Projects

Final projects:

  • Cholera Shield Engineered Spores for Rapid Cholera Protection **A Engineering SuperBugs for Good! | HTGAA 2026 | Fiona Connolly ** Overview. Cholera kills more than 100,000 people a year, almost entirely in disasters and refugee settings where oral cholera vaccines arrive at least two weeks too late. Cholera Shield engineers Bacillus subtilis 168 to display a bivalent anti-cholera-toxin VHH nanobody — BL3.2 from Petersson et al. 2025 Nature Communications — on the spore coat via a CotB C-terminal fusion. Each spore behaves as a luminal molecular sponge: it transits the stomach intact, reaches the small intestine, and captures cholera toxin (CT) at the GM₁-binding face before the toxin can dock on enterocytes. The product is a foil sachet — under $0.10 per dose, two-plus years stable at ambient temperature, self-administered in any liquid, pre-distributable into emergency stockpiles, deployable within hours of risk onset. The twelve-week proof-of-concept builds and validates the strain through three orthogonal readouts (display, accessibility, neutralisation) at three GO/NO-GO gates.

Subsections of Projects

Individual Final Project:CholeraShield

cover image cover image

Cholera Shield

Engineered Spores for Rapid Cholera Protection

**A Engineering SuperBugs for Good! | HTGAA 2026 | Fiona Connolly **


Overview. Cholera kills more than 100,000 people a year, almost entirely in disasters and refugee settings where oral cholera vaccines arrive at least two weeks too late. Cholera Shield engineers Bacillus subtilis 168 to display a bivalent anti-cholera-toxin VHH nanobody — BL3.2 from Petersson et al. 2025 Nature Communications — on the spore coat via a CotB C-terminal fusion. Each spore behaves as a luminal molecular sponge: it transits the stomach intact, reaches the small intestine, and captures cholera toxin (CT) at the GM₁-binding face before the toxin can dock on enterocytes. The product is a foil sachet — under $0.10 per dose, two-plus years stable at ambient temperature, self-administered in any liquid, pre-distributable into emergency stockpiles, deployable within hours of risk onset. The twelve-week proof-of-concept builds and validates the strain through three orthogonal readouts (display, accessibility, neutralisation) at three GO/NO-GO gates.

The Challenge

Cholera causes 1.3 – 4.0 million cases each year and kills 21,000 – 143,000 people (Ali et al. 2015, PLoS NTD), with more than 95 % of the burden in sub-Saharan Africa and South / South-East Asia. Outbreak mortality still runs at 1 – 3 % where modern oral rehydration is available, and far higher where it isn’t. The disease itself is, in the strictest sense, solved: we understand the toxin, we understand the receptor, oral rehydration alone saves lives, and there are three WHO-prequalified oral cholera vaccines (Dukoral, Shanchol, Euvichol). The problem is not knowledge. The problem is deployment.

Every current intervention is reactive and slow:

PropertyCurrent oral cholera vaccinesCholera Shield
Time from risk onset to protection2 – 4 weeks (2 doses, 14 days apart, ~7 day plateau)Hours (single sachet at risk onset)
Cold chain2 – 8 °C, end-to-endNone
Self-administrationTrained health worker requiredYes, in any liquid
Cost per dose$1.50 – $5.00Target < $0.10 at fermentation scale
Shelf life2 – 3 years at 2 – 8 °C2+ years at ambient temperature
Pre-distribution into stockpilesConstrained by cold chainDesigned for stockpiling

The deployment gap — 4M cases, 100,000+ deaths, ≥14 day vaccine lag, and the Cholera Shield concept The deployment gap — 4M cases, 100,000+ deaths, ≥14 day vaccine lag, and the Cholera Shield concept

The first 72 hours of an outbreak — when contaminated water reaches a refugee camp, when monsoon rains overrun sanitation, when a hurricane displaces a city — is the deadliest window and the one no existing tool can address. Cholera Shield is not a replacement for OCVs. It is the missing first-line pre-emptive countermeasure that buys time until the vaccines, the cold chain, and the trained workers can be mobilised

The deployment gap is a public health crisis. There is no medical countermeasure today that can be mass-distributed within hours of a disaster onset, at near-zero cost, with no cold chain, and no training required.


The Vision

“What if the countermeasure sat on a shelf for two years, cost under a dime, and dropped into water within hours?”

Mechanism — BL3.2-displaying spores capture cholera toxin in the gut lumen before it docks on epithelial cells Mechanism — BL3.2-displaying spores capture cholera toxin in the gut lumen before it docks on epithelial cells

Cholera Shield is an engineered B. subtilis spore that displays anti-cholera-toxin VHH nanobodies on its coat surface. Each spore behaves as a luminal molecular sponge: it transits the stomach intact (spores survive pH 1.2 gastric fluid and 80 °C wet heat for tens of minutes), reaches the small intestine, and captures cholera toxin from the lumen before the toxin can engage GM₁ ganglioside on enterocytes

The result:

  • < $0.10 per dose (fermentation-scale production)
  • 2+ years shelf life at ambient temperature (no cold chain)
  • Self-administered in any liquid (no training needed)
  • Pre-emptive distribution within 24 hours of disaster onset
  • Fills the critical 2–4 week gap before vaccines can be deployed

This is a paradigm shift: from reactive treatment to proactive biological protection.

Target metricCholera Shield designSource / rationale
Cost per dose at scale< $0.10Industrial 3,000-L fed-batch B. subtilis on broad-bean / molasses media: 2 × 10⁹ – 7 × 10⁹ spores/mL pilot data
Shelf life≥ 2 years ambientB. subtilis spore wet-heat tolerance + lyophilisation (Setlow 2006)
Dose10⁹ – 10¹⁰ spores / sachetKnecht 2012 mouse data for mucosal IgA; binding-site mathematics
Cold chainNoneLyophilised spore powder is metabolically dormant
Risk-onset → protectionHoursNo germination required for the surface-displayed paratope to work; capture is immediate as spores transit
Deployment partnersWHO, MSF, UNICEF, IFRCPre-positioned stockpile model

The deliverable is humble in form and ambitious in scope: a single-dose foil sachet of lyophilised spore powder. The user empties it into any drinkable water — tap, river, well, bottle, ORS — drinks the suspension, and the spores do the rest. No refrigeration, no health worker, no training, no syringe. The product is designed from the outset for pre-distribution into WHO emergency stockpiles, MSF country-team kits, UNICEF disaster preparedness, and IFRC supplies. When the rains come or the camp opens, it is already in the field.

The scale of the molecular sponge. Native CotB sits at the ceiling end of B. subtilis spore-coat protein abundance at ~1,500 copies per mature spore (Isticato et al. 2001, J Bacteriol). Realistic CotB-fusion display is conservatively 20 – 70 % of that ceiling — call it 300 – 1,000 paratopes per spore at a realistic build. A 10⁹-spore dose therefore carries 3 × 10¹¹ – 1 × 10¹² VHH binding sites per millilitre of suspension. At the upper bound this is more than enough binding capacity to soak the picomolar-to-nanomolar CT load typical of early cholera infection.

“At 10⁹ spores per mL, that’s 1.5 × 10¹² binding sites per mL — plenty of velcro.”

