Fernando García González — HTGAA Spring 2026

FERNANDO GARCÍA GONZÁLEZ

Bioengineering • Synthetic Biology • Monterrey, México

About me

Biotechnology researcher focused on genetic engineering and synthetic biology applications for environmental sustainability. Currently enrolled in How to Grow (Almost) Anything (HTGAA) Spring 2026.

Research Interests: Synthetic biology, environmental biotechnology, bioremediation, genetic engineering, IoT-monitored bioreactors.

Location: Monterrey, Nuevo León, México

Contact info

★ ★ ★

Homework

Homework 1: Governance of Engineered Living Systems

Proposed Application: An Engineered Living Biofilter for PFAS and PFOS Transformation

I propose to develop a genetically informed living biofilter designed to transform and partially defluorinate persistent per- and polyfluoroalkyl substances (PFAS), including PFOS, in contaminated water streams. The system integrates naturally occurring PFAS-transforming microorganisms as gene donors with safe, well-characterized microbial or algal chassis suitable for controlled bioreactor environments.

PFAS and PFOS are widely used industrial compounds often referred to as “forever chemicals” due to the exceptional stability of the carbon–fluorine bond. Conventional remediation approaches—such as activated carbon adsorption, ion exchange resins, or high-energy destruction methods—are costly, energy-intensive, and often shift contaminants rather than eliminate their hazard. Biological approaches, while historically limited, have recently demonstrated initial defluorination and molecular transformation of certain PFAS compounds, suggesting that biology can play a meaningful role when carefully engineered and governed.

This project aims to explore biological transformation rather than complete mineralization, focusing on:

  • Identifying genes and enzymatic pathways associated with initial PFAS/PFOS defluorination or activation from environmentally relevant bacteria (e.g., Rhodococcus spp. and Acidimicrobium spp.).

  • Transferring or functionally expressing these pathways in safe, genetically tractable chassis organisms (e.g., Bacillus subtilis or a model microalga) suitable for contained bioreactors.

  • Conceptually integrating this biological system into an IoT-monitored bioreactor, enabling real-time control, containment, and performance assessment.

The broader motivation for this application is to reframe PFAS remediation as a hybrid biological–engineering challenge, where biology contributes selectivity, adaptability, and lower energy requirements, while engineering and governance provide containment, safety, and accountability. This approach could enable more sustainable remediation strategies while avoiding environmental release of engineered organisms.

References:

Wackett, L. P. (2022). Nothing lasts forever: understanding microbial biodegradation of polyfluorinated compounds and perfluorinated alkyl substances. Microbial Biotechnology.

Wackett, L. P. & Robinson, S. L. (2024). A prescription for engineering PFAS biodegradation. Biochemical Journal.

Khan, M. F. et al. (2025). Recent progress and challenges in microbial defluorination and degradation for sustainable remediation of fluorinated xenobiotics. Processes (MDPI).

Ochoa-Herrera, V. et al. (2016). Microbial toxicity and biodegradability of PFOS and shorter-chain PFAS. Environmental Science: Processes & Impacts.

Governance and Policy Goals for an Ethical Biological Future

Overarching Governance Goal

Ensure that engineered biological systems for PFAS and PFOS transformation contribute to environmental remediation without introducing new risks to human health, ecosystems, or global biosecurity, while supporting responsible innovation and equitable access to remediation technologies.

This project explicitly acknowledges that engineered organisms—especially those designed for environmental applications—raise ethical concerns related to containment, misuse, unintended ecological impact, and governance gaps between laboratory research and real-world deployment.

To address these concerns, the following governance goals and sub-goals are proposed.

Goal 1: Prevent Harm Through Strong Biosecurity and Containment (Non-malfeasance)

Rationale: Genetically engineered microorganisms capable of interacting with persistent pollutants must not become environmental liabilities themselves.

Sub-goals:

  • Prevent unintended environmental release: Ensure that engineered organisms are restricted to closed, monitored bioreactor systems. Avoid open-environment deployment during early-stage research.

  • Minimize misuse or dual-use risks: Limit genetic designs to narrowly scoped metabolic functions. Avoid transferable traits that could be repurposed outside remediation contexts.

  • Enable traceability and accountability: Ensure engineered strains and systems are clearly attributable to responsible institutions.

Goal 2: Promote Laboratory Safety and Responsible Research Practices

Rationale: Even low-risk chassis organisms can pose safety challenges when engineered for novel metabolic functions.

Sub-goals:

  • Align experimental design with appropriate biosafety levels (BSL-1/2): Prefer organisms with long histories of safe laboratory use. Avoid pathogens or environmentally invasive species.

  • Encourage anticipatory risk assessment: Incorporate safety and failure-mode analysis early in the design process. Treat uncertainty as a governance issue, not only a technical one.

Goal 3: Protect the Environment Beyond Immediate Remediation Goals

Rationale: An ethical remediation technology should not shift risks across time, space, or species.

Sub-goals:

  • Avoid ecological burden shifting: Ensure PFAS transformation does not generate equally persistent or toxic byproducts. Design systems that facilitate downstream treatment or capture of intermediates.

  • Prevent biological persistence outside engineered systems: Favor organisms with limited survival outside controlled conditions. Design for dependency on reactor-specific nutrients or conditions.

Goal 4: Support Responsible Innovation and Public Trust

Rationale: Environmental biotechnology operates at the intersection of public concern, regulatory uncertainty, and scientific innovation.

Sub-goals:

  • Promote transparency and explainability: Clearly communicate system capabilities and limitations. Avoid overpromising complete PFAS destruction.

  • Enable equitable and constructive use: Design systems that could be adapted for communities disproportionately affected by PFAS contamination. Avoid remediation approaches accessible only to highly resourced actors.

Why These Goals Matter for This Project

Together, these governance goals ensure that the proposed living biofilter:

  • Advances constructive environmental applications of synthetic biology
  • Respects precaution in the face of uncertainty
  • Aligns with emerging norms for responsible biotechnology governance
  • Treats ethics as a design constraint, not an afterthought

These goals will later serve as the evaluation rubric for comparing concrete governance actions (technical, institutional, and regulatory) in subsequent sections of the project.

References:

National Academies of Sciences, Engineering, and Medicine (2018). Biodefense in the Age of Synthetic Biology. Washington, DC: National Academies Press.

Kelle, A. (2020). Synthetic biology and biosecurity: challenging the “myths”. Global Security Studies, 11(2).

