Projects

Final projects:

  • Nature’s Latent Image is a project which explores the possibility of using chlorophyll and light-harvesting proteins a novel photographic system to substitute toxic silver in current analog photography media.
  • Engineer a shorter version of L protein that permits an independent folding and conserves essential parts of the sequence such as the transmembrane domain needed for the insertion of the L protein into the membrane and the C-terminal domain needed for the clustering of the L proteins that leads to the lysis of the bacteria.

Subsections of Projects

Individual Final Project — Nature's Latent Image

cover image cover image

SECTION 1: ABSTRACT

Analog photography has been experiencing a growing revival and with it a growing ecological concern, especially regarding the impacts of its “magical” component — silver halides. Much of the movement of trying to address the environmental impact of analogue film has fallen on individual artists and researchers, by trying to mitigate the consequences of silver. However, despite the efforts of exploring plant-based developers, and darkroom procedures to prevent damaging disposal of silver contaminated solutions, (extremely toxic for the environment affecting primarily microbial life) we are still left with the need to use this toxic metal in lack of any other option for analog camera photography.

Nature’s Latent Image is a project which explores the possibility of using chlorophyll and light-harvesting proteins a novel photographic system to substitute toxic silver in current analog photography media, with the ultimate objective of developing working photographic emulsions which can be applied to film rolls, paper, etc.

This hypothesis is based on personal experiments that show that chlorophyll, when exposed to light, rapidly degrades into derivatives— pheophytin/pheophorbide that have a porphyrin type ring which (without the central magnesium ion) has the capacity of chelating iron ions. Therefore, chlorophyll can be used to create positive latent images (acting as light-sensitive agent) which can be developed with iron that forms the final negative image (acting as density builder).

Chlorophyll is highly prone to degradation, particularly through photooxidation, where light excitation leads to the formation of reactive oxygen species (ROS) such as singlet oxygen. These ROS can oxidize chlorophyll and nearby molecules, resulting in localized propagation of degradation. In addition, chlorophyll is also sensitive to air oxidation and environmental conditions, especially when not stabilized within a protein complex. And so, the main focus of this research project is understanding the influence of chlorophyll-binding proteins in order to maximize this pigment’s properties and stabilize it so it doesn’t degrade under unwanted situations.

Chlorophyll-binding proteins are here explored as a way to aggregate chlorophyll molecules and amplify their potential as a novel photographic substance, by creating matrixes of organized chlorophyll light-sensitive domains which should improve light absorption and allow for a controlled degradation in order to obtain photographic exposure speeds, stable latent images with good contrast and resolution, which can be later developed.

In order to achieve this project’s objectives, water soluble chlorophyll-binding proteins (WSCPs), CauWSCPs from Brassica oleracea, will be expressed to understand their impact on chlorophyll’s stability, light-sensitive capacity, degradation rate and ability to chelate iron. Another challenge rests on finding the right polymer in which to embed the protein-chlorophyll emulsion as to be able to achieve good experimental results. In further experiments, optimized chlorophyll-binding proteins could be design, if natural occurring ones do not meet photographic needs. Thinking in terms of scalability it would be interesting to synthesize these chlorophyll light-sensitive domains with cyanobacteria with the objective of having a renewable source to produce these emulsions. Finally, the ultimate step would be to develop a fully working photographic emulsion which could be applied to film rolls, paper, etc.

The first experimental approaches (as to achieve Aim 1 of this project) will start with the extraction and purification of chlorophyll from a plant source Urtica dioica (Nettles), as they are abundant and have high concentrations of Chlorophyll. E.coli plasmids for the expression of WSCPs will be design and expressed using an E.coli cell-free system where the purified chlorophyll will be used as co-folding factor. The purified chlorophyll-protein will be embedded into a polymer either chitosan based or algae based like agar to allow for visual tests of the formation of latent images and reaction with iron.


image image

SECTION 2: PROJECT AIMS

Aim 1 — Experimental Aim:

Aim 1 is based on further understanding chlorophyll-binding proteins and their effect on chlorophyll from a photographic point of view. These proteins seem to be the biological way to organize and make the most use of this photosensitive pigment.