Why bivalent BL3.2 over the monomer BL3.1. Cholera toxin’s B-subunit is pentameric, with five copies of CTxB arranged in five-fold symmetry around the catalytic A subunit. Each B-pentamer has five GM₁-binding pockets. A bivalent VHH — two BL3.1 paratopes tethered by a flexible (GGGGS)₃ linker — can either (i) engage two adjacent pockets on the same pentamer (intra-pentameric avidity), or (ii) bridge two separate pentamers (inter-pentameric capture). Either mode multiplies functional affinity by orders of magnitude over the monomer. The published IC₅₀ for BL3.2 in a cellular cAMP assay is 1.535 nM — well into the regime where the bivalent meaningfully outperforms the monomer (Petersson 2025).

“CT’s B-subunit is pentameric, so two paratopes on a tether buys avidity.”


How Cholera Toxin Kills—And Where We Intervene

Cholera toxin endocytosis and intracellular trafficking — apical binding, retrograde transport, A-subunit translocation, cAMP / CFTR efflux Cholera toxin endocytosis and intracellular trafficking — apical binding, retrograde transport, A-subunit translocation, cAMP / CFTR efflux

Cholera works through a precise molecular sequence that unfolds as a cascade:

  1. Colonization: Vibrio cholerae attaches to the small intestine via toxin-coregulated pili (TCP)
  2. Toxin secretion: The bacterium releases cholera toxin (CT), an A₅B pentameric protein
  3. Cell bindingWE BLOCK HERE ← The B-pentamer binds GM₁ ganglioside on epithelial cells
  4. Signal hijacking: The A subunit enters the cell and locks adenylyl cyclase in the “on” position
  5. cAMP flood: Massive increases in intracellular cAMP open CFTR chloride channels
  6. Secretory diarrhea: Fluid pours into the intestinal lumen; severe dehydration and death follow within hours

The VHH nanobody targets the GM₁-binding face of the CT B-pentamer—the exact molecular surface where toxin docks onto intestinal cells. By displaying ~1,500 VHH copies per spore (anchored via CotB coat protein fusion), each spore intercepts cholera toxin in the gut lumen upstream of cell contact. We prevent the toxin from ever making contact with the epithelium.

Cholera toxin holotoxin and B-pentamer structure with GM₁ ganglioside chemistry — adapted Cholera toxin holotoxin and B-pentamer structure with GM₁ ganglioside chemistry — adapted

Step 3 is the only step at which a luminal countermeasure can act. Once CT engages GM₁ on an enterocyte, the toxin is committed: it will be internalised, processed, and activate cAMP regardless of what happens in the lumen afterwards. BL3.2’s paratope binds a conformational epitope on CTxB that overlaps the GM₁ binding pocket — residues 29 – 38 and 50 – 66 by HDX-MS mapping (Petersson 2025). The competition is direct, not allosteric; the nanobody and the receptor compete for the same molecular surface.

This is what makes the surface-display strategy work. We do not need to enter cells. We do not need our spore to germinate. We do not need any subsequent biological event. The paratope on the spore coat is functional from the moment the spore enters the small intestine — within ~3 hours of swallowing the sachet, based on transit-time studies in healthy adults (Davis et al. 1986; corroborated by the DE111 spore-probiotic RCT, Frontiers in Microbiology 2021, which detected viable B. subtilis spores in the small intestine within the same window).


The Biology

What Is a VHH Nanobody?

A VHH (Variable domain of Heavy-chain-only antibody) is a single-domain antibody derived from camelid immunoglobulins. Unlike conventional antibodies (which are ~150 kDa, Y-shaped, and made of four chains), VHHs are remarkably simple: just one polypeptide chain, ~15 kDa, with three complementarity-determining regions (CDRs) that form the antigen-binding site.

The anti-cholera toxin VHH (BL3.1) used in this project was identified by Petersson et al. (2025) through phage display and has a binding affinity (Kd) of approximately 77 nM for cholera toxin B-pentamer—strong enough for rapid capture in the harsh, competitive environment of the gut lumen.

Why Bacillus subtilis Spores?

B. subtilis is an ideal chassis:

  • Spore coat is naturally robust: Sporulation generates dormant cells with multiple protein layers (coat, cortex, outer membrane) that resist heat, desiccation, and chemical stress
  • CotB is abundant: ~1,500 copies per mature spore; we hijack this to display the VHH
  • Spores are shelf-stable: Lyophilized spores last 2+ years at room temperature with minimal metabolic activity
  • Safe for gut delivery: B. subtilis is non-pathogenic, naturally found in soil, and approved for food/probiotic use
  • Genetic tractability: Natural competence transformation, well-characterized promoters, and validated integration sites (amyE locus) make engineering straightforward

The DNA Design

Integration Cassette Overview

The construct is a ~5.1 kb integration cassette assembled via 5-fragment Gibson Assembly and integrated into the B. subtilis 168 chromosome at the amyE locus (BSU22940, α-amylase gene) via double-crossover homologous recombination. The amyE locus is non-essential and provides a validated integration site with decades of precedent in B. subtilis genetic engineering.

The Five Fragments

FragmentElementSizeSourceGC%
1amyE 5′ homology arm~1,000 bpPCR from B. subtilis 168 gDNA43%
2P-cotB + CotB ORF (no stop)~1,428 bpPCR from B. subtilis 168 gDNA
3Linker + VHH + His + Term548 bpTwist Bioscience (verified)49.8%
3’GFP Control (sfGFP variant)881 bpTwist Bioscience (verified)44.4%
4Spectinomycin resistance (aad9)~1,200 bpPCR from pDG1726 plasmid
5amyE 3′ homology arm~1,000 bpPCR from B. subtilis 168 gDNA43%

Critical design choices:

  • No stop codon on CotB: The CotB ORF terminates without TAA/TGA/TGG, allowing in-frame read-through into the linker and VHH. This is essential for the fusion to maintain a single open reading frame under the native P-cotB promoter.
    • N-terminal linker (CotB → VHH). Single GGGGS (5 aa) — preserved from the Petersson 2025 published design. Five amino acids gives ~1 nm of flexible spacing between CotB and the paratope. The short-linker choice is deliberate: it matches the published-paper construct exactly and keeps the cargo compact.
  • (GGGGS)₃ linker: Three repeats of the Gly-Gly-Gly-Gly-Ser motif (~1.5 kDa) provide ~3 nm of flexible spacing between CotB and VHH. This prevents steric occlusion of the VHH paratope by the crowded spore coat surface and allows full rotational freedom for CT binding.
  • 6xHis tag: Enables detection and quantification via anti-His antibodies (immunofluorescence, Western blot, ELISA). Allows Ni-NTA purification of purified VHH-His₆ protein as positive control.
  • spoVG terminator: Bidirectional rho-independent terminator prevents read-through and transcriptional interference with downstream genes.
  • Spectinomycin resistance (aad9): Selection marker from Tn554 with its own promoter; allows selection on LB + spectinomycin (100 µg/mL). Does not interfere with sporulation.
    • amyE integration. Loss of α-amylase is screened on starch-iodine plates — colonies with successful double-crossover give no halo.

VHH Anti-CTB Sequence (Verified BL3.1)

Source: Petersson et al. (2025) Nature Communications 16:2722. VHH domain BL3.1 targeting the cholera toxin B-pentamer GM1-binding face, Kd ~77 nM.

