 2

    Assignment Part 1: Intracellular Artificial Neural Networks (IANNs)

    What advantages do IANNs have over traditional genetic circuits, whose input/output behaviors are Boolean functions?
    

    IANNs are ideal for the continuous transcriptomic-driven change observed in cells that are constantly moving and communicating in their intracellular environment – through analog computations. In contrast, much of the early synbio genetic circuit engineering was digital, with discrete logic gate switch programming or perhaps even through gene knock out (present versus absent) if such a connection would be permitted.

    Describe a useful application for an IANN; include a detailed description of input/output behavior, as well as any limitations an IANN might face to achieve your goal.
    

    Perhaps it’s still a bit conceptual at this time, but the redox lesion-boundary in my personal HTGAA project may be a useful application for framing an intracellular artificial neural network (IANN). My goal would be to create a perceptron-esque intracellular circuit used to classify tissue sample sites by integrating continuous biochemical inputs into a weighted threshold graded output that identifies lesion boundaries in host animals. This data will be dependent on a time-series with continuous expression and variation that is spatially distributed across host goats. The input layer in this model might not even include a mite or mite eggs as is traditionally used but instead models inputs like ROS, hypoxia, inflamatory damage that spreads across hosts in similar phenotypic patterns. The weights for this model would be the expected promoter strength, affinity, repression, similarity. Activation would be evaluated using threshold nonlinear gene response (it’s biology afterall) and the output would be fluorescent markeing (highlighting) of lesion bounardy cellular expression.

    Below is a diagram depicting an intracellular single-layer perceptron where the X1 input is DNA encoding for the Csy4 endoribonuclease and the X2 input is DNA encoding for a fluorescent protein output whose mRNA is regulated by Csy4. Tx: transcription; Tl: translation. 
    

    Example Circuit

    Draw a diagram for an intracellular multilayer perceptron where layer 1 outputs an endoribonuclease that regulates a fluorescent protein output in layer 2.
    
    CortassaMitosciModel CortassaMitosciModel

    With a minimal understanding of this week’s lab but help of the world wide web search and protcol droid Chat-GPT, I am now going to try to adapt the Cortassa lab’s (2004) computational mitochondrial oscillator on the reactive oxygen species model to the diagram challenge for the intracellular multilayer perceptron challenge. Why? I am endlessly fascinated by both. The Cortassa model hypotheses target spontaneous metabolic oscillations in heart cells, and is built using sound biology and stone-cold math. I also respect that Cortassa was modelling the mitochondria in 2003; we didn’t know anything about mitochondria back then, compared to what we know now. Another great feature of the Cortassa model is the scalability across time. Often, when we discuss the interstellar nature of scale in biology, we focus on space, but time is just as perplexing when it comes to the bioenergetics of metabolic redox reactions, as Cortassa et al (2004) describe, with timescales from milliseconds to hours. Lastly, the Cortassa model even considers Fluorescent probes, so as a side note, if this lab is looking for a PostDoc. Cortassa Lab Dynamic Mitochondrial Oscillator Model The dynamics are nonlinear Each modelled mitochondrion is assumed to possess an inner membrane anion channel abbreviated as IMAC. An IMAC is activated An IMAC is modulated by MG2+ and PH An IMAC is inhibited by amphiphilic molecules.
    The model has two state changes: There is the relaxation mitochondrial oscillator state with slow and fast spaces. Over the slow space ROS builds up in the mitochondrial matrix There is the stable mitochondrial oscillatory state Source: Cortassa S, Aon MA, Winslow RL, O’Rourke B. A mitochondrial oscillator dependent on reactive oxygen species. Biophys J. 2004 Sep;87(3):2060-73. doi: 10.1529/biophysj.104.041749. PMID: 15345581; PMCID: PMC1304608. Cortassa S, Aon MA, Marbán E, Winslow RL, O’Rourke B. An integrated model of cardiac mitochondrial energy metabolism and calcium dynamics. Biophys J. 2003 Apr;84(4):2734-55. doi: 10.1016/S0006-3495(03)75079-6. PMID: 12668482; PMCID: PMC1201507.

    Assignment Part 2: Fungal Materials

    What are some examples of existing fungal materials and what are they used for? 
    

    Fungal melanin is used for radiation shielding in spaceflight. Fungal chitan and chitosan hydrogels are being developed medical grade purification and regenerative tissue scaffolds. Mycelium foam as a new line of sustainable nanoscale fiber networks for textiles, upholstery, and shoe support materials. Fungal materials in form of mycelium composites with straw are also being used to engineer sustainable biobuilding materials. I found this nest in a pile of holly branches my wife had trimmed – I was opposed to it exactly for this reason. Nonetheless, holding this nest and thinking about existing fungal materials I can’t help but wonder why the Robin who built this wasn’t contemplating this question as well. Certainly in the evolutionary history of animal housing and nest building there are many unknown libraries of fungal materials integrated in the selection logic in say a bird’s intuition about different materials in different states of decay for each segment of the nest. I wonder how many generations it took for the American Robin to master the architecture for this nest. I think that fungal materials could also be designed using variations of the approach above to help more birds build their own nests – like the HTGAA Habitat for Humanity in a time when so many local nest-building species are increasingly losing their habitats and habits to parking lots and rental properties.

    RobinNest RobinNest
    What are their advantages and disadvantages over their traditional counterparts?
    

    I think it’s only upside for the applications I am envisioning. Except for biofilms, which pose a whole new set of challenges that I must investigate further. Mostly I am thinking of applications for housing animals and supporting animals in their construction projects. For example, birds will abandon a nest if a human touches it after they build it but set the material aside in a pile and the birds will help themselves to any innovation that meets their design needs. Same for dogs as well, I recently learned from one of our farm animal companions - Baku’s new preferred housing.

    BakuNest BakuNest
    What might you want to genetically engineer fungi to do and why? 
    

    There are so many things that we could genetically engineer with Fungi, so why is it so confounding just to pick one? Ironically, it’s easier to imagine what a bird would genetically engineer with fungi. Shelter is the first demand after all for survival; a bird’s nest could be a noble odyssey for scientific discovery. To start, what do birds build nests with? On this farm, birds use sticks, hay, and straight wool. What do all of these substrates have in common? For the most part, they are straight and bendable, but there are other notable attributes. Hay and Wool for example, are resistant to most environmental antagonists: water, wind, bugs, and fire. I also think they use composites because they are structurally reliable with a predictable function. For example, all three are tough enough and not heavy. A bird can pick up a piece with its beak, fly back to the nest, and drop it where they want it. Does this make it a tool? Anyway, once they drop a piece of stick, wool, or hay they then just have two more steps: tuck in side A and then tuck in side B – done. The problem with all three of these materials is that they exist independently of the task of providing birds with material for nests. Enter a fungi farm for bird nest materials. All we need are yeast plasmids, a PCR machine, a gel electrophoresis device, reagents, electricity, computers, and revolutionary institutions to teach us how. Fortified with our why and how, we commence…

    What are the advantages of doing synthetic biology in fungi as opposed to bacteria?
    

    There are several ways to approach this question. We choose bacteria because of their remarkable ability to adapt. While it’s important to acknowledge the bacterium’s collaboration with natural selection, it took over a billion years for the kingdom to develop this trait. Traditionally, we prioritize bacteria in synthetic biology because bacteria occupy the niche first. Why is this significant? Well, it can be summarized in one sentence: the niche is where matter and energy intersect. Fungi eventually occupy the niche also and when they do, they provide structure and in a less specific way. Perhaps their universality is because fungi possess the genes of plants and animals. Scale, is another reason Fungi. Bacteria leaned millions of years ago to the illusion of invisibility to multicellular ocular adaptations, which was advantageous to their race for niches against multicellular competitors. Not to downplay humans too much, we figured this out too, and we can even watch bacteria at their little spinning wheels and transform them from the inside out. However, be it tangential or not, I still wonder where the evolutionary studies are following the synbio bacteria prospectively as they reintegrate with nature. Therefore, in summary, fungi over bacteria because they replicate so slowly for microbiota, which for example better adjusts to human chronological understanding of space and time.

    Installation Guide and Walk-through of the Neuromorphic Wizard Software.
    Open link for the installation file: https://drive.google.com/drive/folders/10_gEzYV2J5hVOdKt6sNBeSH8cEMMGX8O
    Click the three dots.
    Click Download.
    Move the folder to somewhere you can access it from Terminal with cd command.
    If the downloaded file is zipped, then unzip it.
    In terminal run cd into NeuromorphicWizard and ls contents
    In terminal run conda create -n neuro_wiz python==3.10
    In terminal run conda activate neuro_wiz
    In terminal run pip install -r requirements.txt
    In terminal run python main.py
    

    Assignment Part 3: First DNA Twist Order

    Review the Individual Final Project documentation guidelines.

    Submit this Google Form with your draft Aim 1, final project summary, HTGAA industry council selections, and shared folder for DNA designs. DUE MARCH 20 FOR MIT/HARVARD/WELLESLEY STUDENTS Review Part 3: DNA Design Challenge of the week 2 homework. Design at least 1 insert sequence and place it into the Benchling/Kernel/Other folder you shared in the Google Form above. Document the backbone vector it will be synthesized in on your website.

    Reading & Resources

    The perceptron, the basis of artificial neural networks: https://www.geeksforgeeks.org/deep-learning/what-is-perceptron-the-simplest-artificial-neural-network/ Many examples of artificial neural networks made using biomolecules: https://doi.org/10.1016/j.biosystems.2024.105164

nmwa nmwa

Week 9 HW: Cell Free Systems

[] Homework — DUE BY START OF Apr 7 LECTURE

Homework Part A: General and Lecturer-Specific Questions

    General homework questions

    Explain the main advantages of cell-free protein synthesis over traditional in vivo methods, specifically in terms of flexibility and control over experimental variables. Name at least two cases where cell-free expression is more beneficial than cell production.  Describe the main components of a cell-free expression system and explain the role of each component.
    
    
    Why is energy provision regeneration critical in cell-free systems? Describe a method you could use to ensure continuous ATP supply in your cell-free experiment.
    

    Let it be noted, I really want to use George AI to engage this question, but I am running out of time, so I am just pitching shots up on the green to try and finish off with a putter and I also recognize metaphors are symptomatic of a weak mind, so there you have it. This is why we need AI too. Most people are susceptible to weak-minded syndrome. Therefore, since my overall understanding of what I am describing here is dulled, please do not try any of this at home. The bioenergetic cycles we wish to reconstruct in the cell-free environment literally resemble a water mill. I start with these two examples because one makes sense to me, and the other appears to be the same engineering concept but now there are some critical features missing that makes it more difficult to reconstruct the working order of things. I believe the same problem challenges us with cell-free systems. We have all the parts and experiments are clearly designed but what sustains them? There are clearly hidden variables that cannot be intuited at first glance. actualwatermill actualwatermill actualwindmill actualwindmill Now I am afraid if just put up my next image it will be swept away do to copyright infringement laws since I didn’t personally take a picture of this biochemical pathway. actualcellularaerobicrespirationmill actualcellularaerobicrespirationmill The irony of course is that the water mill and whatever mill above were invented when Newton was still alive if not before, likely long before, anyway the cellular aerobic respiration cycle was discovered inside of living organisms on Earth. In addition, we should note that the cellular cycle is part of many interacting open systems, and the other two mills are closed systems embedded in open living systems. Infact, is there anything sadder than a watermill without water for there in the bones of brick and iron is a functionless relic of a time before atomic energy had been harnessed. Perhaps a time we will return to in the end, but enough conjecture.

