Subsections of Projects

Individual Final Project

cover image cover image

Individual Final Project Document (HTGAA 2026):

This document presents the complete final project report, including the design strategy, construct engineering workflow, structural analyses, and in silico validation steps. For a more interactive and visually detailed presentation including animated rotating views of the predicted protein structures, enhanced figures, additional simulations, and direct access to all Benchling design files and cloning maps, please refer to the project documentation webpages associated with this final project.

These resources provide a more comprehensive visualization of the project beyond the static figures included in this PDF document.

Project Title: Engineering Houseplants for Atmospheric Carbon Monoxide Capture: Chloroplast-Targeted Expression of the Bacterial CODH Enzyme Complex in Nicotiana tabacum

image image

The Problem This Project Addresses

Carbon monoxide (CO) is a colorless, odorless, tasteless toxic gas that cannot be detected by human senses. It is produced whenever something burns incompletely — gas heaters, stoves, car engines, fireplaces, and wood-burning appliances all release CO. Indoors, CO accumulates silently and can reach dangerous or fatal concentrations before anyone notices. The current standard of protection is a battery-powered electrochemical CO detector. These devices are excellent at detecting CO and sounding an alarm , but they cannot remove the gas from the air. Once the alarm sounds, the occupants must evacuate and ventilate the space manually. Furthermore, CO detectors require regular battery replacement and eventually need to be replaced entirely. In low-income households worldwide, detectors are frequently absent, have dead batteries, or are past their useful lifespan.

–> This project proposes a fundamentally different approach: instead of detecting CO, make the plant remove it.

The Core Idea

Certain bacteria ,particularly Oligotropha carboxidovorans, have evolved the ability to use CO as a food source. They do this using an enzyme called Carbon Monoxide Dehydrogenase (CODH), which converts CO into CO₂ according to this reaction:

CO + H₂O → CO₂ + 2 electrons + 2 protons

The CO₂ produced by this reaction is not harmful at the quantities involved and supposed to be reused by a plant’s own photosynthesis through the Calvin cycle.

This project proposes to take the bacterial CODH system out of the bacterium and introduce it into a plant, specifically targeting it to the chloroplast (the organelle where photosynthesis happens). By placing CODH inside the chloroplast, two elegant outcomes occur simultaneously:

  1. The plant actively breaks down CO from the surrounding air
  2. The CO₂ produced by CODH is immediately captured by Rubisco and enters the Calvin cycle, making the plant slightly more productive

The scientific foundation for this idea is already established in the literature. Duffus et al. (2018) demonstrated that the complete CODH complex can be functionally expressed in Escherichia coli –> proving heterologous expression is achievable. South et al. (2019) demonstrated in Science that bacterial enzymes introduced into tobacco chloroplasts producing CO₂ directly in the stroma increased plant biomass by up to 40% –> proving that chloroplast-produced CO₂ is efficiently captured by photosynthesis. This project extends this logic to a new substrate: atmospheric CO.

The Complete Genetic System Required

The CODH enzyme from O. carboxidovorans is not a single protein. It is a complex system requiring seven genes organized into two functional groups:

  1. Group 1 — Structural subunits (the enzyme itself):

coxL –> the large catalytic subunit (~88 kDa) where CO is actually oxidized. Contains the unique [CuSMoO₂] active site coxM –> the medium subunit (~30 kDa) containing FAD, responsible for electron transfer coxS –> the small subunit (~18 kDa) containing [2Fe-2S] iron-sulfur clusters, part of the electron relay chain

These three proteins assemble into a (CoxL·CoxM·CoxS)₂ heterohexamer — a complex of six protein subunits working together.

  1. Group 2 — Maturation proteins (the assembly machinery):

coxD –> an AAA+ ATPase chaperone that acts as a “maturation protein,” responsible for the post-translational insertion of copper and the essential bridging sulfur into the apo-enzyme, converting it to active holo-enzyme. coxE, coxF and coxG –> “final processing” and “sulfur addition” are part of a complex pathway. According to research, coxF plays a role in copper acquisition/mobilization, and coxE and coxG are involved in the maturation pathway that leads to the properly sulfurated and copper-inserted active site. The exact individual functions of coxE and coxG are still being elucidated, though their role in the maturation complex is essential.

Overview of the Three Aims

image image

AIM 1 — Computational Design and Validation of the Complete Genetic System

In simple terms: Design the complete genetic blueprint for the CO-capturing plant system on a computer, verify every element computationally, and produce a synthesis-ready design.

The seven bacterial genes cannot simply be pasted into a plant. They need to be comprehensively redesigned for plant expression:

  • Their DNA sequences must be rewritten in “plant language” through codon optimization
  • Each protein needs a molecular address label (chloroplast transit peptide) added to its beginning so it is directed to the correct location inside the plant cell
  • The address labels must be verified to ensure the plant’s processing machinery will correctly remove them after the protein arrives
  • Each gene needs its own promoter (an on-switch for gene expression) and terminator (an off-switch), carefully chosen to prevent the plant from silencing all the genes simultaneously
  • Translation enhancer sequences must be added to maximize protein production
  • Spacer sequences must be placed between genes to prevent one gene’s transcription from accidentally running into the next
  • The complete system must be distributed across two separate transformation vectors

All of this is done computationally using Benchling, A codon optimization tool, ChloroP 1.1, Boltz, and the Asimov Kernel –> producing a complete verified design ready for DNA synthesis through Twist Biosciences.

AIM 2 — Wet Lab Transformation and Functional Validation (The next step — beyond this course)

In simple terms: Actually build the constructs in the lab, put them into tobacco plants, and prove the enzyme works. Aim 2 begins where Aim 1 ends. The Twist-synthesized multicassettes fragments are assembled into the pCAMBIA vectors using Gibson Assembly. The constructs are introduced into Nicotiana tabacum via Agrobacterium tumefaciens-mediated leaf disc transformation , the standard method for introducing genes into tobacco. Transgenic plants are selected on dual antibiotic medium (hygromycin + kanamycin, confirming both constructs integrated).

The experimental progression follows strict logic — each step must succeed before the next begins:

  • –> Step 1 — Chloroplast targeting validation
  • –> Step 2 — Gene integration and transcription
  • –> Step 3 — Protein expression and CTP cleavage
  • –> Step 4 — Complex assembly
  • –> Step 5 — CO oxidation activity
  • –> Step 6 — Plant health and photosynthesis

for more details, please take a look on part I of week 10 homework.

AIM 3 — Optimization, Transfer to Houseplants, and Real-World Deployment(The long-term vision)

In simple terms: Assuming Aim 2 succeeds, optimize the system, transfer it to real houseplants, and develop it toward real-world deployment. If Aim 2 demonstrates functional CO oxidation in tobacco, Aim 3 pursues three parallel directions:

Direction 1 — Transfer to real houseplants: The validated genetic architecture from tobacco is adapted for transformation into Epipremnum aureum (Pothos) and Spathiphyllum wallisii (Peace Lily) — widely kept, hardy, aesthetically acceptable houseplants. Agrobacterium-mediated transformation protocols established for tobacco are adapted for these species.

Direction 2 — System optimization: Several improvements are pursued to increase CO removal efficiency and operational range:

A CO-responsive inducible promoter system replaces constitutive promoters, activating CODH expression only when CO is present and saving plant energy otherwise Constitutively open stomata engineering to maintain CO uptake during nighttime hours when CO poisoning risk is highest Expression levels are optimized based on the quantitative CO removal model to increase per-plant removal capacity

Direction 3 — Safety, containment, and deployment:

Genetic Use Restriction Technology (GURT): To prevent seed viability and uncontrolled environmental spread, I will implement Genetic Use Restriction Technology (GURT). This ensures that any engineered plants cannot reproduce outside controlled environments. Additional containment strategy — chloroplast genome integration:

As an alternative or complement to GURT, I can integrate the transgenes into the chloroplast genome instead of the nuclear genome. Chloroplast DNA is maternally inherited in most flowering plants, including tobacco (Nicotiana tabacum). This means the transgenes are not transmitted via pollen, virtually eliminating the risk of gene flow to wild relatives. This is a well-established biosafety strategy for plant synthetic biology.

Regulatory pathway planning begins under USDA APHIS (Regulation of genetically engineered plantsand) EPA (Regulation of plants producing pesticidal substances (if applicable))frameworks.

The deployment target is refined based on the quantitative CO removal analysis: rather than acute emergency protection in homes (which requires too many plants), the primary application is chronic CO reduction in high-exposure industrial and semi-industrial environments like workshops, garages, underground parking facilities, and developing-world indoor cooking spaces where CO concentrations are higher and more sustained.