Amino acid sequence (127 aa, representative framework shown):

QVQLVESGGGLVQAGGSLRLSCAASGRTFSNYAMGWFRQAPGKEREFVAAISRSGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADRPGYCSGTRCTPFDYDYWGQGTQVTVSS

[FR1: 1-25] [CDR1: 26-35] [FR2: 36-49] [CDR2: 50-58] [FR3: 59-96] [CDR3: 97-116] [FR4: 117-127]

Codon-optimized DNA sequence (381 bp, for B. subtilis 168):

CAGGTTCAAT TGGTAGAGAG CGGTGGCGGT TTGGTCCAAG CTGGAGGCTC CCTTAGATTA
AGCTGCGCCG CTAGCGGCCG TACTTTCTCG AACTACGCAA TGGGCTGGTT CCGACAGGCA
CCAGGTAAAG AACGTGAATT TGTTGCAGCC ATTTCCCGTA GCGGAGGATC TACATATTAT
GCGGACTCAG TAAAGGGACG TTTTACCATT TCCAGGGACA ATGCAAAAAA CACCGTTTAT
CTTCAAATGA ACTCATTGAA GCCAGAAGAT ACTGCAGTGT ACTATTGTGC GGCAGACAGA
CCTGGATACT GCTCCGGAAC TCGCTGCACG CCGTTTGATT ATGACTACTG GGGACAGGGT
ACACAAGTGA CAGTTTCCTC T

Optimization parameters: Codon usage weighted toward highly expressed B. subtilis genes (CAI-optimized). Rare codons eliminated (CGA, CGG, AGG, CCC, ATA, CTA). GC content: 49.8% (optimal range 40–50% for B. subtilis). Internal Shine-Dalgarno sequences removed.

Expressed Fusion Protein

The construct encodes a ~55 kDa fusion protein displayed on the spore coat:

N—[CotB (372 aa, ~41 kDa, embedded in coat)]
  —[(GGGGS)₃ linker (15 aa, ~1.5 kDa, flexible spacer)]
  —[VHH-CTB (127 aa, ~14 kDa, surface-exposed domain)]
  —[His₆ tag (6 aa, <1 kDa)]—C

Display density: Each B. subtilis spore carries approximately ~1,500 copies of the CotB-VHH fusion (based on published CotB copy number). This creates a high-density “nanobody carpet” on the spore surface—a molecular sponge capable of capturing multiple cholera toxin molecules simultaneously. At 1,500 copies/spore × 10⁹ spores/mL = 1.5 × 10¹² VHH binding sites per milliliter of spore suspension.


4.2 Affinity, avidity, stability — what the numbers say

ConstructAssayKD / IC₅₀Source
BL3.1 monomerBLI (BL3.1 as ligand)KD ≈ 0.76 nMPetersson 2025, Fig. 2
BL3.1 monomerSPR (CTxB as ligand)KD ≈ 85 nMPetersson 2025, Fig. 2
BL3.2 bivalentcAMP cellular assayIC₅₀ ≈ 1.535 nMPetersson 2025, Fig. 3
BL3.2 bivalentDSF thermal stabilityTm = 72 °CPetersson 2025
BL3.2 bivalentSimulated gastric fluid (pH 1.2)No loss of CTxB binding after 4 h, 37 °CPetersson 2025
BL3.2 bivalentSimulated intestinal fluid (pH 6.8)No loss of CTxB binding after 5 h, 37 °CPetersson 2025
In vivo · BL3.2 oral5-day-old CD-1 mice, 2.8 × 10⁸ CFU orogastric V. cholerae~10-fold reduction in CFU (1.6 × 10⁸ vs 1.8 × 10⁹; P = 0.0022)Petersson 2025, Fig. 4

The Experimental Approach

Three CotB-fusion cargo variants — BL3.1 monovalent, BL3.2 bivalent (primary), sfGFP control Three CotB-fusion cargo variants — BL3.1 monovalent, BL3.2 bivalent (primary), sfGFP control

Three strains are built in parallel from the same backbone:

  • 3A · BL3.1 monovalent — the lower-risk parallel PoC. Single paratope, simpler fold, clean codon-optimised Twist insert that translates as expected. The published BL3.1 KD of 0.76 nM (BLI) means the paratope itself is potent even without bivalent avidity, but at realistic per-spore copy number the bivalent gives a critical edge in the dose-response regime.
  • 3B · BL3.2 bivalent — the primary lead. Two BL3.1 paratopes on a (GGGGS)₃ tether; avidity-driven IC₅₀ in the low-nM range. The v4 insert (879 bp, verified by programmatic translation) is ready for Twist submission.
  • 3C · sfGFP control — the negative-binding control. Superfolder GFP (Pédelacq et al. 2006, Nat Biotechnol) is a robust, well-characterised display reporter. Direct 488 / 510 nm fluorescence on intact spores confirms the cassette is being integrated and the cargo is reaching the coat; sfGFP has no CT-binding activity so it isolates non-specific CT adsorption from VHH-specific capture.

Four-Step Synthetic Biology Workflow

1. DesignCompleted

  • ✓ Verified anti-cholera toxin VHH sequence (BL3.1) from Petersson et al. (2025)
  • ✓ Codon-optimized for B. subtilis 168 (CAI-weighted, no rare codons)
  • ✓ Designed 5-fragment Gibson Assembly cassette with 30 bp overlaps
  • ✓ Specified all PCR primer sequences with Tm, GC%, and overlap tails

· The experimental plan

Build · sporulate · capture — schematic workflow from cassette assembly to functional display Build · sporulate · capture — schematic workflow from cassette assembly to functional display

2. Synthesize In Progress

  • Pending: Two synthetic fragments from Twist Bioscience:

    • CS-VHH-CTB-v1 (548 bp): (GGGGS)₃ linker + codon-optimized VHH (381 bp) + His tag + TAA stop + spoVG terminator
    • CS-GFP-CTRL-v1 (881 bp): Identical architecture with sfGFP (superfolder GFP, 239 aa, 26.8 kDa) replacing VHH
    • Estimated cost: ~$100–130 total (Twist standard pricing as of 2026)
    • Turnaround: ~5–8 business days
  • PCR primers (8 total, standard desalted, 25 nmol scale):

PrimerSequence (5’→3')Tm (°C)GC%Notes
amyE5-FTTTCGATACAATATTTTTCATATTTTC5433Fragment 1 forward
amyE5-R_OL-PcotBAATTTGATACAATATTTTTCATATTTTCACTGATAAAGAC GGTTTTGCACCGAAATTAA5842Fragment 1 reverse; 30 bp overlap to PcotB
PcotB-F_OL-amyE5TTAATTTCGGTGCAAAACCCGTCTTTAGC AGATACGATTGATGAAATTCAA6048Fragment 2 forward; 30 bp overlap from amyE5
CotB-R_noStopATTAAATCACTGTATAAAGT CTTCGAGAAAGGTA5645Fragment 2 reverse; no Gibson tail (overlap in Twist synthetic)
SpecR-FGGTGCAAAACCCGTCTTTAGCAGATACGATT GATGAAATTCAAA5850Fragment 4 forward; 30 bp overlap from CotB-VHH junction
SpecR-R_OL-amyE3AATAAAAAAGCTAGCTCTACCAATTATCT TGATGATGAAACAG5640Fragment 4 reverse; 30 bp overlap to amyE3
amyE3-F_OL-SpecRCCTGTTTCATCATCAAGATAATTGGTAG AGCTAGCTTTTTATT5845Fragment 5 forward; 30 bp overlap from SpecR
amyE3-RTGATGAAATTCAAAGAGATGGC5245Fragment 5 reverse
  • Templates for PCR:
    • B. subtilis 168 genomic DNA (Qiagen DNeasy or phenol-chloroform extraction; A₂₆₀/A₂₈₀ > 1.8)
    • pDG1726 plasmid (for SpecR cassette; available from BGSC or lab stocks)