    A cell-free system picks up where the watermill ends, beginning from the assumption that what we are doing here will be as difficult as designing an engine powered by a river that is no longer there. Thus, the cell-free system must build the mill and the river and then let go, with the prediction being that if we are successful, this new cell-free system will keep running independently of our intervention. Now, in full disclosure, I might not be resilient enough to imagine a cell-free system world because I have been so conditioned by the Earth-assisted invention cycle, and I am overly sentimental about the importance of existing Earth Systems, as we inherited them from previous generations. That being said, I am not fully naive either and recognize where we are headed. Cell-Free systems are acceptable when the alternative is extinction. Certainly, if we have a mill already built, there are many less promising alternatives than finding a way to regenerate the river that was and fire that mill back up, and sustain them both. Function is clearly the keystone in the design of any cell-free form. Consider the aerobic respiration cycle in our cells, moving from left to right. Let’s categorize two functional buckets in the first cut. The first bucket is for the river, or the input systems, or energy sinks that are milled to power the functions in the other bucket, the cellular motion. The Glucose goes into the river bucket; it is derived as an independent input. Fortunately, in this model, at least Glucose is initially derived from external foodstuffs and converted into a crude energy source, regulated by dosage and intake. However, Glucose will also be an output of the internal system and will later be stored. Another key takeaway about the Glucose it’s one of the only initial inputs (aside from Odd-Numbered-Fatty-Acids) that is not an essential Amino Acid. This is why, when I lived in Boston and worked for the Boston Public Health Commission (BPHC), I survived on bargain fruit from the grocery store– no one was taking Glucose away from me just because I was a poor Epidemiologist. Another key feature of the aerobic respiration cycle is the neighborhoods in the overall metabolic map that different essential amino acids contribute to synthesizing enzymes required by the cell organelles. A similar process is observed in the waterwheel-powered grain mill. If you go inside the structure of a working watermill you will see an array of different shaking and turning gears and swinging rods all in concert to grind up harvested grains and kernels. However, today the water does not flow directly beside the mill, it has been rerouted and piped for pressurization, and then it falls onto the wheel to turn the primary shaft. The great thing about CFS is they too can utilize different pipes or pipette arrangements for additive components of the expression. For example the first reaction in the Glycolysis cascade involves the addition of Hydroxy-proline to Pyruvate as well as conversion to Glyoxylate. In addition, there are four other critical Amino acids, including Alanine, Glycine, Serine, and Cysteine, and then the addition of Threonine, which is also added at the same time to Acetyl-CoA, so it’s ready as a key enzyme for OXPHOS in the Mitochondria or CFS mitochondrial equivalent. However before the Acetyl-CoA can even be completely synthesized the Pyruvate must also be prepared as well as the Lucine. In fact, Acetyl-CoA is actually a much more nuanced synthesis step because although some Leucine will directly lead to the final Acetyl-CoA most will come through the build-up or synthesis of Aceto-Acetate along with Phenylalanine and tyrosine. Only then can the Aceto-Acetyl-CoA be synthesize with Even Numbered Fatty Acids and Lyine and Tryptophan to further increase the supply of Acetyl-CoA. Now what’s extraordinary about all these steps so far is that they only get us to the actual Kreb’s Cycle, which is the essential design element. In living cells, almost all of these reactions take place in the mitochondria. That said, there is a transition-state relationship between the mitochondria and the nucleus of the living cell that varies across phylogeny. Specifically, the variation here is the level of completeness in the transition of mitochondrial genetic information and associated functions to nuclear genome transcription and translation. This transition could potentially by supported by CFS designs that could identify artificial selection acclimations and adaptations that could further facilitate what many believe will be an inevitable combination of mitochondrion and nuclear genomes. Once inside the Krebs Wheel there are many advances to consider. For example unlike a waterwheel it matters which direction the Kreb’s Cycle turns. Temporality is also a requirement. There are many molecules and reactions that must already be working in the Krebs’ Cycle when the Glucose starts flowing. For example, there must be a balanced exchange between Aspartate and Oxalo-Acetate. Infact it is explainable here to see why Oxalo-Acetate has direct pathway back to Glucose almost like a signal that the cycle is ready to commence. However before Oxalo-Acetate can send that signal it must be synthesized by Phenylalanine and Tyrosine through Fumerate. However then some Oxalo-acetate must synthesize Citate which will then result in 2-Oxo-Glutarate which is also maintained through a titration with Glutamate that is synthesize from Proline and Histidine. Then a secondary loop exists between here and Succinyl-CoA that is also independently maintained by influx of Methyl-Malonyl-CoA synthesized by Valine and Propionyl-CoA synthesized from Isoleucine, Methionine, and other Odd-Numbered Fatty acids. In addition Succinyl-CoA combines with Glycine to form Porphyrins. CFS must maintain all of these inflows and outflows if CFS is also going to be dependent on aerobic respiration.

    Compare prokaryotic versus eukaryotic cell-free expression systems. Choose a protein to produce in each system and explain why.
    

    How would you design a cell-free experiment to optimize the expression of a membrane protein? Discuss the challenges and how you would address them in your setup.

    The classic chassis for a prokaryotic cell-free protein synthesis (CFPS) system is derived from bacterial cells, most commonly Escherichia coli lysates. These systems leverage many of the same evolutionary advantages that have allowed bacteria to dominate nearly every ecological niche on Earth: rapid growth, extraordinary metabolic efficiency, and immense adaptive capacity. Bacterial populations replicate clonally at remarkable speed, generating extensive genetic and phenotypic variation over short timescales. While this adaptability contributes to the robustness and productivity of bacterial systems, it also presents challenges for CFPS reproducibility. Even within the same culture lineage, significant divergence can emerge between generations as cells continuously adapt to environmental conditions, metabolic pressures, and selective constraints. As a result, maintaining consistency in CFPS preparations requires careful control of bacterial growth state, timing, and storage conditions. Researchers must decide which physiological state of the culture is most appropriate for lysate preparation, since a population harvested at one time point may differ substantially from the same culture only hours later. Delayed harvesting can lead to nutrient depletion, stress responses, population collapse, or contamination by competing microorganisms, all of which can alter lysate composition and downstream protein synthesis performance. To preserve experimental reproducibility, ancestral stocks are typically cryopreserved and periodically compared against actively growing cultures. Maintaining these reference populations and monitoring culture integrity introduces additional cost and labor, but it is essential for ensuring consistent inference about the CFPS system being modeled. Once stable growth conditions and colony maintenance strategies are established, however, bacterial CFPS platforms can produce specific proteins rapidly and at exceptionally high yield, making them powerful tools for synthetic biology, biosensing, metabolic engineering, and biologics production.

    The classic chassis for a cell-free eukaryotic system (CFES) uses yeast cells. Even at the smallest scale of CFES, there is more control over folding machinery, enzymatic dynamics, and chaperone mechanisms. CFES also offers additional functional categories that can be compared with those of larger Metazoans, including sophisticated immune systems, complex multiprotein structures, signaling networks, and specialized membrane structures. CFES takes more resources and steps to prepare for growth, and their cell lines are almost always more fragile than their CFPS counterparts. The machinery supporting CFES growth is also more expensive, which increases inequality in the research landscape between scientists. Inequality anywhere corrodes the quality of the science. For example, there are institutions where only engineers have access to even basic CFES technology, and entire departments of professors and their students see the machines only in conference pamphlets. This results in specialization of science based on having and not having facilities and technologies, which means considerable gaps form between curiosity, ability, and the type of research questions being pursued. This means that scientific progress in CFES systems, as opposed to CFPS, becomes like Moneyball, and this is certainly not just in the USA. Entire countries may face a CFPS ceiling, in which the only way they can pursue scientific questions about multicellular organisms is to leave their country and join another research institution. This ensures that inequalities in CF research breakthroughs persist, which is detrimental to science as a whole. For example, most of my knowledge about CFES comes from HTGAA; indeed, I didn’t even know what I didn’t know before this course, and there is still much to learn before I can fully articulate an answer to many of these questions.

    Imagine you observe a low yield of your target protein in a cell-free system. Describe three possible reasons for this and suggest a troubleshooting strategy for each.
    

    In CFPS, this is a much easier problem to solve. This is because in CFPS, if the protein we are targeting is synthesized when the match between the environment and genotypic expression prioritizes an expression of a target phenotype, for example, as we might see in V. Cholera that adapts proteins to form a Type Six Secretion System for competition with other bacteria in their colony. In CFES, the specificity of protein function outpaces the abundance of protein across a population. Variation that becomes an obstacle in CFES as individual organisms in a population develop differences in their gene networks that produce target proteins and the reason for the abundance of particular proteins can be counterintuitive to CFES scientists planning experiments, as anyone who has ever tried to grow a multicellular organism for resource harvesting. For example, the blueberry bushes that never produce fruit, or a milk goat that never produces enough milk.

    Homework question from Kate Adamala

    Design an example of a useful synthetic minimal cell as follows:
    
    
    Pick a function and describe it.
    

    I am going to develop a stress inflammatory signaling system in the Ste20 kinase family from the ground up. I will use MAP4K2 as my model.

    What would your synthetic cell do? What is the input and what is the output?
    

    I choose MAP4K2 because it is so complex and high up in the chain and stress signaling molecules. I realize this violates the minimal cell part of the instruction but actually another way of looking at simplicity is just repeating the same word over and over again and in that sense this might be the simplest gene of all. The full name is mitogen-activated protein kinase kinase kinase kinase kinase 2. My version of a MAP4K2 cell will be an upstream stress-responsibe kinase that will direct amplification of inflammatory and oxidative stress signaling cascades. The inputs will be TNF-α signaling, TRAF adaptor complexes, stress receptor activation, small GTPase signaling, Oxidative stress, and environmental stress. Outputs will be MAP3Ks, JNK pathway activation, p38 pathway modulation, c-Jun activation, and Cytoskeletal signaling.

    Could this function be realized by cell-free Tx/Tl alone, without encapsulation?
    

    Unfortunately not, I could express some protein, demonstrate kinase activity in vitro, and exhibit some substrate phosphorylation but I will not be able to recreate the full biological function of mitogen-activated protein kinase kinase kinase kinase kinase 2 without membrane-based signaling geometry, localization, and scaffold interactions.

    Could this function be realized by genetically modified natural cell?
    

    The good news is mitogen-activated protein kinase kinase kinase kinase 2 would be more effective as a modified natural cell than actual minimal synthetic cell which would be more complicated if that is even possible to comprehend. This is because MAP4K2 would benefit from genetically modified cell’s existing membrane organization, protein scaffolding, standing kinase networks, existing ATP homeostasis parameters, as well as the natural cells cytoskeleton, signaling receptors, phoshorylation machinery, and organization of spatial compartments. Furthermore in addition to the existing infrastructure in the natural cell I could add through the genetic modification flourescent reporters to beter visualize pathway activiation associated with my MAP4K2.

    Describe the desired outcome of your synthetic cell operation.
    

    My desired outcome of this simplified synthetic system to investigate which components are minimally required for MAP4K2 function.

    Design all components that would need to be part of your synthetic cell.
    

    Although I wish I had written my dissertation on this topic, now I’d better keep it short for this question. A minimal mapping of all of the components that will need to be part of my MAP4K2 synthetic cell are a Liposome, TX/TL, MAP4K2 DNA and mRNA, ATP and Mg²⁺, phosphorylation substrate, and fluorescent readout. Additional modules would include my base MAP4K2 platform and some simple peptide substrates, MAP3K10, scaffold/recruitment system, liposome membrane anchoring, and JNK/p38 pathway.

    What would be the membrane made of?
    

    I would use a liposome membrane made from phospholipids. Ingredients would include: POPC, POPG, Cholesterol, and Ni-NTA lipids.

    What would you encapsulate inside? Enzymes, small molecules.
    
    Which organism your Tx/Tl system will come from? Is bacterial OK, or do you need a mammalian system for some reason? (hint: for example, if you want to use small molecule modulated promotors, like Tet-ON, you need mammalian)
    
    How will your synthetic cell communicate with the environment? (hint: are substrates permeable? or do you need to express the membrane channel?)
    
    Experimental details
    

    List all lipids and genes. (bonus: find the specific genes; for example, instead of just saying “small molecule membrane channel” pick the actual gene.)

    How will you measure the function of your system?
    

    I will measure the function of my mitogen-activated protein kinase kinase kinase kinase 2 synthetic cell by detecting phosphorylation of an internal substrate. Successful function would be demonstrated by increased phosphorylation signal compared to no-kinase and kinase-dead controls, either using fluorescent phorphorylation reporter or Phos-tag gel shift assay.

    Example solution
    

    Based on: Lentini, R. et al., 2014. Nat comm, 5, p.4012.