Some challenges that are comprised in this aim are: understanding to what extent the organization of the chlorophyll through WSCPs is favorable for photographic purposes; understand if iron will still react with chlorophyll if it is bonded to WSCPs; and stopping chlorophyll degradation by air oxidation which might be aided by being bond to proteins and by being embedded into the right polymer;

To achieve these goals

Use Twist clonal genes tool

  • Create a plasmid ready for cell free expression and order it to be delivered at Ginkgo

Ginkgo Cell Free Protein Expression Validation automation workflow — Gel imaging of protein expression

  • Due to the unknown exact behavior of chlorophyll-protein complexes in terms of degradation speed, at least 2 different samples of WSCP assembly should be prepared:
    • Sample1 with purified whole chlorophylls
    • Sample2 with saponified chlorophyll— converted into chlorophyllin through treatment with an alkali, which removes the pythol tail

    This will allow for a range of photostability and controlled degradation, since the presence of the pythol tail in WSCP chlorophyll-protein complexes drastically increases the photostability of chlorophyll according to Agostini et al., 2017

Analyse absorprion spectrum of proteins + chlorophyll vs pure chlorophyll

  • Check for correct protein-pigment complex formation

Embed both proteins + chlorophyll and pure chlorophyll in polymer to and test one against another in light sensitivity and reaction with iron

  • This allows for an easily identifiable visual test to acess latent image formation and ability to chelate iron
Aim 2 — Development Aim:

Designing an optimized version of WSCPs so it better suits photographic objectives, if needed. These adjustments are yet to be determined and rest on the experimental data from Aim 1.

After having understood the mechanisms of chlorophyll and WSCPs, develop a system where cyanobacteria, which already have both the mechanisms to produce chlorophyll and the proteins in question, could be used, instead of always having to resort to cell-free synthesis, as they would be a renewable source for scalability — the most appropriate chasis for this step would probably be Synechocystis sp. PCC 6803, due to its well-characterized genomes and natural competency.

Aim 3 — Visionary Aim:

The visionary aim of this project would be to develop fully working emulsions that could be applied to the fabrication of film rolls and paper, as well as creating Open-source low-tech protocols to produce chlorophyll-based emulsions so that the experimental analog photography community could expand on the findings of this research.

image image

In the diagram above I drew a conceptual cycle in which this new media could participate in. It would open the possibility of a photographic practice completely compatible with the environment and new ways of producing images could be born, for example, through the partial decomposition of the photographic materials themselves, allowing for a direct intervention of other-than-human beings like bacteria, fungi and plants on the photographic medium.

This would enable an ecologically involved photographic practice that doesn’t rest on an active degradation of the ecosystems from the extraction of silver and its processing to the use of film rolls and other photographic materials and the darkroom waste they produce and their hazardous disposal.


SECTION 3: BACKGROUND

image image image image

Photography field references:

Biotechnology references:

1. Briefly summarize two peer-reviewed research citations relevant to your research

Experimental photography has increasingly foregrounded the material and ecological implications of its processes. In Blue Mud: Entangled Geologies and Lives of Photographic Silver, Alice Cazenave reframes photography as an extractive practice, entangled with mining, toxicity, and planetary infrastructures. Similarly, The Ecology of Grain exposes the environmental and animal-derived dependencies of gelatin-based film, while Andrés Pardo’s Back to Basics Vol. 1 and 2 explore alternative and low-toxicity processes. However, while these works critically examine photographic materials and propose process-based alternatives, they do not replace the reliance on silver as the core photosensitive element.

In parallel, research in biotechnology offers insight into chlorophyll as a light-sensitive molecule. Studies such as An unusual role for the phytyl chains in the photoprotection of the chlorophylls bound to Water-Soluble Chlorophyll-binding Proteins demonstrate that chlorophyll-binding proteins (WSCPs) can stabilize chlorophyll and protect it from degradation. Additionally, Fine tuning of chlorophyll spectra by protein-induced ring deformation shows that protein environments can modulate chlorophyll’s optical properties, suggesting that its behavior as a photosensitive material is not fixed but can be engineered.

The gap this project addresses lies at the intersection of these fields. While experimental photography has critically engaged with the ecological cost of its materials, it has yet to fully develop a non-toxic, non-silver-based photosensitive system. Conversely, scientific research on chlorophyll and WSCPs has not explored their potential within image-forming processes. This project proposes to bridge this gap by investigating chlorophyll as an alternative photosensitive agent, combined with plant-based polymers as an emulsion matrix, aiming to develop a biologically derived photographic process that replaces both silver and animal-based materials.