Garfinkel, M. S., Endy, D., Epstein, G. L., & Friedman, R. M. (2007). Synthetic genomics: options for governance. Biosecurity and Bioterrorism, 5(4), 359–362.

Oye, K. A., et al. (2014). Regulating gene drives. Science, 345(6197), 626–628.

Proposed Governance Actions

Governance Action 1: Technical Containment and Genetic Safeguards in Closed Bioreactors

Purpose: Currently, many environmental biotechnology projects rely on physical containment and institutional oversight as primary safety measures. This action proposes strengthening harm prevention by embedding technical containment mechanisms directly into the biological and reactor design. The goal is to prevent unintended environmental release and persistence of engineered organisms used for PFAS/PFOS transformation.

Design: This action would require academic researchers and technology developers to:

  • Use closed, instrumented bioreactor systems rather than open environmental deployment.
  • Select well-characterized, low-risk chassis organisms suitable for BSL-1 or BSL-2 laboratories.
  • Incorporate built-in biological dependency mechanisms, such as reliance on reactor-specific nutrients or environmental conditions not found outside the system.
  • Integrate real-time monitoring (e.g., IoT-based sensors) for biomass levels, system integrity, and operational anomalies.

Implementation would require opt-in by research laboratories, approval by institutional biosafety committees (IBCs), and alignment with existing biosafety regulations rather than the creation of new high-burden rules.

Assumptions:

  • Technical containment measures are sufficient to significantly reduce environmental escape risk.
  • Researchers and institutions have the capacity and incentives to adopt enhanced containment designs.
  • Monitoring data can be meaningfully interpreted and acted upon in real time.

Risks of Failure and “Success”:

  • Failure could occur if containment systems create a false sense of security, leading to reduced human oversight.
  • Successful implementation may increase project costs and technical complexity, potentially limiting participation by under-resourced laboratories.

Governance Action 2: Mandatory Pre-Deployment Ethical and Environmental Risk Assessment

Purpose: At present, many research projects undergo biosafety review but lack structured evaluation of environmental ethics, long-term ecological impact, and uncertainty. This action proposes a formal requirement for project-specific ethical and environmental risk assessments prior to advancing beyond laboratory-scale research.

Design: This action would be implemented through:

  • Expansion of existing institutional review processes (e.g., IBCs or environmental health and safety offices) to include environmental and ethical risk review.
  • A standardized assessment template addressing:
    • Intended and unintended environmental impacts
    • Potential byproducts of PFAS/PFOS transformation
    • Failure modes and uncertainty
    • Plans for monitoring, shutdown, and remediation
  • Review by interdisciplinary committees including engineers, environmental scientists, and ethics or policy experts.

This approach leverages existing governance structures rather than introducing external regulatory oversight at early research stages.

Assumptions:

  • Structured assessment improves decision-making and researcher awareness.
  • Institutions are willing to broaden review criteria beyond immediate biosafety.
  • Early-stage reflection can meaningfully influence project design choices.

Risks of Failure and “Success”:

  • The process may become a procedural “checkbox” exercise rather than substantive engagement.
  • Excessive review burdens could slow exploratory research if not carefully scoped.

Governance Action 3: Voluntary Transparency and Research Registry for Environmental Synthetic Biology

Purpose: Public trust in environmental biotechnology is often undermined by limited transparency and unclear accountability. This action proposes a voluntary research registry for engineered biological systems intended for environmental applications, promoting openness without mandating disclosure of sensitive intellectual property.

Design: Key elements include:

  • A publicly accessible registry maintained by academic consortia, professional societies, or funding agencies.
  • High-level project descriptions covering:
    • Intended application and organism type
    • Containment strategy
    • Stage of development
    • Responsible institution
  • Participation incentivized through funding requirements, publication norms, or professional recognition rather than legal mandates.

Actors involved include academic researchers, funding bodies, journals, and professional societies.

Assumptions:

  • Transparency reduces suspicion and supports responsible norms.
  • High-level disclosure does not meaningfully increase misuse risk.
  • Incentives are sufficient to encourage participation.

Risks of Failure and “Success”:

  • Low participation could limit the registry’s value.
  • Over-disclosure could raise concerns about intellectual property or dual-use risks if poorly designed.

Summary

Together, these governance actions form a layered approach:

  • Technical safeguards reduce physical and biological risk.
  • Institutional review embeds ethical reflection early in the research process.
  • Transparency mechanisms support accountability and public trust.

This combination balances safety, feasibility, and innovation, aligning governance with the realities of early-stage environmental biotechnology research rather than imposing rigid, one-size-fits-all regulation.

Governance Actions Scoring Table

Does the option:Option 1Option 2Option 3
Enhance Biosecurity
– By preventing incidents122
– By helping respond221
Foster Lab Safety
– By preventing incident123
– By helping respond212
Protect the environment
– By preventing incidents123
– By helping respond212
Other considerations
– Minimizing costs and burdens to stakeholders321
– Feasibility?211
– Not impede research221
– Promote constructive applications121

Prioritized Governance Strategy and Rationale

Drawing upon the scoring across biosecurity, laboratory safety, environmental protection, feasibility, and research enablement, the governance strategy I would prioritize is a combination of Option 1 (Technical containment and genetic safeguards) and Option 2 (Mandatory pre-deployment ethical and environmental risk assessment), with Option 3 (Voluntary transparency and research registry) serving as a complementary, secondary measure.

Option 1 consistently scored highest in categories related to preventing incidents, including biosecurity breaches, laboratory accidents, and environmental harm. For an engineered biological system designed to interact with persistent pollutants such as PFAS and PFOS, prevention is ethically preferable to post hoc response. Embedding containment directly into both the biological design and the reactor architecture aligns with the principle of non-malfeasance and reduces reliance on perfect human behavior or institutional oversight alone.

Option 2 complements this technical approach by addressing a different but equally important dimension: uncertainty. While Option 1 reduces the likelihood of physical or biological escape, Option 2 improves preparedness for unforeseen consequences by requiring structured ethical and environmental reflection before scaling or deployment. This option scored particularly well in helping response, fostering lab safety culture, and protecting the environment through anticipatory governance rather than reactive regulation.

Option 3, while scoring lower in direct prevention, offers significant benefits in terms of feasibility, cost, and public trust. However, transparency alone does not sufficiently mitigate the risks associated with engineered organisms in environmental contexts. As such, it is best positioned as a supporting action that reinforces accountability and legitimacy once strong technical and institutional safeguards are already in place.