    Pick a function and describe it. What would your synthetic cell do? What is the input and what is the output? Expand the sensing capacity of bacteria. Input: theophylline (inert to bacteria). Output of the SMC: IPTG. Output of the whole system: GFP produced in bacteria. (Theophyline aptamer reference: Martini, L. & Mansy, S.S., 2011. Cell-like systems with riboswitch controlled gene expression. Chemical Communications, 47(38), p.10734.) Could this function be realized by cell-free Tx/Tl alone, without encapsulation? No. If the IPTG were not encapsulated, it would go into the bacteria without the need of theophylline-induced membrane channel synthesis, thus the synthetic cell actuator would not exist. Could this function be realized by genetically modified natural cell? Yes, in this particular case: the theophylline aptamer could be incorporated into a transformed gene. This lacks generality though – it is easier to make SMC than modify bacteria, so in this system a single bacteria reporter can be used to detect various small molecules. Describe the desired outcome of your synthetic cell operation. In the presence of SMC, bacteria sense theophylline. Design all components that would need to be part of your synthetic cell. What would be the membrane made of? Phospholipids + cholesterol. What would you encapsulate inside? Enzymes, small molecules. cell-free Tx/Tl system, IPTG, gene for membrane transporter under the control of theophylline aptamer. Which organism your Tx/Tl system will come from? Is bacterial OK, or do you need a mammalian system for some reason? (hint: for example, if you want to use small molecule modulated promotors, like Tet-ON, you need mammalian) Bacterial, because of the theophylline riboswitch used as SMC input. How will your synthetic cell communicate with the environment? (hint: are substrates permeable? or do you need to express the membrane channel?) The membrane is permeable to the input molecule (theophylline), the output is IPTG that will cross the membrane via the membrane pore created after theophyline-initiated gene expression. Experimental details List all lipids and genes. (bonus: find the specific genes; for example, instead of just saying “small molecule membrane channel” pick the actual gene.) Lipids: POPC, cholesterol Enzymes: bacterial cell-free Tx/Tl Genes: a-hemolysin (aHL) to encapsulate in SMC Biological cells: E.coli transformed with GFP under T7 promoter and a lac operator How will you measure the function of your system? Measure GFP output of the cells via flow cytometry. Alternatively, use enzymatic reporter, like luciferase, and measure bulk output of the enzyme. (a) In the absence of artificial cells (circles), E. coli (oblong) cannot sense theophylline. (b) Artificial cells can be engineered to detect theophylline and in response release IPTG, a chemical signal that induces a response in E. coli. Homework question from Peter Nguyen

    Freeze-dried cell-free systems can be incorporated into all kinds of materials as biological sensors or as inducible enzymes to modify the material itself or the surrounding environment. Choose one application field — Architecture, Textiles/Fashion, or Robotics — and propose an application using cell-free systems that are functionally integrated into the material. Answer each of these key questions for your proposal pitch:

    Write a one-sentence summary pitch sentence describing your concept. How will the idea work, in more detail? Write 3-4 sentences or more. What societal challenge or market need will this address? How do you envision addressing the limitation of cell-free reactions (e.g., activation with water, stability, one-time use)? Homework question from Ally Huang

    Freeze-dried cell-free reactions have great potential in space, where resources are constrained. As described in my talk, the Genes in Space competition challenges students to consider how biotechnology, including cell-free reactions, can be used to solve biological problems encountered in space. While the competition is limited to only high school students, your assignment will be to develop your own mock Genes in Space proposal to practice thinking about biotech applications in space!

    For this particular assignment, your proposal is required to incorporate the BioBits® cell-free protein expression system, but you may also use the other tools in the Genes in Space toolkit (the miniPCR® thermal cycler and the P51 Molecular Fluorescence Viewer). For more inspiration, check out https://www.genesinspace.org/ .

    Provide background information that describes the space biology question or challenge you propose to address. Explain why this topic is significant for humanity, relevant for space exploration, and scientifically interesting. (Maximum 100 words) Name the molecular or genetic target that you propose to study. Examples of molecular targets include individual genes and proteins, DNA and RNA sequences, or broader -omics approaches. (Maximum 30 words) Describe how your molecular or genetic target relates to the space biology question or challenge your proposal addresses. (Maximum 100 words) Clearly state your hypothesis or research goal and explain the reasoning behind it. (Maximum 150 words) Outline your experimental plan - identify the sample(s) you will test in your experiment, including any necessary controls, the type of data or measurements that will be collected, etc. (Maximum 100 words) Homework Part B: Individual Final Project

    We’d like students to start exploring their final project in depth this week! Of your three Aims, for this week you should have at least Aim 1 decided and written down.

    Put your chosen final project slide in the appropriate slide deck following the instructions on slide 1: MIT/Harvard/Wellesley ONE FINAL PROJECT IDEA Committed Listener ONE FINAL PROJECT IDEA Submit this Final Project selection form if you have not already. Begin planning how you will write your final project documentation based on these guidelines Prepare your first DNA order and put it in the “Twist (MIT)” or “Twist (Nodes)” tab of the 2026 HTGAA Ordering: DNA, Reagents, Consumables spreadsheet, as appropriate. First Twist order deadline for MIT/Harvard/Wellesley students is Friday, April 3 at 11PM ET First Twist order deadline for Committed Listeners is Friday, April 10 at 11PM ET. (Your Node Lead will place the Twist order, so please work with them to finalize your constructs and ordering decisions.)

    Reading & Resources

    Cell-free protein synthesis (explanation by minipcr's DNAdots) Validation of Cell-Free Protein Synthesis Aboard the International Space Station (ACS Synthetic Biology paper by Ally Huang et al.)

Week 10 HW: Imaging and Measurement

Week 10 HW: Imaging and Measurement

    Homework: Final Project

      Homework is partly based on data that will be generated in the Waters Immerse Lab in Cambridge, MA. Students will characterize green fluorescent protein (eGFP, a recombinant protein standard) structure (primary, secondary/tertiary) in the lab using liquid chromatography and mass spectrometry, as well as Keyhole Limpet Hemocyanin (KLH) oligomeric states using charge detection mass spectrometry (CDMS). Data generated in the lab needed to do the homework is included both within this document and in the Appendix of the laboratory protocol.
    
      Please identify at least one (ideally many) aspect(s) of your project that you will measure. It could be the mass or sequence of a protein, the presence, absence, or quantity of a biomarker, etc.
    
      Please describe all of the elements you would like to measure, and furthermore describe how you will perform these measurements.
    

    There are many measurements that could be taken. The DNA of the mites and their larva is a target. In addition the bacteria and other microbiota and parasites that capitalize on the infestation damage to the host epidermis. This ofcourse brings up the geometry of the host tissue and biochemical molecules all of which can be measured quantiatively or qualitatively. Specifically, when it comes to host cells there are living and deceased keratinocytes and corneocytes and the odd hair follicle, especially in most heavily infested cases. There is superinfection residues full of bacterial cocci and rods or periods and semi colons as Dr. Betsy Dyer writes. There crushed and desciated erythrocytes, platelets, and leukocytes. In addition there will be scattering fluctuations of neturophils, eosinophils, macrophages, and lymphocytes. In addition, goats are always on the move grazing when they’re not cuddled up in hay or dirt. Therefore there will be pollen grains, plant frags, seed husks and hay chaff, and plant hairs in addition to other ecotoparasites. What I want to measure most though is stress.

    What are the technologies you will use (e.g., gel electrophoresis, DNA sequencing, mass spectrometry, etc.)? Describe in detail.

    What does the farmer’s molecular lab contain. This will certainly increase in the coming decades as the struggle to draw nutrients from the Earth is increasingly a necessity and struggle. The same for the labor of keeping herds alive admist the global conflagurations and increasing heat and parasites. I predict by the time I retire to the dirt every farmer worth their salt will have a ready supply of gel electrophoresis, DNA sequencing, and mass spectrometry equipment and proper freezer in their shed lest they have a lab in Boston at the ready to ring.

    Homework: Waters Part I — Molecular Weight

      We will analyze an eGFP standard on a Waters Xevo G3 QTof MS system to determine the molecular weight of intact eGFP and observe its charge state distribution in the native and denatured (unfolded) states. The conditions for LC-MS analysis of intact protein cause it to unfold and be detected in its denatured form (due to the solvents and pH used for analysis).
    
    kit kit
      Based on the predicted amino acid sequence of eGFP (see below) and any known modifications, what is the calculated molecular weight? You can use an online calculator like the one at
    

    https://web.expasy.org/compute_pi/

    eGFP Sequence:
    Note: This contains a His-purification tag (HHHHHH) and a linker (the LE before it).
    eGFP eGFP
    MVSKGEELFTG VVPILVELDG DVNGHKFSVS GEGEGDATYG KLTLKFICTT GKLPVPWPTL
    VTTLTYGVQC FSRYPDHMKQ HDFFKSAMPE GYVQERTIFF KDDGNYKTRA EVKFEGDTLV
    NRIELKGIDF KEDGNILGHK LEYNYNSHNV YIMADKQKNG IKVNFKIRHN IEDGSVQLAD
    HYQQNTPIGD GPVLLPDNHY LSTQSALSKD PNEKRDHMVL LEFVTAAGIT LGMDELYKLE
    HHHHHH
    

    The high MW estimate from Benchling is 28006.50 Da for 1-247 AA. The low MW estimate with BLAST search and selection of P42212 · GFP_AEQVI combined with the ExPASy calculator 1-238 AA link resulted in Compute pI/MW - Results GFP_AEQVI (P42212) Description: Green fluorescent protein Organism: Aequorea victoria (Water jellyfish) (Mesonema victoria) The parameters have been computed for the following feature: FT CHAIN 1 238 Green fluorescent protein The computation has been carried out on the complete sequence (238 amino acids). Molecular weight (Da): 26886.32 (average mass) 26869.36 (monoisotopic mass) Theoretical pI: 5.67

      Calculate the molecular weight of the eGFP using the adjacent charge state approach described in the recitation. Select two charge states from the intact LC-MS data (Figure 1) and:
    
    QDetermine z for each adjacent pair of peaks (n, n+1).
    A
    [ z = (m/zn+1) / ((m/zn) − (m/zn+1)) ]
    QDetermine z for adjacent peaks at m/z 875.4421 and 903.7148.1
    A

    Formula:

    z = (m/zn+1) / ((m/zn) − (m/zn+1))

    Substitute values:

    z = 903.7148 / (875.4421 − 903.7148)

    Simplify denominator:

    z = 903.7148 / (−28.2727)

    Solve:

    z ≈ −31.96

    Take absolute value:

    z ≈ 32

    Therefore, the charge state is +32.

    1 Peak values adapted from Ade Larsen homework data. Formatting of LaTeX blocks for math inside Git using the AI protocol droid Chat-GPT.

    QDetermine the MW of the protein using the relationship between m/zn, MW, and z.
    A
    [ MW = z · (m/zn) − z · H ]
    QDetermine the molecular weight (MW) of the protein using the relationship between m/zn, MW, and z.1
    A

    Relationship between ion mass and charge:

    m/z = (MW + zH) / z

    where:

    • MW = neutral molecular weight of the protein
    • z = charge state
    • H = mass of a proton

    Proton mass:

    H = 1.0073 Da

    Rearrange equation to solve for MW:

    MW = z · (m/zn) − z · H

    Substitute values:

    MW = 32 · (875.4421) − 32 · (1.0073)

    Simplify:

    MW = 28014.1472 − 32.2336

    Solve:

    MW ≈ 27981.91 Da

    Therefore, the molecular weight of the protein is ~27.98 kDa.

    1 Peak values adapted from Ade Larsen homework data. Theoretical GFP molecular weight from Aequorea victoria GFP sequence analysis. Formatting of LaTeX blocks for math inside Git using the AI protocol droid Chat-GPT.

    Calculate the accuracy of the measurement using the deconvoluted MW from 2.2 and the predicted weight of the protein from 2.1 using:

    [ Accuracy = | MWexperiment − MWtheory | / MWtheory ]
    massspecegfp massspecegfp
    QCalculate the accuracy of the measurement using the deconvoluted MW from Section 2.2 and the predicted molecular weight from Section 2.1.1
    A

    Accuracy relationship:

    Accuracy = | MWexperiment − MWtheory | / MWtheory

    Values:

    • MWexperiment = 27981.91 Da
    • MWtheory = 26886.32 Da

    Substitute values:

    Accuracy = |27981.91 − 26886.32| / 26886.32

    Simplify numerator:

    Accuracy = 1095.59 / 26886.32

    Solve:

    Accuracy ≈ 0.0407

    Therefore, the experimental measurement differs from the theoretical molecular weight by ~0.0407.

    1 Experimental molecular weight determined from ESI-MS deconvolution using adjacent charge-state analysis. Theoretical molecular weight derived from the Aequorea victoria GFP amino acid sequence.

    Homework: Waters Part II — Secondary/Tertiary structure

    We will analyze eGFP in its native, folded state and compare it to its denatured, unfolded state on a quadrupole time-of-flight MS. We will be doing MS-only analysis (no liquid chromatography, also known as “direct infusion” experiments) on the Waters Xevo G3-QToF MS.

    1. Based on learnings in the lab, please explain the difference between native and denatured protein conformations. For example, what happens when a protein unfolds? How is that determined with a mass spectrometer? What changes do you see in the mass spectrum between the native and denatured protein analyses (Figure 2)?
      Figure 2.  Comparison of the mass spectra between denatured (top) and native (bottom) eGFP standard on the Waters Xevo G3 QTof MS.

      Figure 2. Comparison of the mass spectra between denatured (top) and native (bottom) eGFP standard on the Waters Xevo G3 QTof MS.