3. Build Will execute

PCR Amplification Protocol (all fragments)

  • Enzyme: Q5 High-Fidelity DNA Polymerase (NEB M0491)

  • Reaction setup (25 µL):

    • 5 µL Q5 reaction buffer (5×)
    • 0.5 µL dNTPs (10 mM each)
    • 1.25 µL forward primer (10 µM)
    • 1.25 µL reverse primer (10 µM)
    • 50–100 ng template DNA
    • 0.125 µL Q5 polymerase
    • H₂O to 25 µL
  • Thermocycling:

    98°C      30 sec        [Initial denaturation]
    ├─ 98°C   10 sec        
    ├─ 58°C   20 sec        × 30 cycles
    ├─ 72°C   30 sec/kb     [~30 sec for 1 kb, ~45 sec for 1.4 kb]
    72°C      5 min         [Final extension]
  • Verification: Run 5 µL of each PCR product on 0.8% agarose gel. Expected band sizes:

    • Fragment 1: ~1,000 bp
    • Fragment 2: ~1,428 bp
    • Fragment 4: ~1,200 bp
    • Fragment 5: ~1,000 bp
  • Gel purification: Extract bands using gel extraction kit (Qiagen MinElute or equivalent). Quantify by Nanodrop (A₂₆₀/A₂₈₀ > 1.7).

5-Fragment Gibson Assembly

  • Reaction setup (20 µL total):

    • Equimolar amounts of 5 fragments (50–100 ng of largest, scale others proportionally)
    • 10 µL NEB HiFi DNA Assembly Master Mix (2×)
    • Fragments + H₂O to 20 µL total
  • Conditions: 50°C for 60 minutes (5-fragment assemblies benefit from full hour incubation)

  • Transformation into E. coli DH5α:

    • Add 5 µL Gibson product to 50 µL NEB 5-alpha competent cells
    • Heat shock: 30 sec at 42°C; 2 min on ice
    • Add 950 µL SOC medium; shake 1 hour at 37°C
    • Plate 100 µL on LB + spectinomycin (50 µg/mL)
    • Incubate overnight at 37°C
  • Colony screening:

    • Pick 4–8 colonies; touch to 20 µL PCR master mix
    • Colony PCR with junction-spanning primers (expect ~50 bp increase in band size)
    • ~30–60% correct clones is typical after Gibson Assembly
  • Verification:

    • Miniprep positive clones (Qiagen QIAprep)
    • Sanger sequence across all four Gibson junctions and the entire VHH ORF (CDR1, CDR2, CDR3 regions critical)
    • Archive sequence-verified clone at -80°C

4. Test Will execute

  • B. subtilis 168 Natural Competence Transformation:

    • Grow B. subtilis 168 in modified competence medium (MC) to late log (OD₆₀₀ ~1.5)
    • Dilute 1:10 into starvation medium (SM); incubate 37°C, 200 rpm for 2 hours
    • Add 1–5 µg linearized cassette DNA; incubate 37°C, 200 rpm for 30 minutes
    • Plate on LB + spectinomycin (100 µg/mL); incubate overnight at 37°C
  • Integration verification:

    • Starch plate assay: Replica plate on starch-containing plates. Successful integrants show no clearing halo (amyE disrupted = no amylase activity)
    • Colony PCR: Confirm integration junctions by PCR spanning cassette 5’ and 3’ boundaries
    • Sanger sequencing: Verify integration points and absence of off-target mutations
  • Sporulation induction:

    • Inoculate positive B. subtilis clones into Difco Sporulation Medium (DSM)
    • Incubate 37°C, 200 rpm, for 48–72 hours (monitor by phase-contrast microscopy for refractile spores)
    • Heat-treat at 80°C for 20 minutes to kill vegetative cells
    • Wash 3× in phosphate-buffered saline (PBS)
    • Enumerate by serial dilution and CFU plating on LB
    • Prepare spore stocks at 10⁹–10¹⁰ CFU/mL; store at 4°C (short-term) and -20°C (long-term)
  • Verify surface display via immunofluorescence, anti-His dot blot, and Western blot (see Validation Strategy below)

  • Quantify cholera toxin neutralization using GM1-ELISA binding inhibition assay (see Validation Strategy below)


Validation Strategy: Multi-Method Surface Display & CT Binding

The proof-of-concept requires three independent validations: (1) surface display of VHH on spore coat, (2) VHH is surface-accessible, (3) functional toxin capture and neutralization.

Validation Method 1: Surface Display — Immunofluorescence Microscopy

Objective: Confirm that VHH-His₆ tag is displayed on the intact (non-permeabilized) spore surface.

Protocol:

  • Fix VHH spores, GFP spores, and wild-type 168 spores (10⁸ CFU each) in 4% paraformaldehyde for 15 min
  • Wash 3× in PBS
  • Block with 5% goat serum in PBS, 30 min at room temperature
  • Incubate with anti-His-HRP antibody (Thermo Fisher MA1-21315, 1:1000 dilution) or anti-His-Alexa488 (fluorescent detection)
  • Wash 3× in PBS
  • Mount on glass slides; image by fluorescence microscopy (Alexa488 excitation 488 nm, emission 520 nm)

Expected result:

  • VHH spores: strong surface fluorescence
  • GFP spores: no anti-His signal; direct GFP fluorescence confirms coat incorporation of the construct
  • Wild-type 168 spores: no signal (negative control)

Success criterion: ≥10% of VHH spores show surface-localized fluorescence.

Validation Method 2: Surface Display — Western Blot (Coat Extract)

Objective: Detect the ~55 kDa CotB-VHH fusion protein in spore coat preparations.

Protocol:

  • Prepare spore coat extract: Incubate spores (10¹⁰ CFU) in extraction buffer (50 mM Tris pH 8, 0.5 M NaCl, 1% Triton X-100) at 37°C for 30 min
  • Centrifuge at 10,000 × g; collect supernatant (soluble coat proteins)
  • Run 20 µg protein on 12% SDS-PAGE gel with dithiothreitol (DTT) reducing conditions
  • Transfer to PVDF membrane
  • Probe with anti-His-HRP (Thermo Fisher, 1:2000)
  • Detect with chemiluminescent substrate (ECL)

Expected result:

  • VHH spores: single band at ~55 kDa (CotB-linker-VHH-His)
  • GFP spores: single band at ~68 kDa (CotB-linker-sfGFP-His)
  • Wild-type 168 spores: no band

Success criterion: Clear, single band at expected molecular weight with no significant degradation.

Validation Method 3: Surface Accessibility — Trypsin Digestion

Objective: Confirm that the VHH domain is accessible to proteolytic cleavage (indicating surface location).

Protocol:

  • Incubate intact spores (10⁹ CFU) with trypsin (10 µg/mL, Sigma T8642) in PBS at 37°C for 0, 15, 30, 60 minutes
  • Add EDTA (5 mM final) to inhibit trypsin
  • Wash spores 3× in PBS; lyse by sonication
  • Run lysates on SDS-PAGE; probe with anti-His-HRP as above

Expected result:

  • Time-dependent degradation of the ~55 kDa band in VHH spores (accessible epitope)
  • GFP spores: variable degradation (GFP may be more resistant to proteolysis)
  • Wild-type spores: no band (no target protein)

Interpretation: Trypsin sensitivity indicates the fusion protein is accessible on the surface (not buried in the coat).