Trade-offs, Assumptions, and Uncertainties

This prioritization involves several trade-offs. Technical containment strategies increase system complexity and cost, potentially limiting accessibility for smaller or under-resourced laboratories. Mandatory ethical and environmental assessments may slow early-stage research and risk becoming procedural if poorly designed. However, these burdens are justified by the high potential costs of failure in environmental biotechnology, where unintended consequences may be irreversible.

Key assumptions underlying this strategy include the belief that:

  • Closed bioreactor systems can meaningfully reduce environmental exposure risks.
  • Early ethical and environmental reflection improves design decisions rather than merely documenting them.
  • Existing institutional governance structures can be adapted without creating excessive regulatory friction.

Uncertainties remain, particularly regarding the long-term fate of PFAS transformation byproducts and the behavior of engineered organisms under non-ideal conditions. These uncertainties further support a governance approach that emphasizes containment and reflection rather than premature deployment.

Target Audience for the Recommendation

This combined governance strategy is primarily directed at academic research institutions and funding agencies, such as MIT leadership, U.S. federal research funders, and international research consortia in environmental biotechnology. These actors are well positioned to:

  • Set norms for responsible design before commercialization pressures emerge.
  • Integrate governance expectations into funding and institutional review processes.
  • Influence downstream industrial and regulatory practices through precedent.

By acting at this early stage, these institutions can shape the ethical trajectory of environmental synthetic biology rather than reacting to failures after deployment.

Ethical Reflections from This Week’s Class

One ethical concern that emerged strongly during this week of class was the tension between urgency and precaution. PFAS contamination represents a pressing environmental and public health problem, creating pressure to deploy solutions rapidly. However, the history of environmental interventions demonstrates that well-intentioned technologies can produce new harms when uncertainty is underestimated.

A second concern was the risk of responsibility diffusion in complex technological systems. When harm occurs, accountability can become fragmented across designers, operators, institutions, and regulators. This reinforces the need for governance mechanisms that assign responsibility clearly and early.

Finally, the class highlighted how ethical considerations are often treated as external constraints, rather than as design inputs. In this project, ethical governance is treated as an integral part of system architecture, shaping choices about organisms, reactors, and deployment pathways.

Additional Governance Actions to Address These Concerns

To address these ethical issues, two additional governance actions are appropriate:

  1. Embedding ethical reflection into technical milestones, such that progression from laboratory proof-of-concept to pilot-scale systems requires explicit justification of risk reduction and uncertainty management.

  2. Clear assignment of institutional responsibility, ensuring that specific actors remain accountable for system performance, monitoring, and shutdown even after research transitions to applied settings.

Together, these measures reinforce a vision of environmental biotechnology that is not only innovative, but also cautious, accountable, and ethically grounded.

★ ★ ★

Labs

★ ★ ★

Projects


HTGAA Spring 2026 • Monterrey, México

Subsections of Fernando García González — HTGAA Spring 2026

Homework 1: Governance of Engineered Living Systems

Proposed Application: An Engineered Living Biofilter for PFAS and PFOS Transformation

I propose to develop a genetically informed living biofilter designed to transform and partially defluorinate persistent per- and polyfluoroalkyl substances (PFAS), including PFOS, in contaminated water streams. The system integrates naturally occurring PFAS-transforming microorganisms as gene donors with safe, well-characterized microbial or algal chassis suitable for controlled bioreactor environments.

PFAS and PFOS are widely used industrial compounds often referred to as “forever chemicals” due to the exceptional stability of the carbon–fluorine bond. Conventional remediation approaches—such as activated carbon adsorption, ion exchange resins, or high-energy destruction methods—are costly, energy-intensive, and often shift contaminants rather than eliminate their hazard. Biological approaches, while historically limited, have recently demonstrated initial defluorination and molecular transformation of certain PFAS compounds, suggesting that biology can play a meaningful role when carefully engineered and governed.

This project aims to explore biological transformation rather than complete mineralization, focusing on:

  • Identifying genes and enzymatic pathways associated with initial PFAS/PFOS defluorination or activation from environmentally relevant bacteria (e.g., Rhodococcus spp. and Acidimicrobium spp.).

  • Transferring or functionally expressing these pathways in safe, genetically tractable chassis organisms (e.g., Bacillus subtilis or a model microalga) suitable for contained bioreactors.

  • Conceptually integrating this biological system into an IoT-monitored bioreactor, enabling real-time control, containment, and performance assessment.

The broader motivation for this application is to reframe PFAS remediation as a hybrid biological–engineering challenge, where biology contributes selectivity, adaptability, and lower energy requirements, while engineering and governance provide containment, safety, and accountability. This approach could enable more sustainable remediation strategies while avoiding environmental release of engineered organisms.

References:

Wackett, L. P. (2022). Nothing lasts forever: understanding microbial biodegradation of polyfluorinated compounds and perfluorinated alkyl substances. Microbial Biotechnology.

Wackett, L. P. & Robinson, S. L. (2024). A prescription for engineering PFAS biodegradation. Biochemical Journal.

Khan, M. F. et al. (2025). Recent progress and challenges in microbial defluorination and degradation for sustainable remediation of fluorinated xenobiotics. Processes (MDPI).

Ochoa-Herrera, V. et al. (2016). Microbial toxicity and biodegradability of PFOS and shorter-chain PFAS. Environmental Science: Processes & Impacts.

Governance and Policy Goals for an Ethical Biological Future

Overarching Governance Goal

Ensure that engineered biological systems for PFAS and PFOS transformation contribute to environmental remediation without introducing new risks to human health, ecosystems, or global biosecurity, while supporting responsible innovation and equitable access to remediation technologies.

This project explicitly acknowledges that engineered organisms—especially those designed for environmental applications—raise ethical concerns related to containment, misuse, unintended ecological impact, and governance gaps between laboratory research and real-world deployment.

To address these concerns, the following governance goals and sub-goals are proposed.

Goal 1: Prevent Harm Through Strong Biosecurity and Containment (Non-malfeasance)

Rationale: Genetically engineered microorganisms capable of interacting with persistent pollutants must not become environmental liabilities themselves.

Sub-goals:

  • Prevent unintended environmental release: Ensure that engineered organisms are restricted to closed, monitored bioreactor systems. Avoid open-environment deployment during early-stage research.

  • Minimize misuse or dual-use risks: Limit genetic designs to narrowly scoped metabolic functions. Avoid transferable traits that could be repurposed outside remediation contexts.