The ethical framework for commercial deployment ,including informed consent, false assurance prevention, equity of access, and environmental risk, is fully developed and integrated into regulatory submissions.

image image

Sources:

  • Bährle, R., Böhnke, S., Englhard, J., Bachmann, J., & Perner, M. (2023). Current status of carbon monoxide dehydrogenases (CODH) and their potential for electrochemical applications. Bioresources and Bioprocessing, 10(1), 84. https://doi.org/10.1186/s40643-023-00705-9
  • Dent, M. R., Weaver, B. R., Roberts, M. G., & Burstyn, J. N. (2023). Carbon Monoxide-Sensing Transcription Factors: Regulators of Microbial Carbon Monoxide Oxidation Pathway Gene Expression. Journal of Bacteriology, 205(5), e00332-22. https://doi.org/10.1128/jb.00332-22
  • Erb, T. J. (2024). Photosynthesis 2.0: Realizing New-to-Nature CO2-Fixation to Overcome the Limits of Natural Metabolism. Cold Spring Harbor Perspectives in Biology, 16(2), a041669. https://doi.org/10.1101/cshperspect.a041669
  • Kaufmann, P., Duffus, B. R., Teutloff, C., & Leimkühler, S. (2018). Functional Studies on Oligotropha carboxidovorans Molybdenum–Copper CO Dehydrogenase Produced in Escherichia coli. Biochemistry, 57(19), 2889–2901. https://doi.org/10.1021/acs.biochem.8b00128
  • Liu, C., Zhang, N., Sun, L., Gao, W., Zang, Q., & Wang, X. (2022). Potted plants and ventilation effectively remove pollutants from tobacco smoke. International Journal of Low-Carbon Technologies, 17, 1052–1060. https://doi.org/10.1093/ijlct/ctac081
  • Park, S., Mani, V., Kim, J. A., Lee, S. I., & Lee, K. (2022). Combinatorial transient gene expression strategies to enhance terpenoid production in plants. Frontiers in Plant Science, 13, 1034893. https://doi.org/10.3389/fpls.2022.1034893
  • Qin, S., Liu, Y., Yan, J., Lin, S., Zhang, W., & Wang, B. (2022). An Optimized Tobacco Hairy Root Induction System for Functional Analysis of Nicotine Biosynthesis-Related Genes. Agronomy, 12(2), 348. https://doi.org/10.3390/agronomy12020348
  • Schübel, U., Kraut, M., Mörsdorf, G., & Meyer, O. (1995). Molecular characterization of the gene cluster coxMSL encoding the molybdenum-containing carbon monoxide dehydrogenase of Oligotropha carboxidovorans. Journal of Bacteriology, 177(8), 2197–2203. https://doi.org/10.1128/jb.177.8.2197-2203.1995
  • Siebert, D., Busche, T., Metz, A. Y., Smaili, M., Queck, B. A. W., Kalinowski, J., & Eikmanns, B. J. (2020). Genetic Engineering of Oligotropha carboxidovorans Strain OM5—A Promising Candidate for the Aerobic Utilization of Synthesis Gas. ACS Synthetic Biology, 9(6), 1426–1440. https://doi.org/10.1021/acssynbio.0c00098
  • Tao, Y., Chiu, L.-W., Hoyle, J. W., Dewhirst, R. A., Richey, C., Rasmussen, K., Du, J., Mellor, P., Kuiper, J., Tucker, D., Crites, A., Orr, G. A., Heckert, M. J., Godinez-Vidal, D., Orozco-Cardenas, M. L., & Hall, M. E. (2023). Enhanced Photosynthetic Efficiency for Increased Carbon Assimilation and Woody Biomass Production in Engineered Hybrid Poplar. Forests, 14(4), 827. https://doi.org/10.3390/f14040827
  • Thagun, C., Odahara, M., Kodama, Y., & Numata, K. (2024). Identification of a highly efficient chloroplast-targeting peptide for plastid engineering. PLOS Biology, 22(9), e3002785. https://doi.org/10.1371/journal.pbio.3002785

Subsections of Individual Final Project

PHASE 1: Sequence Collection

Structural and maturation genes sequences:

To obtain the gene sequences, I used the accession number GenBank CP002827.1, which corresponds to the genome of Oligotropha carboxidovorans. I accessed this record through the National Center for Biotechnology Information platform.

Within the genome page, I used the graphical genome viewer to locate the genes of interest. I specifically identified the structural genes (coxL, coxM, coxS) and the maturation genes (coxD, coxE, coxF, coxG) involved in the CO dehydrogenase (CODH) system.

For each gene, I clicked on its corresponding feature in the graphical map, opened its detailed annotation page, and selected the FASTA format option. This allowed me to retrieve the nucleotide sequence of each gene individually. image image All sequences were downloaded separately in FASTA format and then compiled for further analysis and use in my project. image image

CoxL structural subunit sequence:

CP002827.1:30264-32693 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence

ATGAATATCCAGACCACCGTTGAACCGACGAGCGCGGAGCGTGCCGAAAAGTTGCAGGGTATGGGCTGCAAGCGCAAACGTGTCGAAGATATCCGCTTTACCCAGGGTAAGGGCAACTACGTCGATGATGTGAAATTACCGGGTATGTTGTTTGGTGATTTCGTTCGTTCGTCGCACGCCCATGCGCGCATTAAAAGTATCGATACCTCGAAGGCTAAGGCGCTTCCAGGTGTATTCGCTGTTTTAACGGCGGCCGACCTGAAGCCGCTGAATCTGCATTATATGCCGACGCTGCTGGCGATGTGCAGGCAGTGCTTGCAGACGAGAAGGTTCTTTTCCAGAATCAGGAGGTTGCCTTTGTAGTGGCGAAAGATCGTTACGTTGCGGCGGACGCGATCGAATTGGTCGAAGTCGATTATGAGCCGCTGCCGGTTCTAGTCGACCCATTCAAGGCAATGGAACCAGATGCACCTCTGCTACGTGAAGATATCAAAGACAAAATGACCGGTGCGCACGGTGCGCGCAAACATCACAACCATATCTTCCGTTGGGAAATAGGCGATAAGGAAGGCACCGATGCGACCTTCGCCAAAGCCGAAGTCGTGTCAAAAGATATGTTTACCTATCATCGGGTGCATCCGTCGCCGCTGGAAACGTGTCAGTGCGTTGCGTCGATGGACAAGATCAAGGGTGAACTGACGTTGTGGGGCACATTCCAGGCGCCGCATGTCATCCGTACCGTGGTGTCGCTGATCTCGGGTTTGCCGGAGCATAAAATCCACGTCATTGCACCGGACATCGGGGGCGGCTTTGGCAACAAGGTGGGCGCTTATTCCGGCTACGTCTGCGCGGTGGTTGCCTCCATCGTGCTGGGCGTGCCCGTGAAGTGGGTCGAAGACCGAATGGAGAACCTCTCCACGACATCATTTGCGCGCGACTATCATATGACGACAGAACTCGCAGCCACCAAGGACGGCAAGATTCTTGCGATGCGCTGTCACGTCCTGGCTGATCACGGAGCGTTCGACGCCTGTGCCGATCCATCGAAATGGCCGGCGGGCTTCATGAACATCTGTACCGGCTCCTATGACATGCCGGTGGCACATCTGGCCGTGGATGGTGTCTATACCAACAAAGCGTCCGGCGGCGTAGCCTATCGTTGCTCGTTCCGAGTGACGGAAGCGGTTTATGCCATTGAGCGCGCGATCGAGACGCTGGCGCAGCGGCTCGAGATGGACTCAGCCGATCTACGCATCAAGAACTTTATCCAGCCGGAGCAGTTCCCTTATATGGCGCCGCTGGGCTGGGAGTACGACAGCGGAAATTATCCACTCGCGATGAAGAAAGCGATGGATACGGTCGGTTATCATCAGCTTCGTGCTGAACAGAAAGCCAAACAGGAAGCCTTCAAGCGCGGCGAGACACGCGAGATTATGGGCATCGGTATCTCGTTTTTCACCGAGATTGTCGGCGCCGGGCCGTCGAAGAATTGCGATATTCTCGGCGTGTCGATGTTTGACTCGGCGGAAATCCGTATCCATCCAACCGGTTCAGTGATTGCCCGCATGGGCACCAAGAGCCAGGGCCAGGGGCACGAGACGACCTACGCTCAGATCATCGCCACCGAACTCGGTATTCCCGCTGACGACATCATGATCGAAGAAGGCAATACCGACACTGCCCCTTATGGCCTTGGCACTTACGGCTCGCGCTCGACGCCGACGGCTGGTGCGGCAACCGCTGTGGCCGCGCGCAAAATCAAAGCCAAGGCGCAGATGATTGCGGCGCACATGCTCGAAGTGCATGAGGGCGATTTGGAATGGGACGTGGACCGCTTCCGGGTGAAAGGCCTTCCGGAAAAATTCAAGACCATGAAGGAACTCGCCTGGGCGTCCTACAATAGTCCGCCGCCCAATCTCGAGCCTGGGCTCGAGGCTGTGAACTATTACGACCCTCCGAATATGACTTATCCGTTCGGTGCCTATTTCTGCATCATGGATATCGATGTGGACACCGGCGTCGCCAAAACCCGGCGCTTCTATGCACTGGACGATTGCGGAACACGTATCAACCCGATGATCATCGAAGGGCAGGTGCATGGTGGTTTGACCGAGGCCTTCGCGGTCGCGATGGGGCAGGAGATCCGATACGACGAGCAAGGCAACGTGCTTGGAGCGTCGTTTATGGACTTCTTCCTGCCGACGGCCGTCGAAACGCCGAAGTGGGAGACCGACTACACAGTGACGCCGTCGCCACATCATCCGATCGGCGCCAAAGGCGTGGGTGAAAGTCCGCATGTCGGCGGTGTGCCGTGCTTCTCAAATGCGGTGAATGATGCTTACGCCTTTCTGAACGCCGGCCATATCCAAATGCCGCATGATGCCTGGCGGCTATGGAAGGTAGGCGAGCAACTTGGCCTGCACGTCTAA

Cox M structural subunit sequence:

CP002827.1:28882-29748 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence

GTGATACCTGGTTCATTTGATTATCACCGTCCAAAATCCATTGCAGACGCAGTCGCGCTTCTGACGAAGCTCGGTGAGGATGCTCGGCCCTTGGCCGGAGGCCACAGCCTAATTCCGATCATGAAGACCCGGCTGGCTACGCCGGAGCATCTGGTTGATCTCAGGGATATTGGAGATCTCGTCGGAATTCGAGAGGAGGGTACGGACGTCGTCATCGGGGCGATGACCACTCAGCATGCGCTGATAGGCTCAGATTTTCTCGCAGCAAAATTGCCGATCATTCGCGAGACATCGCTGCTGATCGCCGATCCGCAAATCCGCTACATGGGAACCATTGGCGGCAACGCCGCTAACGGCGATCCGGGCAACGATATGCCGGCCCTCATGCAGTGTCTCGGTGCGGCTTACGAACTCACCGGCCCTGAAGGTGCGCGCATAGTTGCTGCGCGAGATTACTATCAAGGTGCTTATTTCACGGCGATCGAGCCCGGTGAACTTCTTACAGCAATCCGAATTCCGGTGCCGCCCACCGGACACGGTTACGCTTACGAAAAACTGAAGCGGAAAATTGGCGACTATGCCACCGCCGCGGCGGCTGTCGTGCTGACGATGAGCGGCGGAAAATGTGTGACGGCATCGATCGGTCTCACCAATGTTGCGAACACACCGCTTTGGGCGGAAGAGGCCGGCAAGGTGCTGGTTGGCACGGCGCTCGACAAACCTGCGCTCGACAAGGCTGTAGCGCTGGCTGAGGCGATCACCGCTCCGGCGTCGGATGGCCGCGGGCCCGCAGAATATCGGACCAAGATGGCGGGTGTCATGCTGCGTCGTGCGGTCGAGCGGGCCAAGGCCCGCGCCAAGAATTAG

Cox S structural subunit sequence:

CP002827.1:29767-30267 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence

ATGGCGAAAGCCCATATCGAGTTGACGATCAACGGACATCCGGTGGAGGCACTGGTCGAACCGCGTACGCTGTTGATCCATTTCATTCGCGAGCAACAGAACCTTACCGGCGCACATATCGGCTGCGACACCAGCCACTGCGGCGCGTGTACTGTCGATCTCGATGGTATGTCGGTGAAGAGCTGCACAATGTTCGCTGTCCAGGCTAACGGGGCTTCAATCACCACGATTGAAGGCATGGCAGCACCGGATGGTACACTGAGTGCGCTGCAGGAAGGGTTCCGCATGATGCATGGTCTGCAATGCGGCTACTGCACTCCGGGGATGATCATGCGATCGCATCGCTTGCTGCAGGAGAATCCAAGCCCGACCGAAGCGGAAATACGCTTCGGCATCGGTGGAAATCTTTGCCGCTGCACCGGCTATCAGAACATTGTCAAAGCAATCCAGTATGCCGCCGCCAAGATCAATGGCGTACCTTTCGAGGAGGCCGCAGAATGA

Cox D structural subunit sequence:

CP002827.1:32748-33635 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence

ATGCGTCATCATGCTGAACGAGACAAGGTCGCCGAGAGGCTGGCCTATGCGGGCTATATCCCCGATCGCGATCTTGCGACCGCTGTTTGGCTGATGGAAAGCCTGTCGCGCCCGTTGTTGCTGGAAGGCGAAGCGGGTGTAGGCAAGACCGAGGTCGCGCTGACACTGGCGCAAGCGAACGGAGCAAGGCTCATTCGCTTGCAATGCTATGAGGGGCTCGATCAAAACGCGGCATTATACGAGTGGAACTACCAACGGCAGTTGCTGGCGATCAAAACACGGGAAAGTCGTGCGGACGCGGTAGATGTTATCGAGGATCATATTTTCTCGGAGAAGTTTCTGCTTGAGCGGCCGCTGTTGGCTGCAATACGTCAACCCAAATCGGCAGTGCTGCTAATTGATGAGGTTGACCGCGCCGACGAGGAGTTTGAGGCCTTTTTACTCGAACTGTTGTCGGATTATCAGGTTTCGATTCCCGAACTTGGCACAATCCATGCCACAACGATTCCACAGGTGATCCTGACATCCAATGGCACGCGTGAGTTATCAGATGCGTTGCGCCGGCGTTGTCTCTATCACTATGTCGACTATCCGGATGTTGAACGCGAGGCGCGTATCATCACCACACGGATGCCGAATATCGACGTTGCGCTGGCGTTGCAGATTGCCAGGATGATCGAGGGAATCCGAAAAGAGGATTTGCGCAAGAGTCCCGGCGTCGCGGAAACCCTCGACTGGGCGGCAGCATTGGCGGGGCTTGGCGTTGAGGATCTGCGCGCTGAACCCGAAGCTGTCTTTGAAACGATGATGTGCTTGATCAAGACAGTCGAAGATAAATCGCGCGTGACTCGCGAGGTTTCTGATCGGCTGCTGGGCAAGGTGGCATGA

Cox E structural subunit sequence:

CP002827.1:33637-34836 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence

ATGGTGGCAACTGCGGCCATTCATGAATCCAGCGCTGCTTCGGCAGGGGCTCGCCGCAAGCTTGGCGACTTTGTCCGAGTACTCCGGGACAATGGTTTCATTGTGGGGCTCGCGGAGGCTGGCGATGCGCTTACCGTGCTGAGCAGGCCTGCCTCTTTGACGCCGTCGCGTCTGCGACCGGCGCTCCGCGCATTGTTCTGCAGTAACAAGTCTGATTGGGAAAAGTTCGACGAGATTTTCGATGCGTTCTGGCTGGGGCGCGGCATGAAATCCGCAACGCGCATTTCGGGCGTGCTGCAGAAAAGTCCGCCCGGTATGGAGAGTTCAAGGAGTGGCGATCGGCCAGGTAATCCTGATGGGGCGCCAGATCATGTACAGCGGCGTATAGGCTTGGATCACGGCACCGATGAAAATAGTCCCGGCCTGCGGGAAGGTGCATCGCGCGCGGACTCGCTGGCCAAGGCTGATTTTCGTCATCTCACAAACCCGGACGATCTTGCTGCAGCTCATGCGGTAGCTGCAAGACTCGCAAAGGCGATGCGGGTGCGCTTAACCCGTCGCGAACAATCGCGCCGTACTGGCCGGCGTATCGACCTCCGCCGCACGATTCACAAAAATATTGCCCATGGAGGGATGCCGCTGGAGTTGGTCTGGCGACAACGCAAGCATAAACCATTACGGCTGGTCGTGCTGCTCGACGCGTCCGGATCTATGAGCATGTATTCGGCAGTATTCCTCCGGTTCATGCACGGGATTCTTGATAATTTTCGTGAGGCCGAGGCCTTCGTCTTCCATACGCGCCTCATTCATATTTCGCCCGCTTTGCGTGAGCGCGATGCGACACGTTCTGTGGAGCGTATGTCGCTGTTGGCGCAAGGCGTCGGTGGTGGCACCCGGATCGGTGAATCGCTTGCCACGTTCAATCGGTGGCATGCGAAGCGTGCAATTCATTCGCGCACTTGTGTGATGATCGTGTCCGACGGCTACGATACCGGGCCTGCCGAGCAACTGGAGCGAGAGATGTCGGCGCTGCGCCGTCGCTGTCGCCGTATCGCCTGGCTCAATCCGATGATCGGCTGGCGCGGCTATGCGCCAGAGGCAGCGGGGATGAAGGCGGCCCTGCCTCATGTCGACTTGTTTGCGCCCGCTCACAACCTCGAGAGCTTGCAAGCCATTGAGCCTTATCTGGCGAGGATTTGA

Cox F structural subunit sequence:

CP002827.1:34840-35682 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence

ATGACACCTACTCCTGACGTGCTCGATCTCGTCAACAATATGAAAGCCCGGGGTGAGCCGTTTGCCCTCGCAACGGTAGTGCGGACGGTATCACTCACCGCAGCCAAGGCAGGTGCAAAGGCTATTATTTTGAGCGACGGTACTATGACCGCCGGCTGGATCGGGGGCGGGTGTGCGCGGGCGAATGTGCTGAAGGCTGCGCGACAATCGCTTTCGGACGGCAAGCCGCGCCTGATTAGTGTACAGCCCAAGGACGTTCTTGAGGAACACGGTCTGACGGCAGGTGAGGCGCGAGAAGGTGTGCTCTATGCCAACAACATGTGCCCGAGCCATGGTACCATGGATATTTTTGTCGAGCCGATCTTGCCGCGTCCTCAGCTCTATATCTGTGGTGCATCGCCGGTTGCGGTGGCTATCGCGGCTATCGCACCGCGTATGGGATTTTTTGTGTCGGTATGCGCGCCCAAAGCAGATCACACGCTCTTTGGTGACACCGATAGGCTGATTGATGGTTATGAAATTCCCGCCGACAGCGGCACTAATCGTTATGTCGTTGTATCGACGCAGGGACGTGGCGATACTGCTGCGCTGAAATCCGCACTATCCACGCCATCCGTCTACGTGGCTTTCGTTGGCTCGCGTAAGAAAGCGTCGGTGTTGAGGGAAGAGCTTACCGTAGCAGGCATCGCGCCGTCGCTATTGGAAACATTGCACGCGCCTGCCGGCCTCGACCTCGGCGGTATCACGCCTGATGAAATCGCGCTCTCGATCGTAGCGGAGATGGTCGAGATACGTCGCCACGGGCAACGACAATCGGATAATCAGAAAGAAGGAACATCCTGA

Cox G structural subunit sequence:

CP002827.1:35682-36299 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence

ATGGATATGAACGCATCGCAGCGCATCGAAGCCTCGCGCGAAAAAGTCTACGCCGCGCTCAACGATGTTGAGGTGCTTAGGCCGTGCATTCCAGGCTGCGAGTCCATCGAAAAGATCTCTGATAGCGAGATGACTGCCAAGGTCACGTTGCGCATTGGCCCAGTGAAAGCATCTTTTACCGGCAAGGTGACCCTATCGGATCTCGATCCGCCAAACGGTTACACGATTGCAGGGGAGGGTACAGGCGGCATGGCGGGATTTGCCAAGGGCGGTGCTACGGTGAAACTCGAAGCGGATGGGACTGCGACGATTCTTCACTATACTGTTAAAGCTGATGTCGGCGGCAAACTGGCGCAGCTTGGTGGCCGGCTAATCGATGCGACCGCGACAAAACTTGCAGGAGAGTTTTTTGAAAAATTCGGCAATATTGTTGGGCCTGTCGTAGTCCAAGATGAAGAAGAGCCGGTTAAGAAGAAAGGCTGGCTCAAGAAGATCACTGGCGCTCTCAGTGTCCTTGTCTTTAGCATTTTATTAGGCGCGCACTGGTGTTGTATTGGCGGCCATGCTCACGCTCAGAACGATCCGCTGATGTTAGCGATCTGCTCGTCGCGAGTTTGA
GeneGenomic Coordinates (NCBI)Protein IDBiological RoleAssigned Construct
coxLCP002827.1 (30264–32693)AEI08106.1Catalytic subunit responsible for CO oxidationConstruct 1 (Structural)
coxMCP002827.1 (28882–29748)AEI08104.1FAD-binding subunit involved in electron transferConstruct 1 (Structural)
coxSCP002827.1 (29767–30267)AEI08105.1Fe-S cluster-containing subunit for electron relayConstruct 1 (Structural)
coxDCP002827.1 (32748–33635)AEI08107.1Molybdenum cofactor insertion and enzyme maturationConstruct 2 (Maturation)
coxECP002827.1 (33637–34836)AEI08108.1Assists in Mo-cofactor biosynthesis and assemblyConstruct 2 (Maturation)
coxFCP002827.1 (34840–35682)AEI08109.1Active site processing and enzyme activationConstruct 2 (Maturation)
coxGCP002827.1 (35682–36299)AEI08110.1Sulfur ligand incorporation into the active siteConstruct 2 (Maturation)
Promoter sequences:

TobUbi.U4 proximal promoter:

The 263 bp proximal promoter region of the Ubi.U4 gene from Nicotiana tabacum was obtained based on the study by Genschik et al., (1994)This region corresponds to the sequence spanning −263 to −1 relative to the transcription start site (TSS) and contains key cis-regulatory elements involved in transcriptional regulation. The transcription start site (TSS, +1) was not directly annotated in the GenBank entry. Therefore, it was determined based on the promoter analysis presented in the original publication by Genschik et al. (1994), where the TSS was experimentally identified and illustrated in Figure 3. The nucleotide sequence was retrieved from the GenBank database (accession: X77456.1), corresponding to positions 575–837 of the N. tabacum Ubi.U4 gene. image image

> emb|X77456.1 :575-837 N.tabacum Ubi.U4 gene

ACTACGTTAGAGCGCTAACGAGAATACTTCATATACCGTATTTTTTACGATAATAATAATGTAATGTGAAATTGCTATCCAAAAGGCACCTAATTTTGTCCACCGTTCAAAGGAAAGGACAAGGAAGTAGTAGCGTGTAGGTTTGGTGCTGTACAAAATAAGCAAGACACGTGTTGCCTTATTATAGGATAATCCATAAGGCAATTTCGTCTTAAGTCGGCCATTGCACCTTTAAAAGGAGCCTCTTTGTTCCCAAAATCTTC

D100 chimeric promoter (Dahlia mosaic virus - DaMV):

The D100 promoter is a synthetic construct derived from the Dahlia mosaic virus (DaMV) genome, as described by (Khadanga et al., 2021)based on the work of (Sahoo et al., 2015). It is designed by combining an upstream activation sequence with a core promoter region to enhance transcriptional activity.

  • DaMV14UAS (−203 to −33): an upstream activation sequence acting as a transcriptional enhancer
  • A short linker sequence (CCCGAC)
  • DaMV4CP (−474 to +82): a core promoter region required for basal transcription The source promoter region corresponds to a 706 bp fragment (6579–7280) of the DaMV genome (GenBank: JX272320.1), with the transcription start site (TSS, +1) located at position 7053 based on coordinate mapping.

The following sequences were extracted based on coordinate mapping:

DaMV14UAS (−203 to −33):

> gb|JX272320.1|:6850-7020 Dahlia mosaic virus clone pDaMV-p2, complete genome

TCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCTATAT

DaMV4CP (−474 to +82):

> gb|JX272320.1|:6579-7134 Dahlia mosaic virus clone pDaMV-p2, complete genome

GAATTCAATCCTCCTCAGGAAATGAAGGATTCAGGAGATCTTCTCTATCAACTTGCTCAAGTAAGGACAAACGGGTTCACCCGGATCCTCCAGAAGACCCAGTCTATCAACGGAGAAACAAAGATAAAAATCAATTACTCACATGAAAGAGTATTGATCACGAGTCACTATGGAGCGACAATCTCCAGACAGGATGTCAGCATCTTATCTTCCTTTGAAGAAAGCATCATCAATAACGATGTAATGGTGGGGACATCCACTAAGTTATTGCTCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCTATATAATGGCATTCACCCCTCAGTTGAAGAGCATCAGGAGTTTCAGCATAGAAACTTTCTCTTTAACAAATCTATCTTTTCTTTAAAGCATGTGTGAGTAGAAACCCATATAGGGTTA

Initially, the promoter sequence was reconstructed using GenBank coordinates. However, slight discrepancies were observed when compared to the promoter structure illustrated in the published figure. image image Therefore, the final D100 promoter sequence was generated using an Gemini AI tool based on the figure from Khadanga et al. (2021), as it accurately reflects the reported experimental construct:

GCTCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCcccgacAATCCTCCTCAGGAAATGAAGGATTCAGGAGATCTTCTCTATCAACTTGCTCAAGTAAGGACAAACGGGTTCACCCGGATCCTCCAGAAGACCCAGTCTATCAACGGAGAAACAAAGATAAAAATCAATTACTCACATGAAAGAGTATTGATCACGAGTCACTATGGAGCGACAATCTCCAGACAGGATGTCAGCATCTTATCTTCCTTTGAAGAAAGCATCATCAATAACGATGTAATGGTGGGGACATCCACTAAGTTATTGCTCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCTATATAATGGCATTCACCCCTCAGTTGAAGAGCATCAGGAGTTTCAGCATAGAAACTTTCTCTTTAACAAATCTATCTTTTCTTTAAAGCATGTGTGAGTAGAAACCCATATAGGGTTATAATGT

S100 chimeric promoter (Soybean vein clearing virus, SVBV):

The S100 promoter is a synthetic chimeric construct derived from the Soybean vein clearing virus (SVBV), as described by Khadanga et al., (2021)based on Pattanaik et al., (2004). It is designed by combining an upstream activation sequence with a core promoter region to enhance transcriptional activity.

  1. SV10UAS (250 bp) (-352 to -102): This is the Upstream Activation Sequence that contains major regulatory elements contributing to transcriptional enhancement. 2.2. The Linker: CCCGAC sequence: A synthetic 6 bp linker (CCCGAC) inserted between the enhancer and core promoter, similar to the design used in the D100 promoter.
  2. SV10CP (371 bp) (-352 to +19): The core promoter fragment (also referred to as SVBVFLt10) containing the TATA box (around −30) and the transcription start site (TSS, +1) required for transcription initiation.

The S100 promoter sequence was directly extracted from Figure 1 of Pattanaik et al. (2004), where the nucleotide sequence is explicitly provided in text format, and assembled in this order [SV10UAS] + [CCCGAC linker] + [SV10CP]:

GAAGCCCGCTTTACAAGTGGCCAGCTAGCTATCACTGAAAAGACAGCAAGACAATGGTGTCTCGATGCACCAGAACCACATCTTTGCAGCAGATGTGAAGCAGCCAGAGTGGTCCACAAGACGCACTCAGAAAAGGCATCTTCTACCGACACAGAAAAAGACAACCACAGCTCATCATCCAACATGTAGACTGTCGTTATGCGTCGGCTGAAGATAAGACTGACCCCAGGCCAGCACTAAAGAAGAAATAAcccgacGAAGCCCGCTTTACAAGTGGCCAGCTAGCTATCACTGAAAAGACAGCAAGACAATGGTGTCTCGATGCACCAGAACCACATCTTTGCAGCAGATGTGAAGCAGCCAGAGTGGTCCACAAGACGCACTCAGAAAAGGCATCTTCTACCGACACAGAAAAAGACAACCACAGCTCATCATCCAACATGTAGACTGTCGTTATGCGTCGGCTGAAGATAAGACTGACCCCAGGCCAGCACTAAAGAAGAAATAATGCAAGTGGTCCTAGCTCCACTTTAGCTTTAATAATTATGTTTCATTATTATTCTCTGCTTTTGCTCTCTATATAAAGAGCTTGTATTTTCATTTGAAGGCAGAGGCGAACACACACACA

DaMVFLt4 promoter (556 pb):

The DaMV4CP fragment corresponds to a natural promoter region derived from the Dahlia mosaic virus (DaMV). It consists of a 556 bp sequence spanning positions −474 to +82 relative to the transcription start site (TSS) according to Sahoo et al., (2014) study.

This fragment was directly extracted from the DaMV genome available in the GenBank database (accession: JX272320.1), corresponding to genomic coordinates 6579–7134.