Validation Method 4: CT Binding Inhibition Assay (Primary Functional Readout)

The key proof-of-concept is demonstrating that VHH spores specifically capture and neutralize cholera toxin.

Assay principle:

VHH spores + Cholera toxin  →  (37°C, 1 hour)  →
Incubate to allow VHH–CT binding

Pellet spores (+ captured CT)  →  Centrifuge  →
Separate bound toxin from supernatant

GM1-coated surface  →  Apply supernatant + CTB-HRP  →
Measure remaining (unbound) cholera toxin

Result: Reduced CT binding = More toxin captured by spores

Detailed protocol:

  • Spore stocks: Prepare serial 10-fold dilutions (10⁸, 10⁹, 10¹⁰ CFU/mL) in PBS
  • Cholera toxin: Use recombinant or commercially available CTB-HRP conjugate (Sigma C4672, 1 µg/mL final)
  • Pre-incubation: Mix VHH spores (or GFP control or WT spores) with CTB-HRP in PBS, 37°C for 1 hour with gentle shaking
  • Separation: Centrifuge 10 min at 10,000 × g; transfer supernatant to fresh tubes (unbound toxin)
  • Detection via GM1 dot blot:
    • Spot 2 µL of supernatant onto nitrocellulose membrane
    • Block with 5% non-fat milk in TBS-T for 30 min
    • Incubate with anti-CTB primary antibody (or use CTB-HRP directly if used above) for 1 hour
    • Detect with HRP secondary + chemiluminescent substrate
  • Quantification: Densitometry of dot intensity; calculate % toxin binding vs. no-spore control

Controls:

  • No spore control: CT in PBS only (100% binding, baseline)
  • CotB-sfGFP spores (negative control for specificity): Should show <10% inhibition
  • Wild-type B. subtilis 168 spores (baseline): Should show ~0% inhibition
  • Purified VHH-His₆ protein (positive control): Recombinantly expressed VHH from E. coli should show near-complete inhibition at stoichiometric ratios

Dose-response analysis:

  • Run assay at spore concentrations: 10⁸, 10⁹, 10¹⁰ CFU/mL (and 2–4 intermediate dilutions if possible)
  • Plot % CT-binding inhibition vs. spore concentration
  • Calculate IC₅₀ (spore concentration required for 50% CT neutralization)

7.4 Expected dose-response shape

Expected % CT inhibition vs spore concentration — BL3.1 monovalent, BL3.2 bivalent, sfGFP and WT controls, with Gate 3 thresholds Expected % CT inhibition vs spore concentration — BL3.1 monovalent, BL3.2 bivalent, sfGFP and WT controls, with Gate 3 thresholds

The schematic above is a prediction, not data. It defines what success looks like in the dose-response plane:

  • WT and sfGFP controls stay flat at the ~5 – 8 % non-specific baseline.
  • BL3.1 monovalent rises sigmoidally with IC₅₀ in the 5 × 10⁹ – 1 × 10¹⁰ CFU/mL band — driven by single-paratope binding and limited spore-surface valency.
  • BL3.2 bivalent shifts one log to the left, with IC₅₀ in the 5 × 10⁸ – 1 × 10⁹ CFU/mL band — driven by intra- and inter-pentameric avidity.
  • Purified BL3.2-His₆ functions as a soluble-protein positive control, defining the maximum achievable inhibition (typically > 95 %).

Success Metrics

CriterionMinimum (Pass)Target (Goal)Stretch (Exceptional)
Surface display (immunofluorescence)≥10% spores positive≥50% spores positive≥80% spores positive
Western blot (55 kDa band presence)✓ Visible bandStrong, single bandStrong, no degradation
Trypsin accessibilityDetectable degradationTime-dependent lossComplete degradation by 60 min
CT binding inhibition at 10⁹ spores/mL>25%>50%>75%
IC₅₀ calculationCalculable<5 × 10⁸ CFU/mL

Gate 2 (Week 8) Criteria: All four methods show positive results indicating surface display is confirmed. Proceed to functional CT binding assay.


12-Week Proof-of-Concept Timeline

12-week timeline with three GO/NO-GO gates at Wk 4, Wk 8, Wk 12

PhaseWeeksKey MilestonesGate CriteriaDecision
Pre-Lab & Design1–2Verify BL3.1 VHH · Codon optimize · Design cassette · Order Twist fragments & PCR primers
PCR & Assembly2–3Extract B. subtilis gDNA · PCR amplify fragments 1, 2, 4, 5 · Receive Twist fragments · 5-fragment Gibson Assembly
E. coli Cloning3–4Transform E. coli DH5α · Pick 4–8 colonies · Colony PCR screening · Miniprep · Sanger sequencingGate 1 (Wk 4): ≥1 correct clone for VHH cassette. All 4 Gibson junctions correct. Full VHH ORF verified (CDR1/2/3 regions critical). Same for GFP control.GO: Proceed to B. subtilis transformation
NO-GO: Troubleshoot assembly/cloning
B. subtilis Integration5–7Prepare competent B. subtilis 168 · Transform with linearized cassettes · Select on spectinomycin · Verify by amyE starch plate halo · Confirm by colony PCR
Sporulation & Display6–8Inoculate positive integrants into DSM · Induce sporulation (48–72 hours) · Heat-treat 80°C to purify sporesGate 2 (Wk 8): ≥10% spores positive by anti-His immunofluorescence. Western blot shows crisp ~55 kDa band. Trypsin sensitivity confirmed. GFP spores show direct fluorescence. WT spores negative.GO: Proceed to CT binding assay
NO-GO: Troubleshoot fusion/expression
Functional Validation9–10Set up GM1-ELISA / dot blot assay · Pre-incubate VHH spores + CT · Run dose-response (10⁸–10¹⁰ CFU/mL) · Run controls (GFP spores, WT spores, purified VHH)
Data Analysis11–12Quantify % CT inhibition · Calculate IC₅₀ · Statistical analysis (ANOVA) · Prepare figures & datasetGate 3 (Wk 12): Minimum: >25% inhibition at 10⁹ spores/mL (Aim 1 success). Target: >50% inhibition. Stretch: >75% inhibition with calculable IC₅₀. Negative controls (GFP, WT) show <10% inhibition.GO: Project complete, Aim 1 achieved
NO-GO: Troubleshoot assay/repeat

Decision Gate Philosophy: Three rigorous checkpoints ensure that only validated results advance to the next phase, saving time and resources by catching problems early.


Project Aims

Aim 1: Experimental (This Project)

Build and Test the CotB-VHH Spore

Engineer B. subtilis 168 to display anti-CTB VHH on the spore coat via CotB N-terminal fusion. Validate surface display through immunofluorescence and Western blot. Quantify cholera toxin-binding inhibition in vitro using a competitive GM1-ELISA assay. Demonstrate >25% CT neutralization at 10⁹ spores/mL (success), targeting >50% (goal) or >75% (stretch) inhibition.

Deliverables: Sequence-verified B. subtilis strain · Sporulation protocol · Binding inhibition data with dose-response curves


Aim 2: Development (Future Work)

Add Three More Anti-Cholera Modules

Expand the platform to a 4-module system:

  1. Colonization blocker (TCP adhesin inhibitor) — prevents initial attachment
  2. Quorum quencher (AiiA lactonase) — degrades cholera autoinducer signals
  3. Bacteriocin (subtilosin A) — direct bacterial killing

Validate this multi-layered defense in a in vitro intestinal epithelial model and proceed to murine cholera challenge studies (lethal dose, survival curves, intestinal pathology).