2. Explain how your project is novel or innovative. (Minimum 3 sentences.)

Analog photography has always stood in a paradox with ecology, while being the media many use through artistic practices to document and explore the problem, it actively contributes to it through its materiality based on toxic silver and also gelatine components. This project could bring about a change in the way analog photography relates itself with the natural environment, and allow for practices that participate in ecological cycles

3. Explain why your project matters and what impact it could have

The significance of this work lies in the absence of viable, non-toxic alternatives to silver-based camera photography that retain both functional and artistic potential. By exploring biologically derived materials as active components in image formation, the project seeks to expand the possibilities of experimental photography while reducing its environmental impact.

Beyond its technical aims, the project contributes to a broader rethinking of how artistic practices can engage with ecological systems—not as subjects to be represented, but as processes to work within. It also opens a critical dialogue within the experimental ecological community on whether synthetic biology should be considered a viable tool to address environmental challenges, even within artistic contexts. If successful, this research could shift experimental photography toward more sustainable, biologically integrated methods, contributing for the artistic practice as a site for both ecological awareness and material innovation.

4. Describe the ethical implications associated with your project and identify relevant ethical principles (e.g., non-maleficence, beneficence, justice, or responsibility). (Minimum 2 paragraphs.)

This project raises ethical considerations primarily related to the use of biotechnology, material sustainability, and the environmental impact of artistic practices. By proposing chlorophyll and plant-based polymers as alternatives to toxic silver-based photographic materials, the project aligns with the principle of non-maleficence, aiming to reduce harm to ecosystems and human health. At the same time, it engages with responsibility in the use of synthetic biology, particularly in the potential development of genetically modified cyanobacteria as a production system. While the final photographic materials would not contain viable genetically modified organisms, the use of such systems during production raises questions about containment, ecological risk, and the broader normalization of biotechnology within artistic contexts. The project also seeks to contribute to more sustainable material practices, and opens a critical discussion on whether synthetic biology can be ethically integrated into ecological and artistic frameworks.

To ensure the project remains ethical, several measures should be implemented. The initial use of cell-free expression systems minimizes risk by avoiding living genetically modified organisms, while any later use of genetically modified cyanobacteria would require strict laboratory containment, controlled handling, and responsible disposal protocols. A key action is to ensure that no viable GM organisms are present in the final materials, clearly separating production from outcome.

Potential unintended consequences include the accidental release of modified organisms, or the broader risk of legitimizing biotechnological interventions without sufficient critical reflection.

Additionally, one possible incorrect assumption in this project is that chlorophyll is the most suitable photosensitive pigment for these purposes; although it has shown strong conceptual and experimental promise so far, alternative pigments or systems may prove more effective or sustainable. To address this uncertainty, the project remains open to alternative approaches and iterative testing.


SECTION 4: EXPERIMENTAL DESIGN, TECHNIQUES, TOOLS, AND TECHNOLOGY

Experimental Design

Written with use of HTGAA AI Tutor

Step 1 — DNA Design Using Twist Clonal Genes (Day 1–2)

image image
  • Purpose: Generate a plasmid optimized for cell-free WSCP1 expression.
  • Method: Use the Twist Clonal Genes tool to design a codon-optimized WSCP1 construct for E. coli cell-free expression. Include:
    • T7 promoter
    • RBS (Shine-Dalgarno)
    • N-terminal 6×His tag
    • WSCP1
    • T7 terminator
    • Chloramphenicol resistance backbone
  • Automation: Twist design platform + Benchling annotation.
  • Microplate: N/A.
  • Expected Result: Fully annotated plasmid ready for synthesis.
  • Timeline: Day 1–2.

Step 2 — Order and Delivery to Ginkgo (Day 2–10)

  • Purpose: Obtain a sequence-verified plasmid for expression.
  • Method: Submit plasmid for whole synthesis.
  • Automation: Online submission and sequence verification pipeline.
  • Microplate: N/A.
  • Expected Result: Ready-to-use plasmid delivered within 5–10 days.
  • Timeline: Day 2–10.