> gb|JX272320.1|:6579-7134 Dahlia mosaic virus clone pDaMV-p2, complete genome

GAATTCAATCCTCCTCAGGAAATGAAGGATTCAGGAGATCTTCTCTATCAACTTGCTCAAGTAAGGACAAACGGGTTCACCCGGATCCTCCAGAAGACCCAGTCTATCAACGGAGAAACAAAGATAAAAATCAATTACTCACATGAAAGAGTATTGATCACGAGTCACTATGGAGCGACAATCTCCAGACAGGATGTCAGCATCTTATCTTCCTTTGAAGAAAGCATCATCAATAACGATGTAATGGTGGGGACATCCACTAAGTTATTGCTCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCTATATAATGGCATTCACCCCTCAGTTGAAGAGCATCAGGAGTTTCAGCATAGAAACTTTCTCTTTAACAAATCTATCTTTTCTTTAAAGCATGTGTGAGTAGAAACCCATATAGGGTTA

SM chimeric hybrid promoter (SUAS + MUAS fusion):

The SM promoter is a synthetic chimeric hybrid promoter constructed by combining regulatory elements from two plant viruses, as described by Kumari et al., (2024). It integrates an upstream activation sequence from Sugarcane bacilliform virus with an enhancer domain from Mirabilis mosaic virus to enhance transcriptional activity.

  1. SUAS ( SCBV Upstream Activation Sequence): This fragment corresponds to the Upstream Activation Sequence (UAS) derived from Sugarcane bacilliform virus (SCBV), as described by Davies et al., (2014). The selected region spans −434 bp to −153 bp relative to the transcription start site (TSS), resulting in a fragment of 282 bp. This region functions as a transcriptional enhancer.
  2. MUAS (MMV Upstream Activation Sequence): This fragment corresponds to the transcriptional enhancer domain derived from the full-length transcript (FLt) promoter of Mirabilis mosaic virus (MMV), as reported by Dey & Maiti, (1999).The sequence spans −297 to −38 relative to the TSS, with a total length of 259 bp, and contributes strong enhancer activity.

To find the first fragment SUAS, I first mapped both boundaries of the 839 bp SCBV promoter using the SCBV-F primer anchor (ATTGAATGG) and the complement of the SCBV-R primer (GAATTACACCTTTCCGCA) against the Sugarcane bacilliform virus (SCBV) Ireng Maleng isolate sequence (accession AJ277091). This allowed me to confirm the full span of the mother fragment from relative coordinate −770 to +69 image image image image Next, I identified the Transcription Start Site (TSS) based on the underlined leader sequence reported in the Figure 2 from the Davies (2014) study. I could identify the TSS (+1) as the 7528th nucleotide in the Sugarcane bacilliform virus (SCBV) Ireng Maleng isolate sequence: 7528 ATC GGTAGTTCAC CACATGAGTA TTTGAGTCAA 7560 image image To isolate the specific SUAS domain for the SM promoter, which the sources define as the segment from relative coordinates −434 to −153, I calculated the internal absolute indices within the 839 bp mother fragment. By mapping these relative coordinates back from the TSS, I determined the exact 282 bp enhancer sequence required to be joined directly to the MMV core promoter to build the chimeric SM promoter:

> emb|AJ277091.1|:7094-7375 Sugarcane bacilliform IM virus complete genome, isolate Ireng Maleng

GAACACCGTTCGAGTGTCATCGACAGGCCAAGGCCAACAGATGATCATTTCAGACCATGGGGGGATGTTACATACTGGCTGAATAAAGAAGCAGAAGAGTGCCACACAAGGGGCGACAACGTCGAAGGCGCAGAAGACGCAGTCGATCTCACTGACGTAAGCAATGACGACCAGTGGAGGAGATCGTAAGCAATGACGTATGGAGCGTGGAGGACCCATGAAAGCACTGAGAAGGCATCTCAACTTTCGGTGTGTGAGTGCGCATCCTATGCGATGCTTTGT

To find the second fragment MUAS, I first identified the source as the Mirabilis mosaic virus (MMV) full-length transcript (FLt) promoter from the Dey and Maiti (1999) article. Because the original study provided the literal nucleotide sequence in Figure 1 rather than a GenBank accession number, I used the printed sequence obtained from Gemini AI tool as my primary reference. image image I then established the Transcription Start Site (TSS or +1) as the anchor point, which the researchers mapped via primer extension to a guanidine (G) residue located 24 nucleotides downstream of the TATATAA box. To isolate the specific MUAS fragment, which spans the relative coordinates −297 to −38, I counted upstream from the TSS to locate the nucleotide at position −297 and extracted the sequence through to the nucleotide at position −38. This process provided the 259 bp enhancer domain required for the construction of the SM and BM chimeric promoters:

TTCGTCCACAGACATCAACATCTTATCGTCCTTTGAAGATAAGATAATAATGTTGAAGATAAGAGTGGGAGCCACCACTAAAACATTGCTTTGTCAAAAGCTAAAAAAGATGATGCCCGACAGCCACTTGTGTGAAGCATGTGAAGCCGGTCCCTCCACTAAGAAAATTAGTGAAGCATCTTCCAGTGGTCCCTCCACTCACAGCTCAATCAGTGAGCAACAGGACGAAGGAAATGACGTAAGCCATGACGTCTAATCCC

The SM promoter was generated by directly fusing the SUAS fragment upstream of the MUAS enhancer sequence, as described by (Kumari et al., 2024a) based on the source sequence described in Dey & Maiti, (1999) study:

GAACACCGTTCGAGTGTCATCGACAGGCCAAGGCCAACAGATGATCATTTCAGACCATGGGGGGATGTTACATACTGGCTGAATAAAGAAGCAGAAGAGTGCCACACAAGGGGCGACAACGTCGAAGGCGCAGAAGACGCAGTCGATCTCACTGACGTAAGCAATGACGACCAGTGGAGGAGATCGTAAGCAATGACGTATGGAGCGTGGAGGACCCATGAAAGCACTGAGAAGGCATCTCAACTTTCGGTGTGTGAGTGCGCATCCTATGCGATGCTTTGTTTCGTCCACAGACATCAACATCTTATCGTCCTTTGAAGATAAGATAATAATGTTGAAGATAAGAGTGGGAGCCACCACTAAAACATTGCTTTGTCAAAAGCTAAAAAAGATGATGCCCGACAGCCACTTGTGTGAAGCATGTGAAGCCGGTCCCTCCACTAAGAAAATTAGTGAAGCATCTTCCAGTGGTCCCTCCACTCACAGCTCAATCAGTGAGCAACAGGACGAAGGAAATGACGTAAGCCATGACGTCTAATCCC

BM chimeric hybrid promoter (BUAS + MUAS fusion):

The BM promoter is a synthetic chimeric hybrid promoter constructed by the fusion of two regulatory elements, as described by (Kumari et al., 2024a). It combines an upstream activation sequence from Banana streak virus with an enhancer domain from Mirabilis mosaic virus to enhance transcriptional efficiency.

  1. BUAS (BSV Upstream Activation Sequence) : This fragment corresponds to the Upstream Activation Sequence (UAS) derived from Banana streak virus (BSV), as reported by Remans et al., (2005). The selected region spans −1150 bp to −33 bp relative to the transcription start site (TSS), resulting in an expected length of approximately 1117 bp. This region functions as a strong transcriptional enhancer.
  2. MUAS (MMV Upstream Activation Sequence): This sequence corresponds to the transcriptional enhancer domain derived from the full-length transcript (FLt) promoter of Mirabilis mosaic virus (MMV). It is identical to the MUAS element used in the SM promoter and contributes additional transcriptional activation capacity.

To find the first fragment BUAS, I first identified the source as the Banana streak virus (BSV) Cavendish isolate, which corresponds to GenBank accession AF215815. Although the current database entry for this accession may show a length of 1,287 bp, I noted that the sources utilize a 1,304 bp synthesized version of this isolate spanning from relative coordinates −1,150 to +154.

Next, I used the BSV-F primer anchor sequence (GGTTGCATGGAAGG) to locate the beginning of the promoter region within the GenBank file. By finding this exact sequence at the very start of the file, I established that Nucleotide 1 of the GenBank entry corresponds to the relative coordinate −1,150. image image I then determined the Transcription Start Site (TSS or +1) by mapping the relative coordinates to the absolute indices of the 1,304 bp sequence. Since there are 1,150 bases upstream of the start site, the TSS is located at Nucleotide 1151. To isolate the specific BUAS domain, which the sources define as the segment from −1,150 to −33, I calculated the end index by subtracting 33 from the TSS (1151−33=1118). Finally, I extracted the sequence from Nucleotide 1 to Nucleotide 1118, which provided the approximately 1,117 bp (mathematically 1,118 bp) enhancer fragment required to construct the BM chimeric promoter:

> gb|AF215815.1|:1-1118 Banana streak virus ORF III polyprotein gene, partial cds