  • Enable traceability and accountability: Ensure engineered strains and systems are clearly attributable to responsible institutions.

Goal 2: Promote Laboratory Safety and Responsible Research Practices

Rationale: Even low-risk chassis organisms can pose safety challenges when engineered for novel metabolic functions.

Sub-goals:

  • Align experimental design with appropriate biosafety levels (BSL-1/2): Prefer organisms with long histories of safe laboratory use. Avoid pathogens or environmentally invasive species.

  • Encourage anticipatory risk assessment: Incorporate safety and failure-mode analysis early in the design process. Treat uncertainty as a governance issue, not only a technical one.

Goal 3: Protect the Environment Beyond Immediate Remediation Goals

Rationale: An ethical remediation technology should not shift risks across time, space, or species.

Sub-goals:

  • Avoid ecological burden shifting: Ensure PFAS transformation does not generate equally persistent or toxic byproducts. Design systems that facilitate downstream treatment or capture of intermediates.

  • Prevent biological persistence outside engineered systems: Favor organisms with limited survival outside controlled conditions. Design for dependency on reactor-specific nutrients or conditions.

Goal 4: Support Responsible Innovation and Public Trust

Rationale: Environmental biotechnology operates at the intersection of public concern, regulatory uncertainty, and scientific innovation.

Sub-goals:

  • Promote transparency and explainability: Clearly communicate system capabilities and limitations. Avoid overpromising complete PFAS destruction.

  • Enable equitable and constructive use: Design systems that could be adapted for communities disproportionately affected by PFAS contamination. Avoid remediation approaches accessible only to highly resourced actors.

Why These Goals Matter for This Project

Together, these governance goals ensure that the proposed living biofilter:

  • Advances constructive environmental applications of synthetic biology
  • Respects precaution in the face of uncertainty
  • Aligns with emerging norms for responsible biotechnology governance
  • Treats ethics as a design constraint, not an afterthought

These goals will later serve as the evaluation rubric for comparing concrete governance actions (technical, institutional, and regulatory) in subsequent sections of the project.

References:

National Academies of Sciences, Engineering, and Medicine (2018). Biodefense in the Age of Synthetic Biology. Washington, DC: National Academies Press.

Kelle, A. (2020). Synthetic biology and biosecurity: challenging the “myths”. Global Security Studies, 11(2).

Garfinkel, M. S., Endy, D., Epstein, G. L., & Friedman, R. M. (2007). Synthetic genomics: options for governance. Biosecurity and Bioterrorism, 5(4), 359–362.

Oye, K. A., et al. (2014). Regulating gene drives. Science, 345(6197), 626–628.

Proposed Governance Actions

Governance Action 1: Technical Containment and Genetic Safeguards in Closed Bioreactors

Purpose: Currently, many environmental biotechnology projects rely on physical containment and institutional oversight as primary safety measures. This action proposes strengthening harm prevention by embedding technical containment mechanisms directly into the biological and reactor design. The goal is to prevent unintended environmental release and persistence of engineered organisms used for PFAS/PFOS transformation.

Design: This action would require academic researchers and technology developers to:

  • Use closed, instrumented bioreactor systems rather than open environmental deployment.
  • Select well-characterized, low-risk chassis organisms suitable for BSL-1 or BSL-2 laboratories.
  • Incorporate built-in biological dependency mechanisms, such as reliance on reactor-specific nutrients or environmental conditions not found outside the system.
  • Integrate real-time monitoring (e.g., IoT-based sensors) for biomass levels, system integrity, and operational anomalies.

Implementation would require opt-in by research laboratories, approval by institutional biosafety committees (IBCs), and alignment with existing biosafety regulations rather than the creation of new high-burden rules.

Assumptions:

  • Technical containment measures are sufficient to significantly reduce environmental escape risk.
  • Researchers and institutions have the capacity and incentives to adopt enhanced containment designs.
  • Monitoring data can be meaningfully interpreted and acted upon in real time.

Risks of Failure and “Success”:

  • Failure could occur if containment systems create a false sense of security, leading to reduced human oversight.
  • Successful implementation may increase project costs and technical complexity, potentially limiting participation by under-resourced laboratories.

Governance Action 2: Mandatory Pre-Deployment Ethical and Environmental Risk Assessment

Purpose: At present, many research projects undergo biosafety review but lack structured evaluation of environmental ethics, long-term ecological impact, and uncertainty. This action proposes a formal requirement for project-specific ethical and environmental risk assessments prior to advancing beyond laboratory-scale research.

Design: This action would be implemented through:

  • Expansion of existing institutional review processes (e.g., IBCs or environmental health and safety offices) to include environmental and ethical risk review.
  • A standardized assessment template addressing:
    • Intended and unintended environmental impacts
    • Potential byproducts of PFAS/PFOS transformation
    • Failure modes and uncertainty
    • Plans for monitoring, shutdown, and remediation
  • Review by interdisciplinary committees including engineers, environmental scientists, and ethics or policy experts.

This approach leverages existing governance structures rather than introducing external regulatory oversight at early research stages.

Assumptions:

  • Structured assessment improves decision-making and researcher awareness.
  • Institutions are willing to broaden review criteria beyond immediate biosafety.
  • Early-stage reflection can meaningfully influence project design choices.

Risks of Failure and “Success”:

  • The process may become a procedural “checkbox” exercise rather than substantive engagement.
  • Excessive review burdens could slow exploratory research if not carefully scoped.

Governance Action 3: Voluntary Transparency and Research Registry for Environmental Synthetic Biology

Purpose: Public trust in environmental biotechnology is often undermined by limited transparency and unclear accountability. This action proposes a voluntary research registry for engineered biological systems intended for environmental applications, promoting openness without mandating disclosure of sensitive intellectual property.

Design: Key elements include:

  • A publicly accessible registry maintained by academic consortia, professional societies, or funding agencies.
  • High-level project descriptions covering:
    • Intended application and organism type
    • Containment strategy
    • Stage of development
    • Responsible institution
  • Participation incentivized through funding requirements, publication norms, or professional recognition rather than legal mandates.

Actors involved include academic researchers, funding bodies, journals, and professional societies.

Assumptions:

  • Transparency reduces suspicion and supports responsible norms.
  • High-level disclosure does not meaningfully increase misuse risk.
  • Incentives are sufficient to encourage participation.

Risks of Failure and “Success”:

  • Low participation could limit the registry’s value.
  • Over-disclosure could raise concerns about intellectual property or dual-use risks if poorly designed.