    When a protein unfolds because of an environmental exposure, be it from acid or heat or other denaturant, the surface area of that protein is more exposed to protons from the environment that can bond to the proton during ionization. The mass spectrometer then uses electrospray ionization (ESI) to further shift the charge state of the protein. The way this works is the protein is ejected from a charged needle and the droplets formed evaporate. The time of flight is then the movement of these charged droplets as they transition into a gaseous phase.

    1. Zooming into the native mass spectrum of eGFP from the Waters Xevo G3 QTof MS (see Figure 3), can you discern the charge state of the peak at ~2800 $\frac{m}{z}$? What is the charge state? How can you tell?
      Figure 3.  Native eGFP mass spectrum from the Waters Xevo G3 Q-Tof MS.  The inset is a zoomed-in view of the charge state at ~2800 $\frac{m}{z}$ on a mass spectrometer with 30,000 resolution.

      Figure 3. Native eGFP mass spectrum from the Waters Xevo G3 Q-Tof MS. The inset is a zoomed-in view of the charge state at ~2800 $\frac{m}{z}$ on a mass spectrometer with 30,000 resolution.

    The provided peak for charge state 10+ is ~2,800 m/z. The predicted MW of eGFP is ascertained to be ~ 26,886.32 Da. To calculate m/z for ionized protein droplet m/z = (MW + zH) / z which is the protein ion relationship where MW is molecular weight and z is charge state, and H is the mass of one proton. Now we plugin values. The mass of one proton H = 1.0073 Da. Now we rearrange the relationship equation with our available information to solve for z, so that z = MW / (m/z) - H, and m/z = is the given peak near 2,800 m/z or slighly less at m/z = 2799.42. Now we find the deconvoluted MW from before which is MW = 27,981.91 Da. Then we substitute values into our final forumula, z = 27.981.91 / (2,799.42 - 1.0073). Next z = 27,981.91 / 2,798.41. Next z ≈ 9.99. Then we round to the whole number, so z ≈ 10, which means are estimated charge state of 10 carries 10 positive charges for the native eGFP protein ion of ~ 2,800 mz.

    1. Can you observe the charge state for the zoomed-in peak in the mass spectrum for the intact eGFP? If yes, what is it? If no, why not?

    We can make an educated guess. Using zoom view in figure 1 there are multiple possible peaks around m/z = 1,473.7 and they all share the same charge state. To measure distribution, we take a min and max for example 1,473.63 and 1,473.67. We then subtract the min from the max to compute our peak spacing which amounts to about 0.04. We then use the isotope spacing relationship formula where z = 1 / 0.04 which equals approximately 24.94 which we round to z = 25. This produces our back of the envelope approximation of +25 charge state.

    Homework: Waters Part III — Peptide Mapping - primary structure

    We will digest the eGFP protein standard into peptides using trypsin (an enzyme that selectively cleaves the peptide bond after Lysine (K) and Arginine (R) residues. The resulting peptides will be analyzed on the Waters BioAccord LC-MS to measure their molecular weights and fragmented to confirm the amino acid sequence within each peptide – generating a “peptide map”. This process is used to confirm the primary structure of the protein.

    There are a variety of tools available online to calculate protein molecular weight and predict a list of peptides generated from a tryptic digest. We will be using tools within the online resource Expasy (the bioinformatics resource portal of the Swiss Institute of Bioinformatics (SIB)) to predict a list of tryptic peptides from eGFP.

    1. How many Lysines (K) and Arginines (R) are in eGFP? Please circle or highlight them in the eGFP sequence given in Waters Part I question 1 above. (Note: adding the sequence to Benchling as an amino acid file and clicking biochemical properties tab will show you a count for each amino acid).

      Amino Acid Frequencies from Benchling

      AA3AA1CountPercent
      AlaA83.2%
      ArgR62.4%
      AsnN135.3%
      AspD187.3%
      CysC20.8%
      GlnQ83.2%
      GluE176.9%
      GlyG228.9%
      HisH156.1%
      IleI124.9%
      LeuL228.9%
      LysK208.1%
      MetM62.4%
      PheF124.9%
      ProP104.0%
      SerS104.0%
      ThrT166.5%
      TrpW10.4%
      TyrY114.5%
      ValV187.3%
      PylO00.0%
      SecU00.0%
    2. How many peptides will be generated from tryptic digestion of eGFP?

      1. Navigate to https://web.expasy.org/peptide_mass/

      2. Copy/paste the sequence above into the input box in the PeptideMass tool to generate expected list of peptides.

        massposition#MCmodificationspeptide sequence
        4472.1752170-2100HNIEDGSVQLADHYQQNTPI GDGPVLLPDNHYLSTQSALS K
        2566.2931217-2390DHMVLLEFVTAAGITLGMDE LYK
        2437.26085-270GEELFTGVVPILVELDGDVN GHK
        2378.257754-740LPVPWPTLVTTLTYGVQCFS R
        1973.9062142-1570LEYNYNSHNVYIMADK
        1503.659728-420FSVSGEGEGDATYGK
        1266.578387-970SAMPEGYVQER
        1083.4979240-2470LEHHHHHH
        1050.5214115-1230FEGDTLVNR
        982.4952133-1410EDGNILGHK
        821.394081-860QHDFFK
        790.355275-800YPDHMK
        769.391347-530FICTTGK
        711.2944103-1080DDGNYK
        655.381398-1020TIFFK
        602.2780211-2150DPNEK
        579.3137128-1320GIDFK
        507.2925164-1670VNFK
        502.3235124-1270IELK
      3. Use Figure 4 below as a guide for the relevant parameters to predict peptides from eGFP.

      4. Click “Perform the Cleavage” button in the PeptideMass tool and report the number of peptides generated when using trypsin to perform the digest.

        Figure 4.  Example conditions for predicting the number of tryptic peptides from the eGFP standard.  Please replicate all parameters shown above.

        Figure 4. Example conditions for predicting the number of tryptic peptides from the eGFP standard. Please replicate all parameters shown above.

    pepmass pepmass
    1. Based on the LC-MS data for the Peptide Map data generated in lab (please use Figure 5a as a reference) how many chromatographic peaks do you see in the eGFP peptide map between 0.5 and 6 minutes? You may count all peaks that are >10% relative abundance.
      Figure 5a. Total ion chromatogram (TIC) of the eGFP peptide map. The peak at 2.78 minutes is circled, and its MS data is shown in the mass spectrum in Figure 5b, below.

      Figure 5a. Total ion chromatogram (TIC) of the eGFP peptide map. The peak at 2.78 minutes is circled, and its MS data is shown in the mass spectrum in Figure 5b, below.

    Depending on the peaks we select as GTE to 10% relative, about 26 peaks.

    1. Assuming all the peaks are peptides, does the number of peaks match the number of peptides predicted from question 2 above? Are there more peaks in the chromatogram or fewer?

    Yes they are approximately the same.

    1. Identify the mass-to-charge ($\frac{m}{z}$) of the peptide shown in Figure 5b. What is the charge ($z$) of the most abundant charge state of the peptide (use the separation of the isotopes to determine the charge state). Calculate the mass of the singly charged form of the peptide ($\small{[M\!\!+\!\!H]^+}$) based on its $\frac{m}{z}$ and $z$.

      Figure 5b. Mass spectrum figure to show $\frac{m}{z}$ for the chromatographic peak at 2.78 min from Figure 5a above. The inset is a zoom-in of the peak at $\frac{m}{z}$ 525.76, to discern the isotope peaks.

      Figure 5b. Mass spectrum figure to show $\frac{m}{z}$ for the chromatographic peak at 2.78 min from Figure 5a above. The inset is a zoom-in of the peak at $\frac{m}{z}$ 525.76, to discern the isotope peaks.

      Figure 5c. Fragmentation spectrum of the peptide eluting at retention time 2.78 minutes in Figure 5a (above).

      Figure 5c. Fragmentation spectrum of the peptide eluting at retention time 2.78 minutes in Figure 5a (above).

    Start with the calculation of mass of the singly charged form of peptide mass from Figure 5b

    [M + H]+experiment ≈ 1050.52694 Da

    Then compare to the expected PeptideMass value, with the closest expected peptide being FEGDTLVNR

    [M + H]+experiment ≈ 1050.52145 Da

    Then calculate the mass error:

    mass error = 1050.52694 - 1050.52145 = 0.00594 Da

    Then convert the mass error to ppm

    mass error (ppm) = (0.00594 / 1050.52145) * 1,000,000 = 5.23 ppm

    1. Identify the peptide based on comparison to expected masses in the PeptideMass tool. What is mass accuracy of measurement? Please calculate the error in ppm. (Recall that $ \text{Accuracy} = \frac{|MW_{\text{experiment}} - MW_{\text{theory}}|}{MW_{\text{theory}}} $ )

    Now we determine mass accuracy, here is the formula

    Accuracy =|MWexperiment − MWtheory|

    / MWtheory

    Then we substitute in our values from the previous problem

    Accuracy = |1050.52694 − 1050.52145|/1050.52145 Accuracy = 0.00549 / 1050.52145 Accuracy ≈ 10−6

    Lastly, we convert again to ppm

    ppm error = (5.23 × 10−6) x 1,000,000 ppm error = 5.23 ppm

    1. What is the percentage of the sequence that is confirmed by peptide mapping? (see Figure 6)
    ychrt ychrt

    88% of Amino Acids in eGFP in Figure 6

    Bonus Peptide Map Questions 8. Can you determine the peptide sequence for the peptide fragmentation spectrum shown in Figure 5c? (HINT: Use your results from Question 2 above to match the peptide molecular weight that is closest to that shown in Figure 5b. Copy and paste its sequence into this tool online to predict the fragmentation pattern based on its amino acid sequence: http://db.systemsbiology.net/proteomicsToolkit/FragIonServlet.html. What is the sequence of the eGFP peptide that best matches the fragmentation spectrum in Figure 5c?

    1. Does the peptide map data make sense, i.e. do the results indicate the protein is the eGFP standard? Why or why not? Consult with Figure 6, which depicts the % amino acid coverage of peptides positively identified using their calculated mass and fragmentation pattern.

    Homework: Waters Part IV — Oligomers

    zchrt zchrt

    Homework: Waters Part V — Did I make GFP?

    *Part V copied from Ade Larsen page because I did not attend Waters Lab as CL

    Reading & Resources

    Fundamentals of peptide and protein mass spectrometry (Steve Carr, the Broad Institute of MIT and Harvard): https://www.youtube.com/watch?v=PFOodSbH9IY This link has 2 tutorial video presentations on some of the basics of mass analyzers and different information you can learn from “Tandem” MS (also called MS/MS): https://www.asms.org/about-mass-spec/fundamentals-hardware-instrumentation History of LC and MS, a video presentation by Professor James Jorgenson: https://player.vimeo.com/video/53604465 Nature Methods perspectives article on “Best Practices for intact protein analysis for top-down mass spectrometry: https://www.nature.com/articles/s41592-019-0457-0 Principles of Intact Protein Analysis: https://www.youtube.com/watch?v=ySql2iKRN6U What is Mass Spectrometry?: https://www.asms.org/docs/default-source/what-is-ms-booklet/whatisms-ppt_201243e71d0ea09c6d75a448ff000066efb8.pdf?sfvrsn=627b70c3_0 Basics of Reverse Phase Liquid Chromatography: https://www.ionsource.com/tutorial/chromatography/rphplc.htm Peptide and protein for Bioanalysis using LC-MS: https://www.youtube.com/watch?v=vsQ-Kr4Gdoo Article - Native vs Denatured : An in Depth Investigation of Charge State and Isotope Distributions: https://pmc.ncbi.nlm.nih.gov/articles/PMC7539638/
image image

Week 11 HW: Building Genomes

Homework — DUE BY START OF APR 28 LECTURE

Week 11 HW Overview

    Part A: The 1,536 Pixel Artwork Canvas | Collective Artwork

    [!info] Note that this homework is due a week later than it ordinarily would due to its release a week later than normal.

    [x] Contribute at least one pixel to this global artwork experiment before the editing ends on Sunday 4/19 at 11:59 PM EST. Q4F1Electra2X Q4F1Electra2X

    A personalized URL was sent to the email address associated with your Discourse account, and you can discuss the artwork on the Discourse. [x] If you did not have a chance to contribute, it’s okay, just make sure you become a TA this fall! 😉

    Make a note on your HTGAA webpages including: what you contributed to the community bioart project     
    (e.g., “I made part of the DNA on the bottom right plate”)?
    
    What you liked about the project?
    