GGTTGCATGGAAGGTTGGGGAGGAGTTTGTAAATGGAAAGAACAATCAGGACAACCAAGATGGTCAGAGAAGATTTGTGCTTATGCGAGTGGAAAGTTTAATCCGATCAAGAGCACAATTGATGCAGAAATTCAAGCAGTCATCAACAGCTTGGATAAATTCAAGATATATTATCTTGATAAAAAGGAGTTGATCATCAGGACGGATAGTCAAGCGATAGTCAGTTTCTACAAGAAGAGTAGTGACCACAAACCCTCAAGGGTAAGATGGTTAGCTTTCACTGACTATATCACTGGAACAGGATTGGATGTGAAGTTTGAGCATATTGACGGCAAGGATAATGTGCTAGCAGACACTCTGTCAAGGCTAGTAAAAATCATATGCCACAAGGAGAAACATCCATCAGAAACAATATTGATCAACGTTGCAGAAGAAATACTTCAGAAAGGAAGTATTGGAGCAAAAAGAAAGTTGGGAGAAATGATAAGTGGATATGAAGCTTGGATGACAAGAATCCAAGAACACAAAATCAAGACACTAACACTTATCGAAAAACCAGTTTTTAAATGTGGTTGCAGGAAACCTGCTAGGCTTCACACGTCCAGGACATCAAGAAATCCGGGAAGAGAATTTTACTCATGTGAAAATAAAGCATGTTTCACTTGGGTATGGAAGGATCAGATTGATGAATACGTTCAAGAAGTGATGACGTGGAACGACCAAGTAAGCCAGTTGCCAGAAGAACCAGAAGGCTACAATGAAGGATGCACGATTGAAGACGCATTCGATCTGCTAGACGTCAGCAATGACGATCAATGGGCAAGGTCGTAAGCCATGACGTAGCGGAAGTGATGGACCCCATACCACTGGATGGCACTAACCAGTGTGACAAGGATACGAGATGCCAAGTGAGCTGGATAGCACTCACTTTATGTAAAGAGTGGTCTGCGTACCAACTCCACTATAGTCTGTCTGAGGTGCGATGCTGTGTCACGCACAAAGACTTTAGATTCCTTTGCGTGAGATGTACGCAAAGCAGTGTGTCCAGAGTGTGCTGTGACGCGTCCCTTGCATTATTGGTGGGTGCACCTAACGATGCGGGAAGCCGAACTCCCTCT

The BM promoter was generated by directly fusing the BUAS fragment upstream of the MUAS enhancer sequence, as described by Kumari et al., (2024):

GGTTGCATGGAAGGTTGGGGAGGAGTTTGTAAATGGAAAGAACAATCAGGACAACCAAGATGGTCAGAGAAGATTTGTGCTTATGCGAGTGGAAAGTTTAATCCGATCAAGAGCACAATTGATGCAGAAATTCAAGCAGTCATCAACAGCTTGGATAAATTCAAGATATATTATCTTGATAAAAAGGAGTTGATCATCAGGACGGATAGTCAAGCGATAGTCAGTTTCTACAAGAAGAGTAGTGACCACAAACCCTCAAGGGTAAGATGGTTAGCTTTCACTGACTATATCACTGGAACAGGATTGGATGTGAAGTTTGAGCATATTGACGGCAAGGATAATGTGCTAGCAGACACTCTGTCAAGGCTAGTAAAAATCATATGCCACAAGGAGAAACATCCATCAGAAACAATATTGATCAACGTTGCAGAAGAAATACTTCAGAAAGGAAGTATTGGAGCAAAAAGAAAGTTGGGAGAAATGATAAGTGGATATGAAGCTTGGATGACAAGAATCCAAGAACACAAAATCAAGACACTAACACTTATCGAAAAACCAGTTTTTAAATGTGGTTGCAGGAAACCTGCTAGGCTTCACACGTCCAGGACATCAAGAAATCCGGGAAGAGAATTTTACTCATGTGAAAATAAAGCATGTTTCACTTGGGTATGGAAGGATCAGATTGATGAATACGTTCAAGAAGTGATGACGTGGAACGACCAAGTAAGCCAGTTGCCAGAAGAACCAGAAGGCTACAATGAAGGATGCACGATTGAAGACGCATTCGATCTGCTAGACGTCAGCAATGACGATCAATGGGCAAGGTCGTAAGCCATGACGTAGCGGAAGTGATGGACCCCATACCACTGGATGGCACTAACCAGTGTGACAAGGATACGAGATGCCAAGTGAGCTGGATAGCACTCACTTTATGTAAAGAGTGGTCTGCGTACCAACTCCACTATAGTCTGTCTGAGGTGCGATGCTGTGTCACGCACAAAGACTTTAGATTCCTTTGCGTGAGATGTACGCAAAGCAGTGTGTCCAGAGTGTGCTGTGACGCGTCCCTTGCATTATTGGTGGGTGCACCTAACGATGCGGGAAGCCGAACTCCCTCTTTCGTCCACAGACATCAACATCTTATCGTCCTTTGAAGATAAGATAATAATGTTGAAGATAAGAGTGGGAGCCACCACTAAAACATTGCTTTGTCAAAAGCTAAAAAAGATGATGCCCGACAGCCACTTGTGTGAAGCATGTGAAGCCGGTCCCTCCACTAAGAAAATTAGTGAAGCATCTTCCAGTGGTCCCTCCACTCACAGCTCAATCAGTGAGCAACAGGACGAAGGAAATGACGTAAGCCATGACGTCTAATCCC

MSD3 chimeric deletion-hybrid promoter (MUAS + SD3):

The MSD3 promoter is a “deletion-hybrid” construct composed of the following two fragments joined directly together as described in the study of (Kumari et al., 2024b):

  1. MUAS (MMV Upstream Activation Sequence): This is the same sequence of the transcriptional enhancer domain isolated from the Mirabilis mosaic virus (MMV) full-length transcript (FLt) promoter, as used in SM and BM promoters.
  2. SD3 (SCBV Deletion Fragment 3): This fragment is a truncated promoter region derived from the Sugarcane bacilliform virus (SCBV), as described by Davies et al., 2014. The SD3 sequence corresponds to the region spanning −340 bp to +69 bp relative to the transcription start site, resulting in a fragment of 409 bp. This region retains essential core promoter elements required for basal transcription. The SD3 fragment was extracted from the SCBV genome (GenBank accession: AJ277091.1, positions 7188–7597):
emb|AJ277091.1|:7188-7597 Sugarcane bacilliform IM virus complete genome, isolate Ireng Maleng

AAGAGTGCCACACAAGGGGCGACAACGTCGAAGGCGCAGAAGACGCAGTCGATCTCACTGACGTAAGCAATGACGACCAGTGGAGGAGATCGTAAGCAATGACGTATGGAGCGTGGAGGACCCATGAAAGCACTGAGAAGGCATCTCAACTTTCGGTGTGTGAGTGCGCATCCTATGCGATGCTTTGTACCTTTGTTAGCTGTGTGTGTCCTTTTGGCATCTGTGCCACTTTACCTTTGTCGGCCACGTTGCCTTTGCTTAGCATCTACGCAAGCATAGCGCTCGGCTGGTGTGTGTTCCCTCTGCCTATATAAGGCATGGTTGTATGACTCTTACACTCATCGGTAGTTCACCACATGAGTATTTGAGTCAAGTTTGGCTTGAATAATAAGAATTACACCTTTCCGCAA

The final MSD3 promoter was obtained by direct assembly of the MUAS enhancer upstream of the SD3 core promoter fragment:

TTCGTCCACAGACATCAACATCTTATCGTCCTTTGAAGATAAGATAATAATGTTGAAGATAAGAGTGGGAGCCACCACTAAAACATTGCTTTGTCAAAAGCTAAAAAAGATGATGCCCGACAGCCACTTGTGTGAAGCATGTGAAGCCGGTCCCTCCACTAAGAAAATTAGTGAAGCATCTTCCAGTGGTCCCTCCACTCACAGCTCAATCAGTGAGCAACAGGACGAAGGAAATGACGTAAGCCATGACGTCTAATCCCAAGAGTGCCACACAAGGGGCGACAACGTCGAAGGCGCAGAAGACGCAGTCGATCTCACTGACGTAAGCAATGACGACCAGTGGAGGAGATCGTAAGCAATGACGTATGGAGCGTGGAGGACCCATGAAAGCACTGAGAAGGCATCTCAACTTTCGGTGTGTGAGTGCGCATCCTATGCGATGCTTTGTACCTTTGTTAGCTGTGTGTGTCCTTTTGGCATCTGTGCCACTTTACCTTTGTCGGCCACGTTGCCTTTGCTTAGCATCTACGCAAGCATAGCGCTCGGCTGGTGTGTGTTCCCTCTGCCTATATAAGGCATGGTTGTATGACTCTTACACTCATCGGTAGTTCACCACATGAGTATTTGAGTCAAGTTTGGCTTGAATAATAAGAATTACACCTTTCCGCAA

M24 synthetic promoter (MMV-derived):

The M24 promoter is a synthetic high-expression promoter derived from the Mirabilis mosaic virus (MMV), as described by (Sahoo et al., 2014). It was engineered to enhance transcriptional activity in plant systems. Based on the full-length transcript (FLt) promoter of MMV, the promoter was enhanced by duplication of upstream enhancer domains, leading to a significant increase in transcriptional strength.

The M24 promoter sequence was retrieved from the binary vector pSiM24 available in GenBank (accession: KF032933.1). The promoter corresponds to the region spanning positions 235–860 of the vector sequence.