Summary

Together, these governance actions form a layered approach:

  • Technical safeguards reduce physical and biological risk.
  • Institutional review embeds ethical reflection early in the research process.
  • Transparency mechanisms support accountability and public trust.

This combination balances safety, feasibility, and innovation, aligning governance with the realities of early-stage environmental biotechnology research rather than imposing rigid, one-size-fits-all regulation.

Governance Actions Scoring Table

Does the option:Option 1Option 2Option 3
Enhance Biosecurity
– By preventing incidents122
– By helping respond221
Foster Lab Safety
– By preventing incident123
– By helping respond212
Protect the environment
– By preventing incidents123
– By helping respond212
Other considerations
– Minimizing costs and burdens to stakeholders321
– Feasibility?211
– Not impede research221
– Promote constructive applications121

Prioritized Governance Strategy and Rationale

Drawing upon the scoring across biosecurity, laboratory safety, environmental protection, feasibility, and research enablement, the governance strategy I would prioritize is a combination of Option 1 (Technical containment and genetic safeguards) and Option 2 (Mandatory pre-deployment ethical and environmental risk assessment), with Option 3 (Voluntary transparency and research registry) serving as a complementary, secondary measure.

Option 1 consistently scored highest in categories related to preventing incidents, including biosecurity breaches, laboratory accidents, and environmental harm. For an engineered biological system designed to interact with persistent pollutants such as PFAS and PFOS, prevention is ethically preferable to post hoc response. Embedding containment directly into both the biological design and the reactor architecture aligns with the principle of non-malfeasance and reduces reliance on perfect human behavior or institutional oversight alone.

Option 2 complements this technical approach by addressing a different but equally important dimension: uncertainty. While Option 1 reduces the likelihood of physical or biological escape, Option 2 improves preparedness for unforeseen consequences by requiring structured ethical and environmental reflection before scaling or deployment. This option scored particularly well in helping response, fostering lab safety culture, and protecting the environment through anticipatory governance rather than reactive regulation.

Option 3, while scoring lower in direct prevention, offers significant benefits in terms of feasibility, cost, and public trust. However, transparency alone does not sufficiently mitigate the risks associated with engineered organisms in environmental contexts. As such, it is best positioned as a supporting action that reinforces accountability and legitimacy once strong technical and institutional safeguards are already in place.

Trade-offs, Assumptions, and Uncertainties

This prioritization involves several trade-offs. Technical containment strategies increase system complexity and cost, potentially limiting accessibility for smaller or under-resourced laboratories. Mandatory ethical and environmental assessments may slow early-stage research and risk becoming procedural if poorly designed. However, these burdens are justified by the high potential costs of failure in environmental biotechnology, where unintended consequences may be irreversible.

Key assumptions underlying this strategy include the belief that:

  • Closed bioreactor systems can meaningfully reduce environmental exposure risks.
  • Early ethical and environmental reflection improves design decisions rather than merely documenting them.
  • Existing institutional governance structures can be adapted without creating excessive regulatory friction.

Uncertainties remain, particularly regarding the long-term fate of PFAS transformation byproducts and the behavior of engineered organisms under non-ideal conditions. These uncertainties further support a governance approach that emphasizes containment and reflection rather than premature deployment.

Target Audience for the Recommendation

This combined governance strategy is primarily directed at academic research institutions and funding agencies, such as MIT leadership, U.S. federal research funders, and international research consortia in environmental biotechnology. These actors are well positioned to:

  • Set norms for responsible design before commercialization pressures emerge.
  • Integrate governance expectations into funding and institutional review processes.
  • Influence downstream industrial and regulatory practices through precedent.

By acting at this early stage, these institutions can shape the ethical trajectory of environmental synthetic biology rather than reacting to failures after deployment.

Ethical Reflections from This Week’s Class

One ethical concern that emerged strongly during this week of class was the tension between urgency and precaution. PFAS contamination represents a pressing environmental and public health problem, creating pressure to deploy solutions rapidly. However, the history of environmental interventions demonstrates that well-intentioned technologies can produce new harms when uncertainty is underestimated.

A second concern was the risk of responsibility diffusion in complex technological systems. When harm occurs, accountability can become fragmented across designers, operators, institutions, and regulators. This reinforces the need for governance mechanisms that assign responsibility clearly and early.

Finally, the class highlighted how ethical considerations are often treated as external constraints, rather than as design inputs. In this project, ethical governance is treated as an integral part of system architecture, shaping choices about organisms, reactors, and deployment pathways.

Additional Governance Actions to Address These Concerns

To address these ethical issues, two additional governance actions are appropriate:

  1. Embedding ethical reflection into technical milestones, such that progression from laboratory proof-of-concept to pilot-scale systems requires explicit justification of risk reduction and uncertainty management.

  2. Clear assignment of institutional responsibility, ensuring that specific actors remain accountable for system performance, monitoring, and shutdown even after research transitions to applied settings.

Together, these measures reinforce a vision of environmental biotechnology that is not only innovative, but also cautious, accountable, and ethically grounded.

Subsections of Homework 1: Governance of Engineered Living Systems

Week 1 HW: Principles and Practices

cover image cover image
Does the option:Option 1Option 2Option 3
Enhance Biosecurity
• By preventing incidents
• By helping respond
Foster Lab Safety
• By preventing incident
• By helping respond
Protect the environment
• By preventing incidents
• By helping respond
Other considerations
• Minimizing costs and burdens to stakeholders
• Feasibility?
• Not impede research
• Promote constructive applications

Week 3 HW: Opentrons Artwork

Opentrons Artwork Opentrons Artwork

Week 3 — Python Script for Opentrons Artwork

Assignment Summary

For this assignment, I created a Python script to run on an Opentrons liquid handling robot in order to generate a fluorescent artwork on an agar plate.

The workflow included:

  • Designing artwork using the Opentrons GUI tool
  • Extracting coordinate data
  • Writing a Python script compatible with Opentrons API Level 2.20
  • Mapping protein families to available color wells
  • Executing automated droplet-based patterning

My design is titled:

“Catus Mex”

A stylized Mexican cactus constructed from grouped fluorescent protein coordinate sets.


Artistic Concept

The design represents a geometric cactus silhouette inspired by biological fluorescence families.

Color logic:

  • Red-family proteins → Main cactus body
  • Green-family proteins → Internal structure and reinforcement
  • Orange-family proteins → Accent regions and contrast

The structure combines symmetry, layered density, and protein categorization to produce a biologically themed visual composition.