    My favorite part about the project was when different people started collaborating or interacting on a design. I liked the timer and not knowing if someone else recognized the pattern and the opportunity to scale up quickly on a design when different contributors stepped up and worked on the same art. Then at some point in the process, I started to see the maker space as a giant multi-threaded game of GO in color, and it even seemed like some folks started picking up on that and making better shapes. Initially, the competitive streak triggered and I thought game on. Then, I remembered, wait, we are supposed to be working together here. Now, there was a point when the exercise was not as cool. Specifically, when it was first unveiled, everyone was talking about an Egyptian flag, for example, and I was thinking I didn’t see a flag and there were these sections where it was like someone just painted over everything else. However, it was then unveiled (maybe I was just slow on all these details, but it was all a surprise to me:) that there was this hysteresis process built into the application which I thought was brilliant. Then I was right as rain about the whole exercise and better appreciated all of the evolutions.

    What about this collaborative art experiment could be improved next year?
    

    Well, here’s the thing, now that I know about the hysteresis slider, I’m just going to wait until the end of the lab to start plotting. Seriously, though, one idea might be to make it like an archaeological dig or a puzzle. No, I’ve got it. I think we need to make it like a massive mind-sweeper puzzle, and add a component so a portal square can be detected, revealing a new chamber that leads to another massive mind-sweeper puzzle. Alternatively, if we don’t want to just digress into a video game, the next iteration could be a 96-well plate or a gel or a bacterial plasmid,and we could all receive an invitation to make contributions (even redesign experiments), almost like an interactive collaborative Wiki. They also have chemistry and microbe simulators. For example, there is the BEAKER application by THIX (https://thix.co/beaker). Of course, the dream would be an HTGAA BEAKER collaboration with a history slider, so we could scroll backward through experimental changes, including the lab notebook. The great thing about BEAKER is that it also lets you auto-document reaction steps, which could scroll as well. Then, if we could add more organic and biochemical molecules and run an electric pulse through water, we could even run Miller-Laurie (sp?) experiments. I also thought there were a number of lab assignments and demonstrations from the lecture that could have been run in a similar collaborative sandbox. I could also the promise in benchling to support this process. For example we could all be given a link to set-up our own lab notebooks based on a template which was already there this semester but we could just build on that.

    Part B: Cell-Free Protein Synthesis | Cell-Free Reagents

    CFMMC CFMMC

    Getting It Done Note:

    1. Ronan provides a link in lab slide deck to a simulation tool

    2. We are transported to a virtual engineering space where we can design a floor plan, an assembly model, and in the assembly model variables. In addition, radio buttons were included to set the preferences for the simulation space. We can even adjust camera views to observe the cloud lab setup we design. alfaepilabstandard alfaepilabstandard viewb viewb

    3. Ronan provides a link in lab slide deck to Benchling directory GIDN GIDN

      1. Referencing the cell-free protein synthesis reaction composition (the middle box outlined in yellow on the image above, also listed below), provide a 1-2 sentence description of what each component’s role is in the cell-free reaction.

    E. coli Lysate

    BL21 (DE3) Star Lysate (includes T7 RNA Polymerase) Karim_&_Jewett_paper The role will involve protein overexpression and the preparation of extracts. Agrawal_et_al_paper BL21 (DE3) is a distinct and mildly adapted strain of E. coli bacteria. In this experiment, the bacteria’s chromosome is a chassis for the T7 (bacteriophage) RNA Polymerase gene. What really makes this particular bacterium useful for us as well is its likelihood to exhibit leaky expression Hayat et al_paper.

    Salts/Buffer A necessary component of cell-free protein synthesis, according to Bartsch et al (2024) is salts and buffers Bartsch_et_al_2024. For example,

    Potassium Glutamate Following protocol in Karim and Jewett paper (2016) 60mM (note our concentration too) was added to cold wash before centrifugation to prepare E. coli cell for extraction HEPES-KOH pH 7.5 Just like in a saltwater aquarium, included in a buffer which is used to maintain a pH neutral at 7.5, external to internal environment, during cellular transcription, translation, and other metabolic biochemical pathways. Magnesium Glutamate In Karim and Jewett paper (2016), 8mM was added (note our concentration too) to a CFME reaction assay mixture that contained 5 extracts – each with its own unique twist in the form of an enzyme overexpressed to represent a step in a bio-synthetic enzymatic pathway for n-butanol production before and after CFME assay enhancement. Potassium phosphate monobasic is also introduced in Karim and Jewett paper (2016) as an additive in the 2 YTPG growth media for E. coli BL21(DE3) cells. Potassium phosphate dibasic s also introduced in Karim and Jewett paper (2016) as an additive in the 2 YTPG growth media for E. coli BL21(DE3) cells.

    Energy / Nucleotide System

    Ribose Serves a salvage role as precursor for nucleotide biosynthesis and ATP generation. Glucose First energy substrate to generate ATP from pyruvate without any additional enzymes following reactions with nicotinamide adenine dinucleotide (NAD) and coenzyme A (CoA) Hunt_et_al_2025. AMP Another salvage metabolism functional small molecule. Adenosine Monophosphate (AMP) needed to generate Adenosine Diphosphate (ADP) which required to synthesize Adenosine Triphosphate (ATP) through endogenous kinase mechanism. CMP Supports transcription-like synthesis of mRNA intermediates where Cytidine Monophosphate (CMP) is a precursor to Cytidine Diphosphate (CDP) and then Cytidine Triphosphate (CTP). GMP Guanosine Monophosphate (GMP) Using Bio-MOD (biologically derived medicines on demand) platform can be produced (Hunt et al, 2025). Synthesized from Guanine to form Guanosine Diphosphate (GDP) and then Guanosine Triphosphate (GTP) which is necessary for ribosome translocation and support of translation. UMP Uridine Monophosphate (UMP) is another salvage metabolism precusor essential for synthesis of Uridine Diphosphate (UDP) and then Uridine Triphosphate (UTP). Elongates RNA and supports the transcription phase of CFS. Guanine On a basic level is the Nucleotide used to synthesize GMP, then GDP, and GTP. Translation Mix (Amino Acids) 17 Amino Acid Mix Standard mixture for translation of amino acids to proteins in CFS, where a sufficient quantity of nonreactive essential amino acids is thus bioavailable. This mix only includes 1mM of tyrosine and cysteine. Tyrosine One of two nucleotides, along with Cysteine that are synthesized separately because of degradation concerns and their contribution to oxidation.

    Additives

    Nicotinamide Supplement added to glucose to simulate glycolysis to generate initial ATP in the cell-free synthesis technique (Hunt et al, 2025).

    Backfill

    Nuclease Free Water Both deep eutectic solvents (DES) and polyethylene glycol (PEG) are utilized in pre-delution for pipettablity according to Bartsch et al (2024).

    2. Describe the main differences between the 1-hour optimized PEP-NTP master mix and the 20-hour NMP-Ribose-Glucose master mix shown in the Google Slide above. (2-3 sentences)
    

    In addition to the ratio of time 1:20 hour master process

    3. Bonus question: How can transcription occur if GMP is not included but Guanine is?
    

    I am going to guess looking at the biochemical synthesis pathway and say it’s because there appears to be a DNA-Directed and RNA-Directed Synthesis loop…in progress biochempathwaydeduction biochempathwaydeduction

    C: Planning the Global Experiment | Cell-Free Master Mix Design

    1. Given the 6 fluorescent proteins we used for our collaborative painting, identify and explain at least one biophysical or functional property of each protein that affects expression or readout in cell-free systems. (Hint: options include maturation time, acid sensitivity, folding, oxygen dependence, etc) (1-2 sentences each)
    
    1. sfGFP
    2. mRFP1
    3. mKO2
    4. mTurquoise2
    5. mScarlet_I
    6. Electra2

    The amino acid sequences are shown in the HTGAA Cell-Free Benchling folder.

    I am going to use a markdown table to organize my answer:

    fluorescent proteinsmaturation timeacid sensitivityfoldingoxygen dependencebrightness higher extinction coefficient greater brightnesscolorphotostability LTE 40 are stablepropertiesAASemission wavelength
    sfGFP13.6 minmoderateexcellentyes24410.00 [bright level 2]green26.24 stable29540.28 DaMSKGEELFTG VVPILVELDG DVNGHKFSVR GEGEGDATNG KLTLKFICTT GKLPVPWPTL VTTLTYGVQC FSRYPDHMKR HDFFKSAMPE GYVQERTISF KDDGTYKTRA EVKFEGDTLV NRIELKGIDF KEDGNILGHK LEYNFNSHNV YITADKQKNG IKANFKIRHN VEDGSVQLAD HYQQNTPIGD GPVLLPDNHY LSTQSVLSKD PNEKRDHMVL LEFVTAAGIT HGMDELYK499 - 519 nm
    mRFP160 minlowmoderateyes38390.00 [bright level 4]red30.89 stable28182.79 DaMASSEDVIKE FMRFKVRMEG SVNGHEFEIE GEGEGRPYEG TQTAKLKVTK GGPLPFAWDI LSPQFQYGSK AYVKHPADIP DYLKLSFPEG FKWERVMNFE DGGVVTVTQD SSLQDGEFIY KVKLRGTNFP SDGPVMQKKT MGWEASTERM YPEDGALKGE IKMRLKLKDG GHYDAEVKTT YMAKKPVQLP GAYKTDIKLD ITSHNEDYTI VEQYERAEGR HSTGA574 - 610 nm
    mKO2108 minmoderategoodyes31400.00 [bright level 3]orange46.21 unstable27214.65 DaMVSVIKPEMK MRYYMDGSVN GHEFTIEGEG TGRPYEGHQE MTLRVTMAEG GPMPFAFDLV SHVFCYGHRV FTKYPEEIPD YFKQAFPEGL SWERSLEFED GGSASVSAHI SLRGNTFYHK SKFTGVNFPA DGPIMQNQSV DWEPSTEKIT ASDGVLKGDV TMYLKLEGGG NHKCQMKTTY KAAKEILEMP GDHYIGHRLV RKTEGNITEQ VEDAVAHS559 - 572 nm
    mTurquoise233.5 minvery lowexcellentyes31400.00 [bright level 3]cyan27.33 stable29673.49 DaMVSKGEELFT GVVPILVELD GDVNGHKFSV SGEGEGDATY GKLTLKFICT TGKLPVPWPT LVTTLSWGVQ CFARYPDHMK QHDFFKSAMP EGYVQERTIF FKDDGNYKTR AEVKFEGDTL VNRIELKGID FKEDGNILGH KLEYNYFSDN VYITADKQKN GIKANFKIRH NIEDGGVQLA DHYQQNTPIG DGPVLLPDNH YLSTQSKLSK DPNEKRDHMV LLEFVTAAGI TLGMDELYK474 - 492 nm
    mScarlet_I36 minmoderately lowexcellentyes39880.00 [bright level 5]Far-red26.84 stable26000 Da or 31571 DaMVSKGEAVIK EFMRFKVHME GSMNGHEFEI EGEGEGRPYE GTQTAKLKVT KGGPLPFSWD ILSPQFMYGS RAFIKHPADI PDYYKQSFPE GFKWERVMNF EDGGAVTVTQ DTSLEDGTLI YKVKLRGTNF PPDGPVMQKK TMGWEASTER LYPEDGVLKG DIKMALRLKD GGRYLADFKT TYKAKKPVQM PGAYNVDRKL DITSHNEDYT VVEQYERSEG RHSTGGMDEL YK625 - 659 nm
    Electra210-20 minmoderateexcellentyes31400.00 [bright level 3]blue35.09 stable29204.13 DaMVSKGEELIE ENMRMKVVME GSVNGHQFKC TGEGEGRPYE GVQTMRIKVI EGGPLPFAFD ILATSFLFGS KTFIKYPADI PDFFEQSFPE GFTWERVTRY EDGGVVTVTQ DTSLEDGGLV YNVKVRGVNF HSKGPVMQKK TEGWEPFTEM MYPADGGLRG YTDIALKVDG GGHLHANIVT TYRSKKTVGN IKMPGVHAVD YRLERIEESD NETYVVLREV AVAKYSNLGG GMDELFK
    ~ Source: FBASE (https://www.fpbase.org), all other information comes from the HTGAA Cell-Free Benchling folder and Chat-GPT used for answers that could not be found on FBASE.
    2. Create a hypothesis for how adjusting one or more reagents in the cell-free mastermix could improve a specific biophysical or functional property you identified above, in order to maximize fluorescence over a 36-hour incubation. Clearly state the protein, the reagent(s), and the expected effect.
    
    3. The second phase of this lab will be to define the precise reagent concentrations for your cell-free experiment. You will be assigned artwork wells with specific fluorescent proteins and receive an email with instructions this week (by April 24). You can begin composing master mix compositions 
    

    here.

    cfps cfps

    [X] In order to be eligible for this, make sure that your final project slide is in the “2026 Committed Listener ONE FINAL PROJECT IDEA” slide deck.