Aim 3: Visionary

Deployable Prophylactic at Scale

Translate the 4-module spore into a manufacturable product: foil sachets containing lyophilized spores, packaged at <$0.10 per dose, with 2+ year shelf life at room temperature. Establish partnerships with WHO, Médecins Sans Frontières (MSF), and UNICEF to position the product for rapid deployment within 24 hours of outbreak declaration in endemic regions.

Create a paradigm shift in public health: from post-infection treatment to pre-emptive biological protection.



The GFP Control Construct

A critical control strain parallels the VHH construct: identical cassette architecture with sfGFP (superfolder GFP) replacing the VHH coding sequence.

CS-GFP-CTRL-v1 Specifications:

  • Size: 881 bp (codon-optimized for B. subtilis)
  • GC content: 44.4%
  • Components: (GGGGS)₃ linker → sfGFP (239 aa, 26.8 kDa, engineered for robust folding) → 6xHis tag → TAA stop → spoVG terminator
  • Properties: GFP has excitation at 485 nm and emission at 510 nm; folds correctly in the harsh spore coat environment; is protease-resistant

Why it’s essential:

  1. Surface display validation: GFP fluorescence on intact spores directly confirms the C-terminal construct is coat-incorporated and surface-accessible
  2. Non-specific binding control: CotB-GFP spores provide a negative control for CT-binding assays—any reduction in CT binding with GFP spores indicates non-specific CT adsorption (background) rather than VHH-specific capture
  3. Assembly validation: Same Gibson Assembly strategy and overlaps as VHH strain; if GFP works but VHH fails, the problem is VHH-specific (folding, toxicity) not the assembly platform
  4. Experimental control: GFP-positive spores provide baseline fluorescence and coat assembly validation

Both VHH and GFP constructs are ordered from Twist Bioscience simultaneously.


Project Aims

Aim 1: Experimental (This Project) — Build & Test the CotB-VHH Spore

Hypothesis: B. subtilis 168 spores displaying VHH nanobodies targeting the cholera toxin B-pentamer GM1-binding face will neutralize cholera toxin in vitro in a quantifiable, dose-dependent manner.

Specific objectives:

  1. Design and synthesize a codon-optimized CotB-VHH integration cassette (verified BL3.1 sequence)
  2. Assemble via 5-fragment Gibson Assembly and integrate into B. subtilis 168 chromosome at amyE locus
  3. Validate surface display via immunofluorescence, anti-His dot blot, Western blot, and trypsin accessibility
  4. Quantify cholera toxin neutralization via GM1-ELISA binding inhibition assay with dose-response curves

Success criteria:

  • Gate 1 (Wk 4): ≥1 sequence-perfect clone with correct junctions and full VHH ORF
  • Gate 2 (Wk 8): ≥10% spores show surface His-tag fluorescence; Western blot shows ~55 kDa band; trypsin sensitivity confirmed
  • Gate 3 (Wk 12):
    • Minimum (Aim 1 success): >25% CT-binding inhibition at 10⁹ spores/mL
    • Target (Aim 1 goal): >50% inhibition
    • Stretch (exceptional): >75% inhibition with calculable IC₅₀ < 5 × 10⁸ CFU/mL

Deliverables:

  • Sequence-verified B. subtilis 168 strains (VHH and GFP control)
  • Optimized sporulation and spore purification protocol
  • Validated surface display via multiple orthogonal methods
  • Functional CT-binding inhibition data with statistical analysis and dose-response curves

Aim 2: Development (Future Work) — 4-Module Anti-Cholera Platform

Objective: Expand beyond the single VHH module to a multi-layered defense system that targets distinct steps of cholera pathogenesis.

Four modules:

  1. Toxin neutralization (VHH anti-CTB, Module 1 — this project)
  2. Colonization blocker (competitive adhesins blocking V. cholerae TCP pili attachment to intestinal cells)
  3. Quorum quencher (AiiA lactonase degrading autoinducer signals to suppress virulence gene expression)
  4. Bacteriocin (subtilosin A biosynthetic cluster for direct bactericidal activity against V. cholerae post-spore germination)

Integration strategy: Each module integrated at a separate neutral chromosomal locus (thrC, lacA, etc.) using orthogonal antibiotic selection markers.

Validation pathway:

  • In vitro intestinal epithelial model testing (V. cholerae + multi-module spores)
  • Murine infant cholera model (Vibrio cholerae O1 El Tor oral challenge, ≥10⁵ CFU)
    • Readouts: fluid accumulation, bacterial colonization, intestinal pathology, survival curves

Aim 3: Visionary — Deployable Prophylactic at Scale

The visionary aim: turn Cholera Shield into a manufactureable, deployable humanitarian countermeasure that fills the 2 – 4 week gap between outbreak declaration and OCV protection.

The product. Lyophilised B. subtilis spore powder in single-dose foil sachets — ~1 g, 10⁹ – 10¹⁰ CFU each, ≥ 2-year shelf life, reconstitute in ~250 mL of any drinkable water.

Manufacturing economics. Industrial B. subtilis fermentation is mature: 3,000-L fed-batch on broad-bean / molasses media reaches 2 – 7 × 10⁹ spores/mL, yielding ~15 million doses per batch at 10⁹ CFU/dose. Raw-material fermentation cost ≈ $0.005 – $0.015 / dose at this scale [author estimate]. Landed cost-of-goods is 3 – 10× the fermentation cost once lyophilisation ($0.05/dose), foil-sachet fill-finish ($0.02), CMC overhead, and per-dose regulatory amortisation are included — realistic mature-product CoG $0.05 – $0.15 / dose, comfortably near the < $0.10 target. Early Phase 1/2 product is several dollars per dose; the < $0.10 number is a mature-scale target.

Two-track regulatory strategy.

TrackProductPathwayTimeline
A · fastLyophilised cell-free BL3.2-His₆ + ORS sachetUS 21 CFR 600 / FDA biologics; EMA biologics. Lower regulatory burden than an LBP but still subject to CMC + Phase-I safety.2 – 3 yr to clinical
B · fullEngineered spore as Live Biotherapeutic ProductUS 21 CFR 312 (IND), CBER oversight, BLA. WHO EUL for engineered LBPs is uncharted territory; treat as 7 – 10 yr ambition. Precedent: Synlogic SYNB1934/SYNB1353 (Fast Track).5 – 8 yr to safety; 7 – 10 yr to EUL

Track A protects the deployment timeline; Track B is the long-term platform play.

Deployment model. Pre-positioned stockpiles — WHO Strategic Stockpile, MSF country kits, UNICEF disaster preparedness, IFRC national-society supplies. Distribution within 24 hours of outbreak declaration. Self-administered alongside chlorine tablets and ORS in standard cholera-response kits.

Broader impact: Platform extensibility to other AB₅ toxins (ETEC heat-labile toxin, Shiga toxin); paradigm shift from reactive treatment to pre-emptive biological protection; equity-centered design for global populations at greatest risk.


Platform extension potential

“The anchor is generic. The linker is generic. Only the binder changes per project.”