Step 3 — Cell-Free Protein Expression with Pigment Incorporation (Day 10–11)

  • Purpose: Produce WSCP1 and allow simultaneous binding to pigments.
  • Method: At Ginkgo, set up PURExpress cell-free reactions including:
    • Twist-delivered plasmid (WSCP1)
    • Standard PURExpress reagents
    • Addition of pigments directly into reactions:
      • Sample 1: Chlorophyll a
      • Sample 2: Chlorophyllin (saponified chlorophyll)
    • Dispense using Echo525 and Multiflo into 96-well plates
    • Incubate at 37°C for 2–4 hours
  • Concept: Co-translational or immediate post-translational binding improves efficiency and consistency of WSCP–pigment complex formation.
  • Automation: Echo525, Multiflo, Inheco Plate Incubator.
  • Microplate: 96-Armadillo-PCR-AB2396X.
  • Expected Result: WSCP1 expressed and directly assembled with pigments in solution.
  • Timeline: Day 10–11.

Step 4 — Expression Validation via Gel Imaging (Day 11)

  • Purpose: Confirm successful WSCP1 expression.
  • Method: Prepare samples for capillary electrophoresis or gel imaging:
    • Denature samples
    • Run LabChip or SDS-PAGE
  • Automation: ATC Thermal Cycler, LabChip system, HiG Centrifuge.
  • Microplate: 96-Armadillo-PCR-AB2396X.
  • Expected Result: Clear protein band at ~20–22 kDa in WSCP1 samples.
  • Timeline: Day 11.

Step 5 — UV-Vis Absorption Spectroscopy (Day 12–13)

  • Purpose: Verify protein–pigment binding.
  • Method: Measure spectra (350–750 nm) for:
    • WSCP1 + chlorophyll
    • WSCP1 + chlorophyllin
    • Free pigment controls
    • Denatured WSCP1 + pigment (negative control)
  • Replicates: All conditions in triplicate
  • Expected Result:
    • Native WSCP1 shows red-shift (~2–5 nm) and sharper peaks
    • Denatured WSCP1 resembles free pigment (no shift)
  • Timeline: Day 12–13.

Step 6 — Polymer Embedding and Material Preparation (Day 13–14)

  • Purpose: Create solid-state test materials.
  • Method: Embed:
    • WSCP1–pigment complexes
    • Free pigments into a polymer matrix (e.g., agar, chosen for minimal interference with iron reactions).
  • Concept: Stabilizes system and enables visual testing.
  • Automation: Manual preparation.
  • Microplate: N/A.
  • Expected Result: Stable embedded samples.
  • Timeline: Day 13–14.

Step 7 — Light Sensitivity and Iron Reaction Assays (Day 14–15)

  • Purpose: Test functional behavior of pigment systems.
  • Method:
    • Expose samples to controlled light conditions
    • Compare degradation rates (color change, absorbance loss)
    • Add iron (Fe²⁺/Fe³⁺) and observe:
      • Color change
      • Complex formation
  • Concepts: Photodegradation, iron chelation, pigment stability.
  • Automation: Controlled illumination + plate reader.
  • Microplate: Optional.
  • Expected Result:
    • WSCP complexes show increased stability vs free pigment
    • Chlorophyllin shows faster degradation
    • Visible iron interaction indicates chelation behavior
  • Timeline: Day 14–15.

Experimental Workflow

DNA Design (Twist Clonal Genes)
Plasmid Synthesis → Delivery to Ginkgo
Cell-Free Expression + pigments (PURExpress)
Protein Validation (Gel / LabChip)
UV-Vis Spectroscopy
Polymer Embedding
Light + Iron Reactivity Testing
Functional Validation of Photostability & Chelation

Techniques Used in This Project

Pipetting

  • Pipetting
  • Lab Safety
  • Bioethical Considerations

DNA Gel Art

  • DNA Sequencing

DNA Techniques

  • DNA Editing
  • DNA Construct Design
  • Restriction Enzyme Digestion
  • Gel Electrophoresis
  • DNA Purification From Gel
  • Databases (e.g., GenBank, NCBI, Ensembl, UCSC Genome Browser)

Lab Automation

  • Creating Code for Laboratory Automation
  • Using Liquid Handling Robots (e.g., Echo525, Bravo-96, Multiflo)
  • Designing a Twist Order
  • Creating a plan to use the Autonomous lab at Ginkgo Bioworks

Protein Design

  • Protein Design
  • Use of Boltz or PepMLM
  • Use of Asimov Kernel
  • Use of Benchling
  • Models and Notebooks (Python analysis)
  • Databases