Technical Implementation

The protocol performs the following:

  • Loads 20 µL tip rack (slot 9)
  • Loads Temperature Module Gen2 (slot 6)
  • Loads aluminum PCR block for color wells
  • Loads calibrated agar plate (slot 5)
  • Maps protein names to available color wells
  • Iterates through coordinate arrays
  • Aspirates 2 µL per point
  • Dispenses using controlled droplet detachment logic
  • Places droplets relative to the calibrated plate center

Drop volume used: 2 µL

Each coordinate is positioned relative to the agar plate center:

target_location = center_location.move(types.Point(x=x, y=y, z=0))

Index final correcto · MD Copiar


title: “Week 3 HW: Opentrons Artwork” weight: 30

Opentrons Artwork

Week 3 — Python Script for Opentrons Artwork

Assignment Summary

For this assignment, I created a Python script to run on an Opentrons liquid handling robot in order to generate a fluorescent artwork on an agar plate.

The workflow included:

  • Designing artwork using the Opentrons GUI tool
  • Extracting coordinate data
  • Writing a Python script compatible with Opentrons API Level 2.20
  • Mapping protein families to available color wells
  • Executing automated droplet-based patterning

My design is titled:

“Cactus Mex”

A stylized Mexican cactus constructed from grouped fluorescent protein coordinate sets.


Artistic Concept

The design represents a geometric cactus silhouette inspired by biological fluorescence families.

Color logic:

  • Red-family proteins → Main cactus body
  • Green-family proteins → Internal structure and reinforcement
  • Orange-family proteins → Accent regions and contrast

The structure combines symmetry, layered density, and protein categorization to produce a biologically themed visual composition.


Technical Implementation

The protocol performs the following:

  • Loads 20 µL tip rack (slot 9)
  • Loads Temperature Module Gen2 (slot 6)
  • Loads aluminum PCR block for color wells
  • Loads calibrated agar plate (slot 5)
  • Maps protein names to available color wells
  • Iterates through coordinate arrays
  • Aspirates 2 µL per point
  • Dispenses using controlled droplet detachment logic
  • Places droplets relative to the calibrated plate center

Drop volume used: 2 µL

Each coordinate is positioned relative to the agar plate center:

target_location = center_location.move(types.Point(x=x, y=y, z=0))

Design Process

Here is my initial cactus design:

Cactus Design

The coordinate mapping visualization:

Cactus Coordinates

Results

The final fluorescent artwork on the agar plate:

Final Cactus on Plate

The artwork successfully demonstrates the precision of automated liquid handling combined with biological fluorescence.

Code

You can view my complete Python script here: Google Colab Notebook



Subsections of Labs

Week 1 Lab: Pipetting

cover image cover image

Subsections of Projects

Individual Final Project

cover image cover image

Group Final Project

cover image cover image

Contents

Subsections of Contents

Week 2 HW: Gel Electrophoresis & DNA Design

cover image cover image

Part 0: Basics of Gel Electrophoresis

(Completed via lecture and recitation videos.)


Part 1: Benchling & In-silico Gel Art

(In progress — to be submitted after lab access.)


Part 3: DNA Design Challenge

3.1 — Protein Choice

Protein: Haloacid dehalogenase — Rhodococcus jostii RHA1 (gene: RHA1_ro00230) UniProt accession: Q0SK70

I chose this enzyme because it is directly relevant to my proposed project: a living biofilter for PFAS/PFOS transformation. R. jostii RHA1 is one of the best-characterized bacteria capable of initial defluorination of persistent fluorinated compounds. The haloacid dehalogenase catalyzes the cleavage of carbon–halogen bonds, making it a candidate enzyme for the first transformation step of PFAS molecules. Identifying and expressing this gene in a safe chassis is the core engineering goal of my project.

Protein sequence (from UniProt):

>tr|Q0SK70|Q0SK70_RHOJR Haloacid dehalogenase OS=Rhodococcus jostii
(strain RHA1) OX=101510 GN=RHA1_ro00230 PE=1 SV=1
MAGVPFRSPSTGRNVRAVLFDTFGTVVDWRTGIATAVADYAARHQLEVDAVAFADRWRAR
YQPSMDA ILSGAREFVTLDILHRENLDFVLRESGIDPTNHDSGELDELARAWHVLTPWPD
SVPGLTAIKAE YIIGPLSNGNTSLLLDMAKNAGIPWDVIIGSD INRKYKPDPQAYLRTAQ
VLGLHPGEVMLAAA HNGDLEAAHATGLATAFIL RPVEHGPHQTDDLAPTGSWDISATDIT
DLAAQLRAGSTGFR

3.2 — Reverse Translation: Protein → DNA

The DNA sequence below corresponds to the haloacid dehalogenase gene (RHA1_ro00230) from the R. jostii RHA1 genome, obtained via NCBI (GenBank accession: ABG92066.1).

ATGGCGGGCGTGCCGTTTCGTAGCCCGAGCACCGGCCGTAACGTGCGTGCGGTGCTGTTT
GATACCTTTGGCACCGTGGTGGATTGGCGTACCGGCATTGCGACCGCGGTGGCGGATTAT
GCGGCGCGTCATCAGCTGGAAGTGGATGCGGTGGCGTTTGCGGATCGTTGGCGTGCGCGT
TATCAGCCGAGCATGGATGCGATTCTGAGCGGCGCGCGTGAATTTGTGACCCTGGATATT
CTGCATCGTGAAAACCTGGATTTGTGCTGCGTGAAAGCGGCATTGATCCGACCAACCATG
ATAGCGGCGAACTGGATGAACTGGCGCGTGCGTGGCATGTGCTGACCCCGTGGCCGGATA
GCGTGCCGGGCCTGACCGCGATTAAAGCGGAATATATTATTGGCCCGCTGAGCAACGGCA
ACACCAGCCTGCTGCTGGATATGGCGAAAAACGCGGGCATTCCGTGGGATGTGATTATTG
GCAGCGATATTAACCGTAAATATAAA CCGGATCCGCAGGCGTATCTGCGTACCGCGCAGG
TGCTGGGCCTGCATCCGGGCGAAGTGATGCTGGCGGCGGCGCATAACGGCGATCTGGAAG
CGGCGCATGCGACCGGCCTGGCGACCGCGTTTATCCTGCGTCCGGTGGAACATGGCCCGC
ATCAGACCGATGATCTGGCGCCGACCGGCAGCTGGGATATT AGCGCGACCGATATTACCG
ATCTGGCGGCGCAGCTGCGTGCGGGCAGCACCGGCTTTCGT

3.3 — Codon Optimization

Tool used: Twist Bioscience Codon Optimization Tool Chassis organism: Escherichia coli K-12

Why codon optimization is necessary:

The genetic code is degenerate — multiple codons can encode the same amino acid, but different organisms preferentially use certain codons over others (codon usage bias). R. jostii RHA1 has a genomic GC content of ~67%, so its native genes are heavily biased toward GC-rich codons. E. coli K-12, with a GC content of ~51%, uses a very different codon distribution. If the native Rhodococcus gene is expressed in E. coli without optimization, the ribosome will frequently encounter rare codons, causing translation to slow, stall, or produce misfolded protein. Codon optimization replaces rare codons with the E. coli-preferred synonymous codons, improving translation efficiency without changing the amino acid sequence.