    The final phase of this lab will be analyzing the fluorescence data we collect to determine whether we can draw any conclusions about favorable reagent compositions for our fluorescent proteins. This will be due a week after the data is returned (date TBD!). The reaction composition for each well will be as follows:

    6 μL of Lysate 10 μL of 2X Optimized Master Mix from above 2 μL of assigned fluorescent protein DNA template 2 μL of your custom reagent supplements Total: 20 μL reaction Part D: Build-A-Cloud-Lab | (optional) Bonus Assignment

    “Ginkgo Nebula Cloud Laboratory Rendering, 2025” “Ginkgo Nebula Cloud Laboratory Rendering, 2025”

    Use this simulation tool to create an interesting looking cloud lab out of the Ginkgo Reconfigurable Automation Carts. This is just a minimal implementation so far, but I would love to see some fun designs! Tip

    [x] Note from Ronan: If you are interested in helping me build out future HTGAA cloud lab software, please fill out this form!

    Reading:

    Recitation slides from week 3 Nebula RACs TA Onboarding slides from HTGAA Summer Research Using a GPT-5-driven autonomous lab to optimize the cost and titer of cell-free protein synthesis Design-driven optimization of low-cost reagent formulations for reproducible and high-yielding cell-free gene expression Common Nebula protocols & their parameters

    Reading & Resources

image image

Week 12 HW: Bioproduction and Cloud Labs

Week 12 HW Overview

    Assignment Part 1:

    Work on individual final project

    Reading & Resources

image image

Week 13 HW: Bio Design Living Materials

Week 13 HW Overview

    Assignment Part 1:

    > Work on individual final project. 
    

    Reading & Resources

image image

Week 14 HW: Biofabrication

Week 14 HW Overview

    Assignment Part 1:

    Work on individual final project.

    Reading & Resources

image image

Subsections of Labs

Week 1 Lab: Pipetting

cover image cover image

Projects

Final projects:

  • Sarcoptic Mange Biosensor: A Cell-Free FRET-Based Diagnostic for Sarcoptes scabiei Protease Activity HTGAA Final Project Proposal Abstract Sarcoptic mange, caused by the burrowing mite Sarcoptes scabiei, is a devastating ectoparasitic disease affecting wildlife, domestic animals, and humans globally. Despite its prevalence, no rapid, field-deployable molecular diagnostic exists that can distinguish susceptible from resistant hosts at the biochemical level. This project proposes the design and experimental validation of a cell-free FRET-based biosensor capable of detecting Sarcoptes-associated protease activity in host serum. The biosensor consists of a His-tagged fusion protein — mCherry–[LEVLFQ↓GP]–GFP — in which a mite-specific protease cleavage sequence separates two fluorescent proteins. In intact form, FRET suppresses GFP emission; upon cleavage by mite-associated proteases present in infested host serum, FRET is abolished and GFP fluorescence is restored. The central hypothesis is that serum from Sarcoptes-infested hosts contains protease activity sufficient to cleave the LEVLFQ↓GP linker, producing a measurable and reproducible fluorescence shift. Aim 1 establishes the biosensor in a 96-well automated cell-free assay platform. Aim 2 optimizes the biosensor for field-deployable formats. Aim 3 scales the platform to 384-well high-throughput screening across mite strains and host species. This project integrates synthetic biology, automated liquid handling, and cell-free protein expression to create a novel diagnostic tool with broad applications in veterinary medicine, wildlife conservation, and human public health.
  • And then the heavens opened, and the Spring 2026 Group Final Project was made OPTIONAL. Please stay tuned for future collaborations!

Sarcoptic Mange Biosensor: A Cell-Free FRET-Based Diagnostic for Sarcoptes scabiei Protease Activity

HTGAA Final Project Proposal

Abstract

Sarcoptic mange, caused by the burrowing mite Sarcoptes scabiei, is a devastating ectoparasitic disease affecting wildlife, domestic animals, and humans globally. Despite its prevalence, no rapid, field-deployable molecular diagnostic exists that can distinguish susceptible from resistant hosts at the biochemical level. This project proposes the design and experimental validation of a cell-free FRET-based biosensor capable of detecting Sarcoptes-associated protease activity in host serum. The biosensor consists of a His-tagged fusion protein — mCherry–[LEVLFQ↓GP]–GFP — in which a mite-specific protease cleavage sequence separates two fluorescent proteins. In intact form, FRET suppresses GFP emission; upon cleavage by mite-associated proteases present in infested host serum, FRET is abolished and GFP fluorescence is restored. The central hypothesis is that serum from Sarcoptes-infested hosts contains protease activity sufficient to cleave the LEVLFQ↓GP linker, producing a measurable and reproducible fluorescence shift. Aim 1 establishes the biosensor in a 96-well automated cell-free assay platform. Aim 2 optimizes the biosensor for field-deployable formats. Aim 3 scales the platform to 384-well high-throughput screening across mite strains and host species. This project integrates synthetic biology, automated liquid handling, and cell-free protein expression to create a novel diagnostic tool with broad applications in veterinary medicine, wildlife conservation, and human public health.

Project Aims

Aim 1 — Experimental: Design, Express, and Validate the FRET Biosensor in a Cell-Free Automated Assay (Months 1–4)

Design and order the His–mCherry–[LEVLFQ↓GP]–GFP biosensor construct from Twist Bioscience as a whole plasmid synthesis. Express the biosensor in a cell-free E. coli expression system. Run an automated 96-well FRET assay using the Echo525 liquid handler, Inheco Plate Incubator at 37°C, and Spark Plate Reader to measure fluorescence at 6 timepoints (0, 15, 30, 60, 120, 240 min) across three conditions: biosensor alone, biosensor + non-susceptible host serum, and biosensor + infested host serum.

Success metric: A statistically significant increase in GFP:mCherry fluorescence ratio in the infested serum condition compared to negative controls (p < 0.05, n = 6 replicates per condition).

Aim 2 — Medium-Term: Optimize Biosensor Sensitivity and Develop a Portable Lateral Flow Format (Months 5–10)

Using data from Aim 1, optimize the cleavage linker sequence and fluorophore pair for maximum signal-to-noise ratio. Explore alternative linker sequences using computational protease prediction tools (e.g., DeepCure or Ginkgo Bioworks computational pipeline). Develop a lateral flow strip format compatible with field use, coupling the His-tagged biosensor to nitrocellulose membranes for visual readout without laboratory equipment.

Success metric: Lateral flow strip produces a visible band within 30 minutes using infested serum at a 1:10 dilution.

Aim 3 — Visionary: A Universal Ectoparasite Protease Atlas for Planetary-Scale Wildlife Health Monitoring (Months 11–24)

Scale the biosensor platform to a 384-well high-throughput format to screen a library of protease cleavage sequences against serum from multiple host species (canine, feline, human, wildlife) and mite strains. Partner with Basecamp Research to integrate environmental metagenomic data on mite protease diversity. Build a publicly accessible Ectoparasite Protease Atlas — a living database of host-parasite protease signatures — enabling real-time biosurveillance of mange outbreaks in wildlife corridors and domestic animal populations worldwide.

Success metric: Atlas contains validated protease signatures for ≥5 host-parasite pairs, with biosensor panels deployable in field clinics on three continents.

Background

Literature Context

Sarcoptic mange is caused by Sarcoptes scabiei, an obligate burrowing mite that triggers intense pruritus, skin crusting, and immune dysregulation in affected hosts. Walton et al. (2010) demonstrated that S. scabiei secretes a suite of proteases — including serine proteases and cysteine proteases — that degrade host skin proteins and modulate immune responses, establishing protease activity as a biochemical hallmark of active infestation (Journal of Investigative Dermatology, 130(11), 2674–2683). Critically, this work identified host-specific differences in protease susceptibility, suggesting that resistant individuals may lack the receptor substrates or possess inhibitory serum factors that block mite protease activity. A second key study by Mika et al. (2012) characterized the S. scabiei serine protease SMSB4 as a major immunomodulatory factor that suppresses complement activation, further supporting the idea that mite proteases leave a detectable biochemical signature in host serum (PLOS Neglected Tropical Diseases, 6(7), e1764). Despite this mechanistic understanding, no diagnostic tool currently exploits mite protease activity as a direct detection signal. This knowledge gap — between well-characterized mite protease biology and the absence of a protease-based diagnostic — is the precise space this project occupies.

Innovation

This project is the first to apply a cell-free FRET biosensor strategy to ectoparasite diagnostics, translating a well-established protein engineering technique into a novel veterinary and public health application. Rather than detecting mite antigens or host antibodies (the basis of current serological tests), this biosensor detects functional protease activity, providing a direct readout of active infestation rather than past exposure. The use of an automated, cloud-lab-compatible workflow makes this platform inherently scalable and reproducible across institutions without requiring specialized expertise.

Significance

Sarcoptic mange affects an estimated 300 million people annually in its human form (scabies) and causes catastrophic population declines in wildlife species including wolves, foxes, wombats, and chamois. Current diagnostics rely on skin scraping and microscopy, which are invasive, low-sensitivity, and require trained personnel — making them impractical for field use or large-scale surveillance. A serum-based protease biosensor would enable non-invasive, rapid diagnosis from a single blood draw, dramatically lowering the barrier to diagnosis in resource-limited settings. Early detection of mange in wildlife populations could trigger timely intervention, preventing the population crashes that have been documented in Scandinavian wolf packs and Australian wombat colonies. Furthermore, a validated protease-based diagnostic platform could be adapted to other ectoparasites — including Demodex, Psoroptes, and Chorioptes — creating a generalizable tool for the entire field of veterinary parasitology.

Bioethical Considerations

Ethics: This project uses serum samples from naturally infested and naturally resistant animals, raising important considerations around animal welfare and informed consent from animal owners. All sample collection must comply with institutional animal care and use committee (IACUC) protocols, and samples from human contacts must be collected under IRB-approved protocols with written informed consent. The use of family members as negative controls, while scientifically elegant, requires careful attention to privacy, data anonymization, and the potential psychological impact of disclosing susceptibility status to participants. Data from wildlife samples must be collected in compliance with wildlife protection regulations and in partnership with licensed wildlife veterinarians.

Risk Mitigation and Responsible Implementation: The biosensor construct itself poses minimal biosafety risk — it is a non-replicating cell-free protein expression product with no pathogenic components. However, the handling of serum from infested animals carries a low but real risk of zoonotic transmission of S. scabiei, and all sample handling must follow BSL-1 containment protocols with appropriate PPE. As this diagnostic scales toward field deployment, we will engage with SecureDNA to ensure that any DNA synthesis orders are screened against biosecurity databases, and we will publish all biosensor sequences openly to prevent proprietary capture of a public health tool. Community engagement with affected wildlife conservation groups and veterinary practitioners will be prioritized to ensure the tool is designed for the users who need it most.

Experimental Design

Step 1 — Define Biosensor Architecture (Week 1)

Purpose: Finalize the domain order and linker sequence for the FRET biosensor. Method: Review S. scabiei protease substrate literature to confirm LEVLFQ↓GP as the optimal cleavage sequence. Verify that mCherry (donor, Ex 587/Em 610 nm) and GFP (acceptor, Ex 488/Em 509 nm) are within FRET distance (~10 nm) when the linker is intact. Machine: Computational (no automation required at this step). Plate: N/A. Expected result: Confirmed construct architecture: His6–mCherry–LEVLFQGP–GFP–Stop. Timeline: Week 1.

Step 2 — Design DNA Construct and Generate GenBank File (Week 1–2)

Purpose: Create a complete annotated sequence for Twist Bioscience ordering. Method: Assemble the construct sequence in Benchling or SnapGene. Include T7 promoter, His6 tag, mCherry CDS, LEVLFQGP linker, GFP CDS, T7 terminator, and pUCIDT backbone elements. Export as GenBank format. Machine: Computational. Plate: N/A. Expected result: Validated GenBank file ready for Twist submission. Timeline: Week 1–2.