The Cholera Shield architecture — CotB anchor, GGGGS linker, paratope, His tag, amyE integration, SpecR selection — is paratope-agnostic. Swap the VHH for a different binder and the chassis targets a different pathogen. Candidate next targets:

  • ETEC heat-labile toxin (LT) — highest-value bridge market. CTxB and LTxB share ~80 % sequence identity but distinct conformational epitopes; Petersson 2025 did not test BL3.2 for LTxB cross-reactivity, so a cross-reactive anti-LT/CT VHH would have to be selected anew. Travellers’ diarrhoea is a $1 B+ annual market with no good prophylactic.
  • Shiga toxin (STEC, Shigella) — AB₅ architecture, different receptor (Gb3 vs GM₁); requires its own VHH library.
  • Norovirus capsid — published camelid VHHs exist; cruise-ship and care-home outbreak control.
  • C. difficile TcdA / TcdB — published anti-TcdA/B VHHs; hospital-acquired infection control. The chassis becomes a universal water-safety enhancer — a library of paratopes, one platform, one manufacturing pipeline, swap-in flexibility for whatever target the field demands.

Ethics & Biosecurity Considerations

Biosecurity Screening

All synthetic DNA sequences could been submitted to SecureDNA (https://www.securedna.org) for biosecurity screening to ensure no overlap with select agents, toxin genes, or pathogenic sequences. The VHH coding sequence and linker sequences contain no known off-target homologies to dangerous pathogens.

Safety & Regulatory Framework

B. subtilis 168 is a non-pathogenic model organism with GRAS (Generally Regarded As Safe) status from the FDA. It does not colonize the human GI tract — spores transit through the system within 24–72 hours and do not establish persistent populations. This design feature is intentional: the spore is a temporary, self-limiting biological delivery vehicle, not a colonizing therapeutic.

Genetic Safeguards (Future Implementation)

For any clinical-stage strain, we recommend:

  1. Genetic kill-switch: Auxotrophic dependency (e.g., requirement for synthetic amino acid not present in environment) to prevent environmental persistence
  2. Antibiotic resistance removal: Spectinomycin resistance marker flanked by recombinase sites (loxP, FRT) for excision in late development
  3. Sequence verification: All DNA designs deposited in public registries (NCBI, Benchling) to enable peer review and reproducibility

Deployment of engineered organisms in humanitarian settings requires explicit informed consent from recipients. Communities must be transparently informed that the product contains engineered B. subtilis spores and given the opportunity to opt in or out. This is both an ethical requirement and good public health practice.


9 · Risk Analysis of limitations

#RiskProbabilitySeverityMitigation
1CotB-BL3.2 fusion fails to fold / display (54 kDa cargo larger than Isticato 2001 benchmarks)40 %CRITICALPre-integration transient expression test on a plasmid before genomic integration ($300). If display fails, swap to truncated CotB (C-terminal 300 aa anchor) or CotC/CotG anchor.
2v3 BL3.2 frameshift not caught before Twist submissionLOW (now mitigated)CRITICALAlready caught by programmatic codon translation 27 May 2026. v4 fixes the deletion. SOP: programmatic in-silico translation of every Twist insert mandatory before order.
3Premature germination during gut transit (L-Ala, glucose, inosine triggers present in SI fluid)35 %HIGHTest germination kinetics in simulated intestinal fluid (SIF, pH 6.8 + bile salts + pancreatic enzymes + 20 AAs + ADP). If > 50 % germinate in < 90 min, engineer ger-operon knockout in chassis (Phase 2).
4CT neutralisation below 25 % at 10⁹ CFU/mL (Gate 3 floor)30 %HIGHThree escalations in order: (a) increase per-spore display via linker extension to (GGGGS)₃; (b) escalate dose to 10¹⁰ CFU/mL; (c) pivot product format to cell-free purified BL3.2 + ORS (Track A regulatory path).
5Disulphide misfolding in oxidising coat environment (BL3.1 CDR3 has Cys106; intramolecular disulphide critical for paratope)25 %HIGHAnaerobic-reduction Western to compare reduced vs oxidised fusion mass. If 50 – 90 % of paratopes are misfolded, co-express a coat-targeted thiol-disulphide isomerase as Module 1b.
6SpecR resistance fails to express in B. subtilis (aad9 codon usage borderline)30 %MEDIUMBackup: Cre/Flp-removable kanR (km) cassette. Confirm SpecR functionality in B. subtilis 168 on day 1 with a control transformation.
7Anti-VHH IgA response on repeated daily oral dosing (immunogenicity over 14 – 28 day risk windows)20 %MEDIUMPetersson 2025 tested single doses only. Phase 2 plan: 7-day and 14-day repeat-dose murine models, ELISA for serum anti-VHH IgG and gut anti-VHH IgA. If significant, consider PEGylation of soluble Track-A product or alternate-day dosing.
8Mucus-layer settling (non-motile spores may sediment into mucus rather than remain in luminal flow)25 %MEDIUMCaco-2 transepithelial assay with mucin-coated apical surface; measure paratope access to apical CT-HRP. If mucus-trapping is significant, formulate with mucolytic excipient or pivot to germination-dependent activation (vegetative cells motile).

Key References

Primary Literature — VHH Anti-Cholera Toxin Nanobodies:

  • Petersson et al. (2025). “Orally delivered toxin-binding protein protects against diarrhoea in a murine cholera model.” Nature Communications 16: 2722.
    • DOI: 10.1038/s41467-025-52722-9
    • Critical for this project: Provides the verified BL3.1 VHH sequence; demonstrates oral stability of VHH; shows in vivo efficacy in murine cholera model; establishes that VHH neutralization can reduce bacterial colonization 10-fold.
    • Use: Download BL3.1 amino acid sequence from supplementary data; use as source sequence for codon optimization.

Foundational References — B. subtilis Spore Surface Display:

  • Isticato et al. (2001). “Surface display of recombinant proteins on Bacillus subtilis spores.” Journal of Bacteriology 183(21): 6294–6301.

    • Key contribution: Established CotB C-terminal fusion as the gold-standard method for spore surface display; demonstrated ~1,500 CotB copies per spore; showed displayed proteins retain function after 80°C heat treatment.
  • Cutting & Vander Horn (1990). “Genetic analysis of the amyE locus of Bacillus subtilis 168.” Journal of Bacteriology 172: 4662–4669.

    • Relevance: Characterizes amyE as a validated, non-essential integration site; establishes starch plate halo assay as the screening method.
  • Driks & Losick (1991). “Compartmentalization of gene expression during Bacillus subtilis sporulation.” Microbiology Reviews 55: 371–399.

    • Relevance: Details SigK-dependent sporulation promoter; explains CotB expression timing and coat assembly; guides promoter design choices.

Supplementary Reading — Cholera & AB₅ Toxins:

  • Holmgren, J. (1981). “Actions of cholera toxin and the prevention and treatment of cholera.” Nature 292: 413–417.

    • Classic mechanism paper on CT-induced cAMP signaling and secretory diarrhea.
  • Sixma, T.K., Pronk, S.E., Kalk, K.H., et al. (1992). “Lactose binding to the heat-labile enterotoxin revealed by X-ray crystallography.” Nature 355: 561–564.

    • Structural basis for GM1 ganglioside recognition by AB₅ toxins.