Why E. coli K-12 as chassis: E. coli K-12 was chosen over B. subtilis because its GC content (~51%) is more compatible with the donor sequence (~67%), requiring fewer codon substitutions. It is BSL-1, extremely well characterized for heterologous protein expression, and all major codon optimization tools have highly curated E. coli codon tables. This aligns with the safety and containment goals outlined in my PFAS biofilter project proposal.

Codon-optimized DNA sequence for E. coli K-12:

ATGGCGGGCGTGCCGTTTCGTAGCCCGAGCACCGGCCGTAACGTGCGTGCGGTGCTGTTT
GATACCTTTGGCACCGTGGTGGATTGGCGTACCGGCATTGCGACCGCGGTGGCGGATTAT
GCGGCGCGTCATCAGCTGGAAGTGGATGCGGTGGCGTTTGCGGATCGTTGGCGTGCGCGT
TATCAGCCGAGCATGGATGCGATTCTGAGCGGCGCGCGTGAATTTGTGACCCTGGATATT
CTGCATCGTGAAAACCTGGATTTGGTGCTGCGTGAAAGCGGCATTGATCCGACCAACCAT
GATAGCGGCGAACTGGATGAACTGGCGCGTGCGTGGCATGTGCTGACCCCGTGGCCGGAT
AGCGTGCCGGGCCTGACCGCGATTAAAGCGGAATATATCATTGGCCCGCTGAGCAACGGC
AACACCAGCCTGCTGCTGGATATGGCGAAAAACGCGGGCATTCCGTGGGATGTGATCATT
GGCAGCGATATTAACCGTAAATATAAACCGGATCCGCAGGCGTATCTGCGTACCGCGCAG
GTGCTGGGCCTGCATCCGGGCGAAGTGATGCTGGCGGCGGCGCATAACGGCGATCTGGAA
GCGGCGCATGCGACCGGCCTGGCGACCGCGTTTATCCTGCGTCCGGTGGAACATGGCCCG
CATCAGACCGATGATCTGGCGCCGACCGGCAGCTGGGATATTAGCGCGACCGATATTACCG
ATCTGGCGGCGCAGCTGCGTGCGGGCAGCACCGGCTTTCGT

GC content after optimization: 60.6% (reduced from ~67% in the native Rhodococcus sequence)


3.4 — From DNA to Protein: Production Methods

Once the codon-optimized expression cassette is assembled (Promoter → RBS → ATG → optimized gene → 7×His-tag → STOP → Terminator), the haloacid dehalogenase protein can be produced by two main approaches:

Cell-based (in vivo) — E. coli K-12: The plasmid carrying the expression cassette is transformed into chemically competent E. coli K-12 cells. RNA polymerase recognizes the promoter and transcribes the gene into mRNA. The ribosome binds at the Shine-Dalgarno sequence (RBS), positions itself at the ATG start codon, and translates the mRNA codon-by-codon until the TAA stop codon. The polypeptide folds into the functional enzyme. The 7×His-tag enables purification by nickel-affinity chromatography (Ni-NTA).

Cell-free (in vitro): The plasmid is added directly to a cell-free transcription-translation system (e.g., PURExpress, NEB). The gene is transcribed and translated without any living cell, producing functional protein in a tube. This is faster than cell-based methods, avoids containment concerns for engineered organisms, and is especially useful for early-stage functional testing — directly aligned with the biosafety goals of my PFAS biofilter project.


3.5 — How Does It Work in Biological Systems? (Optional)

How a single gene codes for multiple proteins:

In biological systems, a single gene can give rise to multiple distinct protein products through several mechanisms:

  • Alternative transcription start sites: RNA polymerase can initiate transcription at different promoters, producing transcripts with different 5’ ends and therefore different protein N-termini.
  • Alternative splicing (eukaryotes): The spliceosome can include or exclude different exon combinations, generating multiple mRNA isoforms and protein variants from the same gene. The human DSCAM gene can theoretically produce over 38,000 isoforms this way.
  • Translational frameshifting: In prokaryotes and viruses, the ribosome can slip into a different reading frame, producing a distinct protein from the same mRNA — as seen in the MS2 phage lysis protein discussed in class.
  • Post-translational cleavage: A single polyprotein precursor can be cleaved by proteases into multiple functional subunits.

DNA → RNA → Protein alignment (first 15 codons of Q0SK70):

Every T in DNA becomes U in mRNA during transcription. Each 3-nucleotide codon encodes exactly one amino acid.

DNA:  ATG GCG GGC GTG CCG TTT CGT AGC CCG AGC ACC GGC CGT AAC GTG
mRNA: AUG GCG GGC GUG CCG UUU CGU AGC CCG AGC ACC GGC CGU AAC GUG
AA:    M   A   G   V   P   F   R   S   P   S   T   G   R   N   V
#DNA CodonmRNA CodonAAName
1ATGAUGMMet (Start)
2GCGGCGAAla
3GGCGGCGGly
4GTGGUGVVal
5CCGCCGPPro
6TTTUUUFPhe
7CGTCGURArg
8AGCAGCSSer
9CCGCCGPPro
10AGCAGCSSer
11ACCACCTThr
12GGCGGCGGly
13CGTCGURArg
14AACAACNAsn
15GTGGUGVVal

Full protein N-terminus confirmed: M-A-G-V-P-F-R-S-P-S-T-G-R-N-V-R-A-V-L-F-D… — matches Q0SK70 exactly.


Part 4: Twist DNA Synthesis Order

(Pending — will be submitted after feedback on expression cassette design.)


Part 5: DNA Read / Write / Edit

5.1 — DNA Read

(i) What DNA would I sequence and why?