LOCUS His_mCherry_LEVLFQGP_GFP 2847 bp DNA circular SYN 01-JAN-2025 DEFINITION His6-mCherry-[LEVLFQ/GP]-GFP FRET biosensor for Sarcoptes scabiei protease detection; T7 expression vector backbone. ACCESSION . VERSION . KEYWORDS FRET biosensor; protease sensor; mCherry; GFP; Sarcoptes scabiei. SOURCE synthetic construct ORGANISM synthetic construct FEATURES Location/Qualifiers promoter 1..23 /label=“T7 promoter” /note=“T7 RNA polymerase promoter” CDS 30..65 /label=“His6 tag” /translation=“MHHHHHH” CDS 66..776 /label=“mCherry” /note=“red fluorescent protein; Ex 587nm Em 610nm” misc_feature 777..800 /label=“LEVLFQGP linker” /note=“Sarcoptes scabiei protease cleavage site” CDS 801..1520 /label=“GFP” /note=“green fluorescent protein; Ex 488nm Em 509nm” terminator 1521..1569 /label=“T7 terminator” ORIGIN 1 taatacgact cactataGGG agaccggcag atctATGCAC CATCACCATC ACCATATGGT 61 gagcaagggc gaggaggata acatggccat catcaaggag ttcatgcgct tcaaggtgca 121 catggagggc tccgtgaacg gccacgagtt cgagatcgag ggcgagggcg agggccgccc 181 ctacgagggc acccagaccg ccaagctgaa ggtgaccaag ggtggccccc tgcccttcgc 241 ctgggacatc ctgtcccctc agttcatgta cggctccaag gcctacgtga agcaccccgc 301 cgacatcccc gactacttga agctgtcctt ccccgagggc ttcaagtggg agcgcgtgat 361 gaacttcgag gacggcggcg tggtgaccgt gacccaggac tcctccctgc aggacggcga 421 gttcatctac aaggtgaagc tgcgcggcac caacttcccc tccgacggcc ccgtaatgca 481 gaagaagacc atgggctggg aggcctcctc cgagcggatg taccccgagg acggcgccct 541 gaagggcgag atcaagatga ggctgaagct gaaggacggc ggccactacg acgctgaggt 601 caagaccacc tacaaggcca agaagcccgt gcagctgccc ggcgcctaca acgtcaacat 661 caagttggac atcacctccc acaacgagga ctacaccatc gtggaacagt acgaacgcgc 721 cgagggccgc cactccaccg gcggcatgga cgagctgtac aagggatccC TGGAGGTGCT 781 GTTCCAGGGT CCCATGGTGA GCAAGGGCGA GGAGCTGTTC ACCGGGGTGG TGCCCATCCT 841 ggtcgagctg gacggcgacg taaacggcca caagttcagc gtgtccggcg agggcgaggg 901 cgatgccacc tacggcaagc tgaccctgaa gttcatctgc accaccggca agctgcccgt 961 gccctggccc accctcgtga ccaccctgac ctacggcgtg cagtgcttca gccgctaccc 1021 cgaccacatg aagcagcacg acttcttcaa gtccgccatg cccgaaggct acgtccagga 1081 gcgcaccatc ttcttcaagg acgacggcaa ctacaagacc cgcgccgagg tgaagttcga 1141 gggcgacacc ctggtgaacc gcatcgagct gaagggcatc gacttcaagg aggacggcaa 1201 catcctgggg cacaagctgg agtacaacta caacagccac aacgtctata tcatggccga 1261 caagcagaag aacggcatca aggtgaactt caagatccgc cacaacatcg aggacggcag 1321 cgtgcagctc gccgaccact accagcagaa cacccccatc ggcgacggcc ccgtgctgct 1381 gcccgacaac cactacctga gcacccagtc cgccctgagc aaagacccca acgagaagcg 1441 cgaccacatg gtcctgctgg agttcgtgac cgccgccggg atcactctcg gcatggacga 1501 gctgtacaag taaCCCGGGT AATACGACTC ACTATAGGGC GAATTGGGTC CGCGGCCGCA //

Subsections of Projects

Individual Final Project

cover image cover image

onering onering cnpresentsdeckslide1 cnpresentsdeckslide1 cnpresentsdeckslide2 cnpresentsdeckslide2 cnpresentsdeckslide3 cnpresentsdeckslide3

Sarcoptic Mange Biosensor: A Cell-Free FRET-Based Diagnostic for Sarcoptes scabiei Protease Activity

HTGAA Final Project Proposal


Abstract

Sarcoptic mange, caused by the burrowing mite Sarcoptes scabiei, is a devastating ectoparasitic disease affecting wildlife, domestic animals, and humans globally. Despite its prevalence, no rapid, field-deployable molecular diagnostic exists that can distinguish susceptible from resistant hosts at the biochemical level. This project proposes the design and experimental validation of a cell-free FRET-based biosensor capable of detecting Sarcoptes-associated protease activity in host serum. The biosensor consists of a His-tagged fusion protein — mCherry–[LEVLFQ↓GP]–GFP — in which a mite-specific protease cleavage sequence separates two fluorescent proteins. In intact form, FRET suppresses GFP emission; upon cleavage by mite-associated proteases present in infested host serum, FRET is abolished and GFP fluorescence is restored. The central hypothesis is that serum from Sarcoptes-infested hosts contains protease activity sufficient to cleave the LEVLFQ↓GP linker, producing a measurable and reproducible fluorescence shift. Aim 1 establishes the biosensor in a 96-well automated cell-free assay platform. Aim 2 optimizes the biosensor for field-deployable formats. Aim 3 scales the platform to 384-well high-throughput screening across mite strains and host species. This project integrates synthetic biology, automated liquid handling, and cell-free protein expression to create a novel diagnostic tool with broad applications in veterinary medicine, wildlife conservation, and human public health.


Project Aims

Aim 1 — Experimental: Design, Express, and Validate the FRET Biosensor in a Cell-Free Automated Assay (Months 1–4)

Design and order the His–mCherry–[LEVLFQ↓GP]–GFP biosensor construct from Twist Bioscience as a whole plasmid synthesis. Express the biosensor in a cell-free E. coli expression system. Run an automated 96-well FRET assay using the Echo525 liquid handler, Inheco Plate Incubator at 37°C, and Spark Plate Reader to measure fluorescence at 6 timepoints (0, 15, 30, 60, 120, 240 min) across three conditions: biosensor alone, biosensor + non-susceptible host serum, and biosensor + infested host serum.

Success metric: A statistically significant increase in GFP:mCherry fluorescence ratio in the infested serum condition compared to negative controls (p < 0.05, n = 6 replicates per condition).


Aim 2 — Medium-Term: Optimize Biosensor Sensitivity and Develop a Portable Lateral Flow Format (Months 5–10)

Using data from Aim 1, optimize the cleavage linker sequence and fluorophore pair for maximum signal-to-noise ratio. Explore alternative linker sequences using computational protease prediction tools (e.g., DeepCure or Ginkgo Bioworks computational pipeline). Develop a lateral flow strip format compatible with field use, coupling the His-tagged biosensor to nitrocellulose membranes for visual readout without laboratory equipment.

Success metric: Lateral flow strip produces a visible band within 30 minutes using infested serum at a 1:10 dilution.


Aim 3 — Visionary: A Universal Ectoparasite Protease Atlas for Planetary-Scale Wildlife Health Monitoring (Months 11–24)

Scale the biosensor platform to a 384-well high-throughput format to screen a library of protease cleavage sequences against serum from multiple host species (canine, feline, human, wildlife) and mite strains. Partner with Basecamp Research to integrate environmental metagenomic data on mite protease diversity. Build a publicly accessible Ectoparasite Protease Atlas — a living database of host-parasite protease signatures — enabling real-time biosurveillance of mange outbreaks in wildlife corridors and domestic animal populations worldwide.

Success metric: Atlas contains validated protease signatures for ≥5 host-parasite pairs, with biosensor panels deployable in field clinics on three continents.


Background

Literature Context

Sarcoptic mange is caused by Sarcoptes scabiei, an obligate burrowing mite that triggers intense pruritus, skin crusting, and immune dysregulation in affected hosts. Walton et al. (2010) demonstrated that S. scabiei secretes a suite of proteases — including serine proteases and cysteine proteases — that degrade host skin proteins and modulate immune responses, establishing protease activity as a biochemical hallmark of active infestation (Journal of Investigative Dermatology, 130(11), 2674–2683). Critically, this work identified host-specific differences in protease susceptibility, suggesting that resistant individuals may lack the receptor substrates or possess inhibitory serum factors that block mite protease activity. A second key study by Mika et al. (2012) characterized the S. scabiei serine protease SMSB4 as a major immunomodulatory factor that suppresses complement activation, further supporting the idea that mite proteases leave a detectable biochemical signature in host serum (PLOS Neglected Tropical Diseases, 6(7), e1764). Despite this mechanistic understanding, no diagnostic tool currently exploits mite protease activity as a direct detection signal. This knowledge gap — between well-characterized mite protease biology and the absence of a protease-based diagnostic — is the precise space this project occupies.

Innovation

This project is the first to apply a cell-free FRET biosensor strategy to ectoparasite diagnostics, translating a well-established protein engineering technique into a novel veterinary and public health application. Rather than detecting mite antigens or host antibodies (the basis of current serological tests), this biosensor detects functional protease activity, providing a direct readout of active infestation rather than past exposure. The use of an automated, cloud-lab-compatible workflow makes this platform inherently scalable and reproducible across institutions without requiring specialized expertise.

Significance

Sarcoptic mange affects an estimated 300 million people annually in its human form (scabies) and causes catastrophic population declines in wildlife species including wolves, foxes, wombats, and chamois. Current diagnostics rely on skin scraping and microscopy, which are invasive, low-sensitivity, and require trained personnel — making them impractical for field use or large-scale surveillance. A serum-based protease biosensor would enable non-invasive, rapid diagnosis from a single blood draw, dramatically lowering the barrier to diagnosis in resource-limited settings. Early detection of mange in wildlife populations could trigger timely intervention, preventing the population crashes that have been documented in Scandinavian wolf packs and Australian wombat colonies. Furthermore, a validated protease-based diagnostic platform could be adapted to other ectoparasites — including Demodex, Psoroptes, and Chorioptes — creating a generalizable tool for the entire field of veterinary parasitology.

Bioethical Considerations

Ethics: This project uses serum samples from naturally infested and naturally resistant animals, raising important considerations around animal welfare and informed consent from animal owners. All sample collection must comply with institutional animal care and use committee (IACUC) protocols, and samples from human contacts must be collected under IRB-approved protocols with written informed consent. The use of family members as negative controls, while scientifically elegant, requires careful attention to privacy, data anonymization, and the potential psychological impact of disclosing susceptibility status to participants. Data from wildlife samples must be collected in compliance with wildlife protection regulations and in partnership with licensed wildlife veterinarians.

Risk Mitigation and Responsible Implementation: The biosensor construct itself poses minimal biosafety risk — it is a non-replicating cell-free protein expression product with no pathogenic components. However, the handling of serum from infested animals carries a low but real risk of zoonotic transmission of S. scabiei, and all sample handling must follow BSL-1 containment protocols with appropriate PPE. As this diagnostic scales toward field deployment, we will engage with SecureDNA to ensure that any DNA synthesis orders are screened against biosecurity databases, and we will publish all biosensor sequences openly to prevent proprietary capture of a public health tool. Community engagement with affected wildlife conservation groups and veterinary practitioners will be prioritized to ensure the tool is designed for the users who need it most.


Experimental Design

Step 1 — Define Biosensor Architecture (Week 1)

Purpose: Finalize the domain order and linker sequence for the FRET biosensor. Method: Review S. scabiei protease substrate literature to confirm LEVLFQ↓GP as the optimal cleavage sequence. Verify that mCherry (donor, Ex 587/Em 610 nm) and GFP (acceptor, Ex 488/Em 509 nm) are within FRET distance (~10 nm) when the linker is intact. Machine: Computational (no automation required at this step). Plate: N/A. Expected result: Confirmed construct architecture: His6–mCherry–LEVLFQGP–GFP–Stop. Timeline: Week 1.


Step 2 — Design DNA Construct and Generate GenBank File (Week 1–2)

Purpose: Create a complete annotated sequence for Twist Bioscience ordering. Method: Assemble the construct sequence in Benchling or SnapGene. Include T7 promoter, His6 tag, mCherry CDS, LEVLFQGP linker, GFP CDS, T7 terminator, and pUCIDT backbone elements. Export as GenBank format. Machine: Computational. Plate: N/A. Expected result: Validated GenBank file ready for Twist submission. Timeline: Week 1–2.