Experimental Milestones

Milestone Timeline (Table Format)

WeekMilestoneStatusNotes
Wk 1–2Design & order sequences; extract gDNA⬜ PendingVerify VHH from Petersson et al. (2025); codon optimize; finalize primer design
Wk 2PCR amplify fragments 1, 2, 4, 5⬜ PendingAll four genomic/plasmid PCR products gel-purified and verified
Wk 3Receive Twist synthetic fragments⬜ PendingFragment 3 (VHH) + control Fragment 3’ (GFP) both validated
Wk 35-fragment Gibson Assembly⬜ PendingMix all fragments with NEB Master Mix; 50°C, 1 hour assembly
Wk 3Transform into E. coli; plate on selection⬜ PendingRecord colony count on SpecR plates vs. no-DNA control
Wk 3–4Colony PCR screening (junction primers)⬜ PendingExpect ~30–60% correct clones; pick 3–4 for miniprep
Wk 4🎯 GATE 1 — Sequence verificationDECISION POINTSanger sequencing of all junction regions + full VHH CDR1/CDR2/CDR3. Minimum: 1 correct clone. Proceed: YES / NO
Wk 5Transform into B. subtilis 168 (natural competence)⬜ PendingSelect on spectinomycin LB; pick colonies for amyE starch plate
Wk 5–6Verify integration (amyE starch plate halo assay)⬜ PendingLoss of halo = positive integration. Confirm on 2–3 independent colonies
Wk 6–8Sporulation in DSM (5–7 days at 37°C)⬜ PendingGentle aeration essential for sporulation efficiency
Wk 8Heat-treat spore suspension (80°C, 30 min)⬜ PendingKills vegetative cells; purifies spore population
Wk 8🎯 GATE 2 — Surface display verificationDECISION POINTAnti-His immunofluorescence + dot blot + Western blot (~55 kDa band). Positive: YES / NO. Proceed: YES / NO
Wk 9–10GM1-ELISA competitive inhibition assay⬜ PendingPre-incubate VHH spores + cholera toxin; pellet spores; measure remaining CT in supernatant
Wk 10–11Dose-response curves (10-fold dilution series)⬜ PendingRun assay across 10⁸–10¹⁰ spores/mL; calculate % inhibition & IC₅₀
Wk 11Statistical analysis & figure preparation⬜ PendingError bars (n=3), ANOVA, curve fitting
Wk 12🎯 GATE 3 — Toxin neutralization proofDECISION POINTMinimum: >25% inhibition (Aim 1 success). Target: >50%. Stretch: >75% with IC₅₀ value. PROJECT COMPLETE: YES / NO

Milestone Checklist (Phase-Based)

✅ Pre-Lab & Design (Weeks 1–2)

  • Obtain verified VHH amino acid sequence from Petersson et al. (2025) supplementary data
  • Run codon optimization with updated VHH sequence; generate updated Fragment 3 FASTA
  • Create Benchling project; import all three GenBank files (VHH, GFP, full cassette)
  • Screen synthetic sequences through SecureDNA biosecurity portal
  • Place Twist Bioscience order (CS-VHH-CTB-v1 + CS-GFP-CTRL-v1); budget ~$200
  • Order PCR primers for fragments 1, 2, 4, 5 (IDT or Integrated DNA Technologies)
  • Order reagents: Q5 polymerase, Gibson Assembly Master Mix (NEB), spectinomycin sulphate
  • Order validation reagents: anti-His-HRP antibody, CTB-HRP, GM1 ganglioside
  • Extract genomic DNA from B. subtilis 168; quantify and verify quality

✅ PCR & Gibson Assembly (Weeks 2–4)

  • PCR amplify Fragment 1 (amyE 5’ arm, ~1 kb); gel verify band size
  • PCR amplify Fragment 2 (P-cotB + CotB, ~1.4 kb); confirm stop codon removal via sequencing junction
  • PCR amplify Fragment 4 (SpectR, ~1.2 kb); gel verify
  • PCR amplify Fragment 5 (amyE 3’ arm, ~1 kb); gel verify
  • Perform 5-fragment Gibson Assembly; incubate 50°C for 1 hour
  • Transform Gibson product into E. coli DH5α; plate on spectinomycin LB
  • Pick 8–12 colonies for colony PCR screening (junction primers)
  • Miniprep correct clones (expect ~30–60% correct); send for Sanger sequencing
  • [GATE 1] Confirm at least one sequence-perfect clone with correct junctions and full VHH ORF
  • Archive correct E. coli clone at -80°C

✅ B. subtilis Integration & Sporulation (Weeks 5–8)

  • Prepare B. subtilis 168 competent cells (natural competence protocol)
  • Transform sequence-verified plasmid into B. subtilis 168
  • Plate on spectinomycin LB; pick 4–6 colonies
  • Perform amyE starch plate assay on candidates (loss of halo = positive integration)
  • Confirm positive colonies; streak-purify on spectinomycin plates
  • Inoculate positive strains into DSM (Difco Sporulation Medium)
  • Incubate 37°C with vigorous aeration for 5–7 days to induce sporulation
  • Heat-treat spore suspension to 80°C for 30 minutes (kills vegetative cells)
  • Store spore stocks at 4°C and -20°C
  • [GATE 2] Verify surface display: anti-His immunofluorescence on intact spores + dot blot + Western blot (expect ~55 kDa fusion protein band)
  • Include control: CotB-sfGFP spores (GFP fluorescence validation)

✅ Validation & Analysis (Weeks 9–12)

  • Prepare cholera toxin stock (use recombinant or commercially available CTB-HRP)
  • Pre-incubate VHH spores + cholera toxin (37°C, 1 hour)
  • Pellet spores; collect supernatant (unbound toxin)
  • Apply supernatant to GM1-coated ELISA plate or dot blot
  • Detect with CTB-HRP + substrate; measure absorbance or chemiluminescence
  • Calculate % toxin binding inhibition vs. no-spore control
  • Run dose-response curve: 10⁸, 10⁹, 10¹⁰ spores/mL (and 2–4 intermediate dilutions)
  • Include negative controls: wild-type B. subtilis spores, CotB-sfGFP spores (non-specific binding)
  • Calculate IC₅₀ value (spore concentration at 50% inhibition) if data permits
  • Perform statistical analysis (mean ± SD, ANOVA, curve fitting)
  • Prepare figures: dose-response curves with error bars, binding inhibition % vs. spore concentration
  • [GATE 3] Confirm toxin neutralization: Minimum >25% inhibition (success), Target >50%, Stretch >75%
  • Write up final report and submit

Notes for Lab Execution

Critical Success Factors:

  1. Verify VHH sequence early — Literature source (Petersson et al. 2025) is essential before ordering; confirm Kd ~77 nM and CTB binding epitope
  2. Codon optimization — B. subtilis has distinct codon preferences; suboptimal codon usage will reduce expression levels
  3. No stop codon on CotB — Triple-check PCR design; the stop codon MUST be removed for in-frame fusion
  4. Gibson overlaps — All 30 bp overlaps must be checked for secondary structure; use Twist’s built-in overlap design for Fragment 3
  5. B. subtilis natural competence — Cells must be in exponential phase (OD₆₀₀ ~0.5); competence efficiency varies by strain and growth conditions
  6. Sporulation conditions — DSM medium, vigorous aeration, and 37°C are non-negotiable; low aeration = poor spore yield
  7. Assay validation — Run controls first: CotB-sfGFP (non-binding), wild-type spores (baseline), and purified VHH-His protein (positive control)

Last Updated: APRIL 2026
Contact: fionaconn@icloud.com

Group Final Project

cover image cover image