In the context of my PFAS biofilter project, I would sequence the metagenome of PFAS-contaminated soil and water microbiomes — specifically from sites near industrial discharge zones, firefighting training areas, and agricultural land treated with PFAS-containing biosolids.

The rationale: we currently know very little about which microorganisms naturally perform any degree of PFAS transformation. Shotgun metagenomic sequencing of these communities would reveal novel genes and enzymatic pathways associated with defluorination, without needing to culture every organism individually. This is a “read first, engineer later” strategy — sequencing environmental DNA to discover what biology is already doing, then extracting candidate genes (such as haloacid dehalogenases) for transfer into a safe chassis. This also serves environmental monitoring and biodiversity assessment goals directly relevant to the governance framework in my project proposal.

(ii) Technology: Illumina Short-Read Sequencing (Second-Generation)

Generation: Second-generation (Next-Generation Sequencing, NGS).

Why: For metagenomic samples containing millions of different organisms and genes, Illumina offers the best balance of throughput, accuracy, and cost. It generates billions of 150 bp paired-end reads per run with an error rate of ~0.1% — sufficient for reliable gene identification and annotation across diverse communities.

Input preparation — essential steps:

  1. Environmental DNA extraction from soil/water samples (e.g., Qiagen PowerSoil kit).
  2. Mechanical fragmentation by sonication to ~300–500 bp fragments.
  3. End repair and A-tailing to generate blunt, phosphorylated ends.
  4. Adapter ligation — double-stranded adapters containing primer binding sites and multiplexing indices are ligated to both ends.
  5. Limited-cycle PCR to enrich adapter-ligated fragments.
  6. Library QC by Bioanalyzer to verify fragment size distribution.
  7. Loading onto flow cell for sequencing.

How base calling works (Sequencing by Synthesis, SBS): DNA fragments are loaded onto a glass flow cell and amplified in place by bridge amplification, creating clusters of identical copies. Fluorescently labeled reversible terminator nucleotides are added one at a time. A laser excites the fluorophore on each incorporated base; a camera captures the emission color (A, T, G, or C); the terminator is chemically cleaved; and the next cycle begins. This repeats for every position in the read, decoding the sequence base by base.

Output: FASTQ files containing billions of short reads (150 bp paired-end), each with a per-base Phred quality score. These are assembled or aligned against reference genomes and annotated for gene function.


5.2 — DNA Write

(i) What DNA would I synthesize and why?

The DNA I would synthesize is the full expression cassette for the codon-optimized haloacid dehalogenase (Q0SK70) in E. coli K-12, as designed in Part 3. Beyond this gene, I would also synthesize a complete genetic circuit consisting of:

  • A biosensor module — a fluoride-responsive riboswitch (crcB riboswitch, Rfam: RF01734) that activates gene expression in response to intracellular fluoride ions released during PFAS defluorination.
  • The haloacid dehalogenase downstream of the riboswitch, so enzyme expression is automatically induced when PFAS are present in the bioreactor.
  • A sfGFP reporter as a real-time readout of system activity, detectable by fluorescence under UV.

This complete circuit — sense PFAS → express dehalogenase → report activity — is the minimal viable design for the living biofilter described in my project proposal.

The codon-optimized haloacid dehalogenase sequence is provided in Part 3.3. The crcB riboswitch sequence is publicly available in Rfam (RF01734).

(ii) Technology: Twist Bioscience Clonal Gene Synthesis

Essential steps:

  1. Sequence design and codon optimization — the target sequence is processed to remove secondary structures and avoid restriction sites (BsaI, BsmBI, BbsI).
  2. Computational division into overlapping ~200 bp oligonucleotides.
  3. Silicon chip-based parallel oligo synthesis at high density.
  4. PCR-based assembly of overlapping oligos into the full-length gene.
  5. Cloning into the selected vector backbone (e.g., pTwist Amp High Copy).
  6. Transformation into E. coli and Sanger sequencing verification.

Limitations:

  • Maximum insert length ~5 kb per clonal gene; larger constructs require fragment ordering and in-lab assembly.
  • Highly repetitive sequences or extreme GC content can reduce synthesis success.
  • Turnaround time is typically 2–3 weeks.
  • Per-base cost is low but scales with construct length.

5.3 — DNA Edit

(i) What DNA would I edit and why?

For my PFAS biofilter project, the most valuable editing target is the haloacid dehalogenase gene itself — to engineer improved variants with higher catalytic efficiency toward long-chain perfluorinated PFAS substrates. The native R. jostii enzyme has modest activity on PFAS; directed evolution or rational active-site redesign could produce variants that defluorinate PFAS more rapidly and across a broader range of chain lengths.

A second target is the E. coli K-12 chromosome — specifically, deleting competing non-specific dehalogenases that might generate toxic intermediates, and inserting the biosensor-dehalogenase circuit into a stable chromosomal locus rather than a plasmid, to prevent plasmid loss during long-term bioreactor operation.

(ii) Technology: CRISPR-Cas9

How it edits DNA — essential steps:

  1. gRNA design — a 20-nucleotide spacer sequence is designed to match the target genomic site, adjacent to a PAM sequence (5’-NGG-3’ for SpCas9).
  2. Construct preparation — the gRNA is cloned into a plasmid expressing both the guide and Cas9. A donor DNA template (the desired insert or correction, flanked by ~500 bp homology arms) is also prepared.
  3. Delivery — the Cas9/gRNA plasmid and donor template are co-transformed into E. coli by electroporation.
  4. Cleavage and HDR — Cas9 binds the target via the gRNA and makes a double-strand break. The cell repairs the break by homology-directed repair (HDR) using the donor template, precisely inserting the sequence of interest.
  5. Screening — colonies are screened by colony PCR and confirmed by Sanger sequencing.

Inputs required:

  • Designed 20 nt gRNA sequences
  • Cas9 expression plasmid
  • Donor DNA with homology arms (~500 bp each side)
  • Competent E. coli cells
  • Selectable markers

Limitations:

  • Off-target cuts at sites with partial gRNA complementarity (mitigated by high-fidelity Cas9 variants such as eSpCas9 or HiFi Cas9).
  • HDR efficiency in E. coli is lower than in eukaryotes; lambda Red recombineering is commonly combined with CRISPR to improve efficiency.
  • Multiplexing multiple edits simultaneously increases risk of unintended genomic rearrangements.
  • Delivery remains challenging in organisms without established transformation protocols.