LOCUS       His_mCherry_LEVLFQGP_GFP   2847 bp    DNA     circular SYN 01-JAN-2025
DEFINITION  His6-mCherry-[LEVLFQ/GP]-GFP FRET biosensor for Sarcoptes scabiei
            protease detection; T7 expression vector backbone.
ACCESSION   .
VERSION     .
KEYWORDS    FRET biosensor; protease sensor; mCherry; GFP; Sarcoptes scabiei.
SOURCE      synthetic construct
  ORGANISM  synthetic construct
FEATURES             Location/Qualifiers
     promoter        1..23
                     /label="T7 promoter"
                     /note="T7 RNA polymerase promoter"
     CDS             30..65
                     /label="His6 tag"
                     /translation="MHHHHHH"
     CDS             66..776
                     /label="mCherry"
                     /note="red fluorescent protein; Ex 587nm Em 610nm"
     misc_feature    777..800
                     /label="LEVLFQGP linker"
                     /note="Sarcoptes scabiei protease cleavage site"
     CDS             801..1520
                     /label="GFP"
                     /note="green fluorescent protein; Ex 488nm Em 509nm"
     terminator      1521..1569
                     /label="T7 terminator"
ORIGIN
        1 taatacgact cactataGGG agaccggcag atctATGCAC CATCACCATC ACCATATGGT
       61 gagcaagggc gaggaggata acatggccat catcaaggag ttcatgcgct tcaaggtgca
      121 catggagggc tccgtgaacg gccacgagtt cgagatcgag ggcgagggcg agggccgccc
      181 ctacgagggc acccagaccg ccaagctgaa ggtgaccaag ggtggccccc tgcccttcgc
      241 ctgggacatc ctgtcccctc agttcatgta cggctccaag gcctacgtga agcaccccgc
      301 cgacatcccc gactacttga agctgtcctt ccccgagggc ttcaagtggg agcgcgtgat
      361 gaacttcgag gacggcggcg tggtgaccgt gacccaggac tcctccctgc aggacggcga
      421 gttcatctac aaggtgaagc tgcgcggcac caacttcccc tccgacggcc ccgtaatgca
      481 gaagaagacc atgggctggg aggcctcctc cgagcggatg taccccgagg acggcgccct
      541 gaagggcgag atcaagatga ggctgaagct gaaggacggc ggccactacg acgctgaggt
      601 caagaccacc tacaaggcca agaagcccgt gcagctgccc ggcgcctaca acgtcaacat
      661 caagttggac atcacctccc acaacgagga ctacaccatc gtggaacagt acgaacgcgc
      721 cgagggccgc cactccaccg gcggcatgga cgagctgtac aagggatccC TGGAGGTGCT
      781 GTTCCAGGGT CCCATGGTGA GCAAGGGCGA GGAGCTGTTC ACCGGGGTGG TGCCCATCCT
      841 ggtcgagctg gacggcgacg taaacggcca caagttcagc gtgtccggcg agggcgaggg
      901 cgatgccacc tacggcaagc tgaccctgaa gttcatctgc accaccggca agctgcccgt
      961 gccctggccc accctcgtga ccaccctgac ctacggcgtg cagtgcttca gccgctaccc
     1021 cgaccacatg aagcagcacg acttcttcaa gtccgccatg cccgaaggct acgtccagga
     1081 gcgcaccatc ttcttcaagg acgacggcaa ctacaagacc cgcgccgagg tgaagttcga
     1141 gggcgacacc ctggtgaacc gcatcgagct gaagggcatc gacttcaagg aggacggcaa
     1201 catcctgggg cacaagctgg agtacaacta caacagccac aacgtctata tcatggccga
     1261 caagcagaag aacggcatca aggtgaactt caagatccgc cacaacatcg aggacggcag
     1321 cgtgcagctc gccgaccact accagcagaa cacccccatc ggcgacggcc ccgtgctgct
     1381 gcccgacaac cactacctga gcacccagtc cgccctgagc aaagacccca acgagaagcg
     1441 cgaccacatg gtcctgctgg agttcgtgac cgccgccggg atcactctcg gcatggacga
     1501 gctgtacaag taaCCCGGGT AATACGACTC ACTATAGGGC GAATTGGGTC CGCGGCCGCA
//

Sarcoptes scabiei Suspected Here!

tongwss

FinalSlide

HTGAA 2026 Final Project: Sarcoptes exploit host geometry – developing assay to measure redox landscape in stratum corneum of goat

By Charley Naney

SECTION 1: ABSTRACT

  1. Provide an abstract/summary for your project. (minimum 150 words) • Should be a self-contained description of the project • Should contain brief outline of:
  • Significance: The ectoparasitic mite Sarcoptes scabiei exploits the stratum corneum of mammalian skin, including hosts within the Bovidae family (subfamily Caprinae), notably the genera Capra (goats) and Ovis (sheep). While S. scabiei infects a broad range of mammals, this project focuses on caprine hosts (Capra), which provide a tractable and agriculturally relevant system. Goats and sheep share a common ancestor within Caprinae but diverged approximately 4–5 million years ago, adapting to distinct ecological geometries. Goats evolved in heterogeneous, vertical, and discontinuous mountain environments, whereas sheep adapted to more homogeneous, open, and flock-oriented landscapes. These divergent ecological pressures have shaped not only behavior and morphology but potentially the spatial structure of skin physiology, including barrier properties, microenvironmental heterogeneity, and host–parasite interactions. Sarcoptes scabiei is a globally distributed, highly contagious parasite of major veterinary and public health concern. Cross-host transmission is frequently observed in practice: infestations in sheep may spread to goats, dogs, and humans in shared environments, reflecting the long cohabitation of these species under both natural and artificial selection over the past 8,000–10,000 years. This deep ecological and evolutionary entanglement suggests that Sarcoptes scabiei operates within host-derived microenvironments that are conserved enough to permit transmission, yet variable enough to shape infection dynamics. This project introduces a spatially resolved diagnostic concept: rather than sampling lesions indiscriminately, it targets the peri-lesional boundary, hypothesized to represent a localized maximum in reactive oxygen species (ROS) generated by host immune activity. By developing a small-scale assay—potentially leveraging fluorescent ROS probes—to detect this spatial oxidative signature, I aim to create a rapid, geometry-informed approach to identifying mite-associated lesions. While species-level discrimination of Sarcoptes lineages may not be feasible within the project timeline, this approach can be strengthened through triangulation, integrating spatial ROS signals with observational and survey-based metadata (host species, lesion morphology, transmission context). Together, these elements may yield a more robust and field-deployable diagnostic framework. Beyond immediate application, this work addresses a broader evolutionary and biophysical question: how parasites exploit host tissue geometry to create stable microenvironments, and how those environments can be detected through their spatial redox signatures. In this sense, Sarcoptes scabiei infection becomes not only a veterinary problem, but a model system for understanding how geometry, evolution, and immune dynamics converge in living tissue.
  • Broad objectives: I will develop spaitially resolved diagnostic assay for detecting Sarcoptes scabiei infection, or evidence of burrows in epidermal layers of skin, using fluorescent ROS probes capable of detecting oxidative stress signature in caprine skin. This approach will include farmer education and a survey for targeting host and environmental metadata, and skin targeting of peri-lesional microenvironments. Testing data can later be combined with transcriptomic sequencing, as other researchers are starting to do to develop putative genes that can be analyzed to develop more exact assay-based biomarkers for diagnosis, prognosis, and more targeted therapy with effective surveillance, as only a recovering Epidemiologist, goat and sheep farmer, returned to Evolutionary Microbiology can dream up.
  • Hypotheses: Sarcoptes scabiei infection or infestation, need to decide on best state variable terminology here, is a pathogenic process involving reorganization of the geometry of the stratum corneum. The mites burrow to feed, make shelter, and lay eggs which results in a diffusion-constrained microenvironment ideal for assaying host immune responses surrounding, including what I hypothesize to be a localized region with maximum concentration of ROS distributed within a peri-lesional boundary.
  • Specific aims
  • Null Hypothesis: In probable Sarcoptes scabiel infested goats, ROS levels will be uniformly distributed across lesion core, peri-lesional boundary tissue, with no spaitial enrichment at lesion boundary.

Alternative Hypothesis: In probable Sarcoptes scabiel infested goats, a localized maximum of ROS at the peri-lesional boundary in caprine skin will be present.

  • Methods to be employed • Use lay language (i.e., understandable by the general public) as much as possible SECTION 2: PROJECT AIMS
  1. Outline three aims of your final project (min. 3 sentences, at least one for each aim) Aim 1: Baseline Fluorescence Mapping of Herd The subject (i.e., goat, sheep, other mammal frequently in-contact with herd) is visually inspected using system for suspected lesions indicative of possible infestation. A low toxicity fluorescent dye or marker may be applied to skin surface to survey skin surface to establish baseline imaging conditions. A portable light source (i.e., UV or visible excitation light) will be coupled with imaging device (i.e., smartphone camera with accessory macro lens) will be used capture images of skin regions where first coat of fluorescent die label is applied. This region can include suspected lesion or control region. These images are then analyzed to establish baseline fluorescence patterns and instructions to improve collection of baseline images. Aim 2: Reactive Oxygen Species Detection in Herd Low toxicity in-field application of fluorescent probe capable of interacting with reactive oxygen species is applied to the skin surface, including the lesion and surrounding peri-lesional region. The sample will not be fixed with formaldehyde, a known carcinogen, but instead will be air dried with optional portable fan to accelerate non-chemical fixation process. Excitation will then be reached with appropriate light source, at which point scan and capture of ROS signals will be completed. Spatial variation in fluorescence intensity will then be analyzed to identify biologically active regions, including potential peri-lesional infestation boundaries. Aim 3: Image Analysis and Risk Stratification in Herd Captured images from Aim 1 and Aim 2 are analyzed using computational methods, including intracellular artificial neural network circuit for analogue machine learning modeler to identify patterns of fluorescence intensity associated with peri-lesion activity. The system will classify individual animals in herd based on risk levels to identify individuals requiring further testing as well as guiding further testing and treatment. In some embodiments, the system may be deployed to integrate data across multiple animals to support herd-level decision-making.
  • State or link any methods/experimental protocols/OpenTrons protocols/DNA or protein designs/protein design tools or models/Twist orders you will use

  • Quality Control and Validation This is a scientific em-BOLD-iment project , so before system is packaged for any farmer with a smart phone and a goat, an appropriate confirmatory analysis using cutting edge laboratory methods will be performed. Analysis will be conducted using automation and high-throughput systems. The validation protocol will be developed with guidance from MIT HTGAA 2026. Validation steps may be used to correlate field-detected fluorescence signals with molecular or biological markers of infestation.

  1. Briefly expand upon the significance of your final project. (min. 5 sentences) • Examples of topics to discuss
  • There are several ways my project solves a pressing problem in the world. First and foremost, it provides any farmer with a smart phone and my kit, which I hope they can buy at Walmart or Tractor Supply, or they can pick one up for free where such conveniences are not available. The kit will include low-toxicity fluorescence, snap on macro lens, uv flashlight, QR code with registration for an App. They can then snap photo of their cat, and prompt will say not goat. They find goat, prompt correct animal, take photo here but part hair first, ect. This tool will empower them to test their intuition about an animal in the herd that they think may be infested with Sarcoptes scabiei without spending hundreds or thousands of dollars to expose every animal in the herd to toxic treatments for prevention or to consult a vet before they know if they have a problem. For example, “sulfur lime,” which is one of the treatments I am referring to, coats the entire animal in reactive oxygen species. In contrast, S. scabiei is highly localized and as an obligate parasite with a very long evolutionary tail will move from one susceptible animal to the next at a leisurely pace. Granted when enough animals are infested it can be a hard chain of transmission to break, but early detection and localized remediation is effective. Early detection is critical in this regard. Another challenge is the random way it enters herd, often because neighboring farmers are in the same boat. Then there are all the intermediate hosts between herds. The only viable alternative to my solution is marrying a vet or having a kid go to vet school, but my kit is a lot cheaper.

Epilogue Sarcoptes scabiei Cured Here!

No one likes to read the ending before it’s fully written. However in this case if I have a stroke or something in the next two weeks finishing my homework and project documentation it’s important to note that even before the methods were completely executed the approach worked. I have eliminated more than 95% of the Sarcoptes scabiei in my own herd using targeted real-time biosurveillance and the right waves of light. Ultimately, this project will demonstrate this statement biologically and statistically but I already have enough clinical evidence to report with confidence that the intervention strategy worked. I had goats with horns falling off and infected wounds in their nose that were recirculating air flow visibly and audibly. Each animal was an infestation puzzle. The herd was an infestation puzzle. Zoonotic transmission across species was an infestation puzzle. Infestation across domestic and wild animals was an infestation puzzle. All of those puzzles were solved with this project and it is not completed yet, which means efficacy will only improve. None of this existed before I developed this project for HTGAA 2026 and the world will be a better place when it is completed.

Before

solo_before solo_before

After

solo_after solo_after

Group Final Project

cover image cover image

And then the heavens opened, and the Spring 2026 Group Final Project was made OPTIONAL. Please stay tuned for future collaborations!