Bioproduction

  • Bioproduction
  • Chassis Selection
  • Registry of Standard Biological Parts
  • Plasmid Preparation (via synthesis)
  • Bacterial Culturing
  • Quality Control/Analysis (UV-vis, LabChip)
  • Bacterial Processing

Cell-Free Systems

  • Cell Free Reactions
  • Freeze-Dried Cell Free Systems
  • miniPCR Tools
  • Protein Purification

Gibson Assembly / Cloning

  • Primer Design or Selection
  • PCR Reactions
  • Gibson Assembly
  • Other Cloning Methods

CRISPR

  • CRISPR/Cas9
  • Designing Prime Editing gRNA

SECTION 6: ADDITIONAL INFORMATION

References

Group Final Project

cover image cover image

Bacteriophage Engineering

GROUP MEMBERS

PROJECT MAIN GOAL : Increase the stability of the L protein

  • Our first approach to the mutagenesis of the L protein in order to increase its stability resulted in some of the following results:
METRQPQQQQQTPASTNRRRPRKHEDRPSRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

6 best LLR scored residues in hydrophilic zone (no changes to transmembrane zone)

  • 29 C->S (C->R was the best according to LLR score but was negative for lysis on the experimental data)
  • 39 Y->L
  • 9 S->Q
  • 5 F->Q
  • 27 Y->R
  • 22 F ->R
image image
MATRQQQQQQQQPSSTRRRRPRRRRRRPSRRRRRSSLLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

17 best residues in hydrophilic zone (no changes to transmembrane zone) Added to the previous best LLR scored residues the best mutant for other 11 residues always double checking with experimental data sheet

  • 39 Y->L
  • 9 S->Q
  • 5 F->Q
  • 27 Y->R
  • 22 F ->R
  • 17 N->R
  • 26 D->R
  • 23 K->R
  • 2 E -> A
  • 6 P -> Q
  • 12 T -> Q
  • 24 H -> R
  • 25 E -> R
  • 32 Q -> R
  • 33 Q -> R
  • 37 T -> L
  • 14 A -> S
image image
METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLLIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

Selection Rationale: Hydrophobic substitution in the transmembrane segment. Ala→Leu increases hydrophobicity and may stabilize membrane helix packing/insertion and oligomer stability.

image image
METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT

Selection Rationale: Polar→hydrophobic change in the TM region. Thr→Leu may increase membrane compatibility and reduce local insertion/misfolding penalties.

image image

PROPOSAL from Flo’s research: Shorten the L protein.

Rationale: MS2 bacteriophages kill E. coli bacteria via the protein L. L proteins insert themselves into the membrane and cause the lysis of the bacteria. A weakness of the L protein is that its folding and/or stabilization depends on a bacterial chaperone (DnaJ), making it vulnerable to adaptive mutations of the latter. A mutational study demonstrated that shorter versions of the L protein do not depend on the chaperone anymore [1], making it more resistant to bacterial mutations.

Strategy: Engineer a shorter version of L protein that permits an independent folding and conserves essential parts of the sequence such as the transmembrane domain needed for the insertion of the L protein into the membrane [2] and the C-terminal domain needed for the clustering of the L proteins that leads to the lysis of the bacteria [3].

Possible pitfalls:

  • We lack knowledge about the precise interactions between the L protein and DnaJ and thus, can’t exclude other purposes than the folding.
  • The absence of folding in the shortened versions of the protein might make them more susceptible to aggregation or/and degradation by endoribonucleases/proteases
  • We might underestimate the role of the “non-essential” regions
  • The bacteria can still keep adapting to survive (e.g. membrane composition, upregulation of proteases)
QPSSTRRRRPRRRRRRPSRRRRRSSLLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

Rationale: After our individual efforts on reaching a more stable mutant, we decided to make a shorter version out of the more apparently stable mutant— which seemed to fold the best according to AlphaFold.

image image

REFERENCES

1 — MS2 Lysis of Escherichia coli Depends on Host Chaperone DnaJ Chamakura et al. Journal of Bacteriology 2017

2 — Mutational analysis of the MS2 lysis protein L Chamakura et al., Microbiology 2017

3 — In vitro characterization of the phage lysis protein Microbiome Res Rep 2023