KF032933.1:235-860 Binary vector pSiM24, complete sequence

TTCGTCCACAGACATCAACATCTTATCGTCCTTTGAAGATAAGATAATAATGTTGAAGATAAGAGTGGGAGCCACCACTAAAACATTGCTTTGTCAAAAGCTAAAAAAGATGATGCCCGACAGCCACTTGTGTGAAGCATGTGAAGCCGGTCCCTCCACTAAGAAAATTAGTGAAGCATCTTCCAGTGGTCCCTCCACTCACAGCTCAATCAGTGAGCAACAGGACGAAGGAAATGACGTAAGCCATGACGTCTAATCCCCCCAACTTCGTCCACAGACATCAACATCTTATCGTCCTTTGAAGATAAGATAATAATGTTGAAGATAAGAGTGGGAGCCACCACTAAAACATTGCTTTGTCAAAAGCTAAAAAAGATGATGCCCGACAGCCACTTGTGTGAAGCATGTGAAGCCGGTCCCTCCACTAAGAAAATTAGTGAAGCATCTTCCAGTGGTCCCTCCACTCACAGCTCAATCAGTGAGCAACAGGACGAAGGAAATGACGTAAGCCATGACGTCTAATCCCACAAGAATTTCCTTATATAAGGAACACAAATCAGAAGGAAGAGATCAATCGAAATCAAAATCGGAATCGAAATCAAAATCGGAATCGAAATCTCTCATCT

PClSV FLt promoter (Peanut chlorotic streak caulimovirus):

The PClSV FLt promoter is a constitutive plant promoter derived from the Peanut chlorotic streak caulimovirus. It is composed of a basic full-length transcript (FLt) promoter region and upstream enhancer elements, which can be arranged in single or duplicated configurations to modulate transcriptional strength.

The promoter elements were identified from the PClSV genome (GenBank accession: U13988.1) as follows:

  1. Basic FLt promoter (core region): Spans positions 5852–6101 (~250 bp) and contains essential elements required for transcription initiation
> gb|U13988.1|PCU13988:5852-6101 Peanut chlorotic streak caulimovirus, complete genome
GAGATCTTGAGCCAATCAAAGAGGAGTGATGTAGACCTAAAGCAATAATGGAGCCATGACGTAAGGGCTTACGCCATTACGAAATAATTAAAGGCTGATGTGACCTGTCGGTCTCTCAGAACCTTTACTTTTTATATTTGGCGTGTATTTTTAAATTTCCACGGCAATGACGATGTGACCTGTGCATCCGCTTTGCCTATAAATAAGTTTTAGTTTGTATTGATCGACACGATCGAGAAGACACGGCCAT
  1. Enhancer element: A 178 bp upstream regulatory sequence (5852–6029) responsible for increasing transcriptional activity
> gb|U13988.1|PCU13988:5852-6029 Peanut chlorotic streak caulimovirus, complete genome
GAGATCTTGAGCCAATCAAAGAGGAGTGATGTAGACCTAAAGCAATAATGGAGCCATGACGTAAGGGCTTACGCCATTACGAAATAATTAAAGGCTGATGTGACCTGTCGGTCTCTCAGAACCTTTACTTTTTATATTTGGCGTGTATTTTTAAATTTCCACGGCAATGACGATGTGA

The assembled PClSV FLt promoter [Enhancer] + [Core promoter] sequence:

GAGATCTTGAGCCAATCAAAGAGGAGTGATGTAGACCTAAAGCAATAATGGAGCCATGACGTAAGGGCTTACGCCATTACGAAATAATTAAAGGCTGATGTGACCTGTCGGTCTCTCAGAACCTTTACTTTTTATATTTGGCGTGTATTTTTAAATTTCCACGGCAATGACGATGTGAGAGATCTTGAGCCAATCAAAGAGGAGTGATGTAGACCTAAAGCAATAATGGAGCCATGACGTAAGGGCTTACGCCATTACGAAATAATTAAAGGCTGATGTGACCTGTCGGTCTCTCAGAACCTTTACTTTTTATATTTGGCGTGTATTTTTAAATTTCCACGGCAATGACGATGTGACCTGTGCATCCGCTTTGCCTATAAATAAGTTTTAGTTTGTATTGATCGACACGATCGAGAAGACACGGCCAT

Double enhancer PCisV FLt promoter:

Based on (Maiti & Shepherd, 1998), the double enhancer configuration was constructed by duplicating the enhancer region upstream of the core promoter: [Enhancer] + [Enhancer] + [Core promoter] (~428 bp)

The PClSV FLt promoter sequence was reconstructed from GenBank (U13988.1) and assembled in a double enhancer configuration based on the design described by Maiti & Shepherd (1998):

GAGATCTTGAGCCAATCAAAGAGGAGTGATGTAGACCTAAAGCAATAATGGAGCCATGACGTAAGGGCTTACGCCATTACGAAATAATTAAAGGCTGATGTGACCTGTCGGTCTCTCAGAACCTTTACTTTTTATATTTGGCGTGTATTTTTAAATTTCCACGGCAATGACGATGTGAGAGATCTTGAGCCAATCAAAGAGGAGTGATGTAGACCTAAAGCAATAATGGAGCCATGACGTAAGGGCTTACGCCATTACGAAATAATTAAAGGCTGATGTGACCTGTCGGTCTCTCAGAACCTTTACTTTTTATATTTGGCGTGTATTTTTAAATTTCCACGGCAATGACGATGTGAGAGATCTTGAGCCAATCAAAGAGGAGTGATGTAGACCTAAAGCAATAATGGAGCCATGACGTAAGGGCTTACGCCATTACGAAATAATTAAAGGCTGATGTGACCTGTCGGTCTCTCAGAACCTTTACTTTTTATATTTGGCGTGTATTTTTAAATTTCCACGGCAATGACGATGTGACCTGTGCATCCGCTTTGCCTATAAATAAGTTTTAGTTTGTATTGATCGACACGATCGAGAAGACACGGCCAT

The double enhancer configuration of the PClSV FLt promoter results in an approximately threefold increase in transcriptional activity compared to the single enhancer version. Overall, this promoter exhibits strong constitutive expression in transgenic plants, with activity levels reported to be comparable to the FLt promoter of the Figwort mosaic virus and functionally similar to the widely used CaMV 35S promoter, making it a robust alternative for high-level gene expression in plant systems.

CVP1 and CVP2 promoters (Cassava vein mosaic virus, CsVMV):

The CVP1 and CVP2 promoters are constitutive plant promoters derived from the Cassava vein mosaic virus (CsVMV), as described by Verdaguer et al., (1996) and Verdaguer et al., (1998) based on the reference genome reported by Calvert et al., (1995). These promoters correspond to two fragments of different lengths within the viral genome and differ in their regulatory strength.

  • CVP1 (short fragment): corresponds to a 388 bp fragment spanning nucleotides 7235 to 7623, which maps to the region −368 to +20 relative to the transcription start site (TSS).
  • CVP2 (long fragment): represents a longer 511 bp fragment extending from nucleotides 7160 to 7675, corresponding to positions −443 to +72 relative to the TSS.

Both fragments contain core promoter elements, including the TATA box and upstream regulatory motifs, with CVP2 retaining additional upstream sequences that enhance transcriptional activity.

The sequences were directly retrieved from the CsVMV reference genome (GenBank accession: U20341.1) using the genomic coordinates reported in the original studies:

CPV 1 :

>gb|U20341.1|CVU20341:7235-7623 Cassava vein mosaic virus, complete genome

GCTCAGCAAGAAGCAGATCAATATGCGGCACATATGCAACCTATGTTCAAAAATGAAGAATGTACAGATACAAGATCCTATACTGCCAGAATACGAAGAAGAATACGTAGAAATTGAAAAAGAAGAACCAGGCGAAGAAAAGAATCTTGAAGACGTAAGCACTGACGACAACAATGAAAAGAAGAAGATAAGGTCGGTGATTGTGAAAGAGACATAGAGGACACATGTAAGGTGGAAAATGTAAGGGCGGAAAGTAACCTTATCACAAAGGAATCTTATCCCCCACTACTTATCCTTTTATATTTTTCCGTGTCATTTTTGCCCTTGAGTTTTCCTATATAAGGAACCAAGTTCGGCATTTGTGAAAACAAGAAAAAATTTGGTGTAAG

CPV 2 :

>gb|U20341.1|CVU20341:7160-7675 Cassava vein mosaic virus, complete genome

TCCAGAAGGTAATTATCCAAGATGTAGCATCAAGAATCCAATGTTTACGGGAAAAACTATGGAAGTATTATGTGAGCTCAGCAAGAAGCAGATCAATATGCGGCACATATGCAACCTATGTTCAAAAATGAAGAATGTACAGATACAAGATCCTATACTGCCAGAATACGAAGAAGAATACGTAGAAATTGAAAAAGAAGAACCAGGCGAAGAAAAGAATCTTGAAGACGTAAGCACTGACGACAACAATGAAAAGAAGAAGATAAGGTCGGTGATTGTGAAAGAGACATAGAGGACACATGTAAGGTGGAAAATGTAAGGGCGGAAAGTAACCTTATCACAAAGGAATCTTATCCCCCACTACTTATCCTTTTATATTTTTCCGTGTCATTTTTGCCCTTGAGTTTTCCTATATAAGGAACCAAGTTCGGCATTTGTGAAAACAAGAAAAAATTTGGTGTAAGCTATTTTCTTTGAAGTACTGAGGATACAACTTCAGAGAAATTTGTAAGTTTG

Functional analyses have demonstrated that CVP2 exhibits expression levels comparable to the enhanced CaMV 35S promoter (e35S), whereas CVP1 shows approximately half of this activity, indicating that CVP2 is about twofold more active than CVP1. These results highlight the importance of additional upstream regulatory sequences in driving stronger gene expression in plant systems.

FMV Sgt (34S) promoter (Figwort mosaic virus):

The Sgt (34S) promoter is a subgenomic promoter derived from the Figwort mosaic virus (FMV). It is located between ORF V and ORF VI and is responsible for driving the expression of ORF VI via a subgenomic transcript. According to (Bhattacharyya et al., 2002) , a 301 bp fragment spanning −270 to +31 relative to the transcription start site (TSS) provides maximal promoter activity. The promoter sequence was extracted from the published figure using an AI tool (Gemini), as it was only available in image format: image image

TTTACAGTAAGAACTGATAACAAAAATTTTACTTATTTCCTTAGAATTAATCTTAAAGGTGATAGTAAACAAGGACGATTAGTCCGTTGGCAAAATTGGTTCAGCAAGTATCAATTTGATGTCGAACATCTTGAAGGTGTAAAAAACGTTTTAGCAGATTGCCTCACGAGAGATTTTAATGCTTAAAAACGTAAGCGCTGACGTATGATTTCAAAAAACGCAGCTATAAAAGAAGCCCTCCAGCTTCAAAGTTTTCATCAACACAAATTCTAAAAACAAAATTTTTAGAGAGGGGGAGTG

PTSB1 promoter (Arabidopsis thaliana):

The PTSB1 promoter is a constitutive plant promoter I derived from the Arabidopsis thaliana tryptophan synthase β-subunit gene (TSB1). I identified this as a powerful alternative to the CaMV 35S promoter for high-level gene expression in tobacco (Shirasawa-Seo et al. 2002).

I retrieved this promoter from GenBank accession M23872, corresponding to a 1.5 kb fragement. I defined the exact boundaries of this fragment by mapping the reported PCR primers directly onto the reference sequence (Shirasawa-Seo et al. 2002):

  • 5’ Border (Forward primer): GAATTCTTTCATATCTCCTGCAAAGT
  • 3’ Border (Reverse primer): TCAGAGAGAGATTCATTCAGTA (This is the reverse complement of the primer sequence TACTGAATGAATCTCTCTCTGA listed in the sources.) image image image image The resulted extracted sequence of PTSB1 promoter:
GAATTCTTTCATATCTCCTGCAAAGTTCTTGATATCAATACTCCAGCAGTAACTAAGACTTAGACTCTTGAGCGTAGGAGAGTTTGATAACAAAGACTCGGCCTCTGTGAGCTTGATCCAACCAATAGAGAGCTTTCTAGGCAATCCCGAGTTTTTGAACTTGGAGGGATCAAGCCCACACGCGTAAATCTTTAGTGATTCGAGATTTGTGTTTAAAATCCGAATTAAAACCTAATCAAATTAAAACTAAACCAAACCAAATACAATCCAAAATTAAACTAATTTTGGTTGAGTTTGGTTATAGTTTTACTAAATCCAAATTAACAGAACATAACCAAACCCGAAGATTTTTAGAGTCTTTAGAATTTTAAGGTGATTTTAGATAAAAGAGATTAAACACAAATCTCGAAAACTAAAGAAAGAGTTTTTGAAAATTTTTAAGTGTTTTCATGTAAAGTGGATTTCTCTGTGTTTTCTGCATTCTGCGGATTATAACTCCTATGTTTTTTTTCTCCGTCAATTATATGTGTTTATTTTCTCTATTTTCTTTTATTTTTATTTTTATTCTCTATATTAGGGTTTAGTTTATGAAAACTTTTTGTTATCTATATAGGCTTGGGGGATGTATTTAAATTAGAATTTAAAGTGATTTGAGTTCTTTGAGTTTTTAAATAATTTTAACGATTTTAAAAAAGTTCGTATGATTTTTGTAAAATCTATTAAAATCTCACCTTAAATCATGGGATTTGGATTTCTGTATTTTGAACTAAGAAAATCCTCTCAAATCCTCCAAAATCATTAAAATTCAAATCCACAAATTGTTCTGAATAACAGTGAATTTTAAGGTGGATTTTGAAATAATTAGTTCAATAACACTGAATTTCATGAGATTTTTTAAAATACATGTTTGAATAACATATGATTTATAAATTCTACACAAATCTTTTAAAATTCTAATTTCAATACATTGTTTTTGAAAGTGTTATTGACTCTTGCCAATATAGTATCCCAATTCCCAACTTGTGTTTCATTTTTTCATCTATCTAATAAACAATTAGATGAACACAAAAAAATATTGGTAGGTGATGGCTCAATTGGATATGTTTTTGAAAACCATGTGTTAAAAACTTAAAATACTATCCAACTTACCCCAGTCCTACCAACTTTTTTTTTCTTCTCTTGGTCTGCTTACATGTGTCTGCTTATATCTCCAAAAGGAAATAGATATATAAAAATTCAAATTTAAATATTTGCGATTTGTTAAATTTTAATCAATATTTAATTTTTGTTTTTTTTTGTTTTTTTTTATGAAGACAACAAATAACCAAATTTATCAAATCTGATCAAAGCAGATTTAGGATTTTACAAATATATTTTTTTAATATGAATTTTGTGGTCAGATTTTGACCAATTCTCTTTGAAAAAAAAAAAAATCTATCTATAAAAACATGTGTTACTTTGAAAGGATATTTCAAGGAGAAGAATATATTTGACTCAGAGAGAGATTCATTCAGTA

This region contains the core promoter and upstream regulatory elements responsible for its strong constitutive activity. This promoter exhibited approximately 2.4-fold higher expression than the CaMV 35S promoter in mature tobacco leaves, with activity increasing in lower leaf positions (Shirasawa-Seo et al. 2002).

PPHYB promoter (Arabidopsis thaliana):

The PPHYB promoter is a constitutive promoter derived from the Arabidopsis thaliana phytochrome B (PHYB) gene (Goosey et al. 1997; Shirasawa-Seo et al. 2002).

I retrieved this sequence from GenBank accession L09262, which corresponds to a 2.3 kb fragment. The promoter boundaries were defined by mapping the experimentally reported primers onto the sequence (Shirasawa-Seo et al. 2002):

  • 5’ Border (Forward primer): GTCGACTTGTGCACCACCGTCT
  • 3’ Border (Reverse primer): CGGAGAAGAAGAACCGTCGTCA (This is the reverse complement of the primer sequence TGACGACGGTTCTTCTTCTCCG listed in the sources.) image image image image The resulted extracted sequence of PPHYB promoter:
GTCGACTTGTGCACCACCGTCTAAGCTAACAAGTTGACCTAAACGCTCTATGGGATTAGGGTTTAGTAGATTGAGACTGAATAAAGAAACCCTAAAATCGAGCATCATCACAACATGAAACTCCTTACTCTGCTTCTTCTTTGCTTCTTCTTTATCGATGTGCTTCCTTGTAAAAGACATATCTTTGGATAAAGTGTTCAACTTTTTGCATGTGAATCGTACTCTTCTCAGAGATGTCACTGGAAACTTCGAGAGCACCTCCTCCGCCACATCCTTTGGAAGATCCGAGAGCATCGTCGTTGATTGTTTTTGCATATCGAAGAAATTTTACTTTACCTTTTACTCTGATTTCTTCAGAGATTATGAGAGAACGAACACTTCAGAAATGTTAGATGTTTCTAAATTGGGCTTGGGCTTTAAAGTATTACCCAAAGGCTATTAAAGTCGTTTTTTCCAATTTGGGCTCCTGATTTATTAGTATGGGAGGGCTTAGTTTTGGGCTTTAAAGTATGCCCCAATGCCTAATAATGTCTAGCTAGTTCTTCGTTATACTAAAGAACGAATTTTGGAAATTCTTGAATTACGATTGTACCCTTATATTAATTTCATCTTTTGTCTTATTCTTATTTATGCAAAAGTTATGCAAAAGTTTTAAGAAATTAGCAGCCAAGCCTAAAGAATCATTGAGAGTTTATAAGGGTGATTTGGTAATTGAGTAGTTTATTAGCTAATTTGATTTCAGTGGCACGTGGTAAATTACTGGTGGTTTAAAACTATTGTACGTGGACGATTCTTAGCCAACGAACTAGTACACTCTAGTGCGAACAGGTACATGATTAAATTCGTGGACATCCAATCATATCTCGTCCAAGATAAGACCAAAACATATGAGGTCATTACTCACTAATAAACATTTAAACTTTTGTTTTGTCAACGAATAGTGTGTTTTTCTTTTGTCATTCCAATTTTTTTCTGTTTTCTTTTCACTATTCACTTTTGGTCCATAATATTTTATGGGTATATAAGATAATCGTTTTTGTCTTCATACATGGTAACATGGATGTTTATATATGTAATAGTGTTAAAAAGAAAAAGTGGTCGGTTATACTTAACTTATTATGATAGAGCTTTGAAAACAAACAACACGAGATGGAGAAATTAGTCATTCAACAAAAGAAAAGGACGAACGCAGTGACTTAACATGAAACTGTGAGCGGCCCAAAATCATTTATGTAATGGACCCTTAACTTTTCATGCACACGATTTTTCTCATTTATATGTTTTTCTGCTCTCTTTTTTTCCTCTTTATCATTACTTTAATTTATTTTATGTTCTTTTTTCGAAGCACCATAATTGTATGCTTTCACCAAATAATCCAAATTTAGAATCATTAATATGTCAAAAAAGAATTGCATATATTCAATAAAACGTAATGCTAAGTAGTACAATGCATGTATTATACAAAATGTAATGATATAGATCCAACGTATATATCAAAGTGGACCAAAATATATCTTATGTATTAGACGAGTTTACTATGCAAAATTTATGATTCTATTCCGCATGGAGCGTGCTAATACTACTTCGAACCCCTTTGAGACCAATATGTGATTCTATATTCTATCTAGTACAAATTATGAGAAGTATATACGTACGATGAGAGTATAAAACATTTCAATATTTGTATAGAGAGGACACCACTTGGTTGACTTGACCCACGATAAGATATTGAAGAAACCAAACTTGTATAGTACGAATTCGAAATCGTAATTGATGATGCGATTCGACAAGTCCAGGGGCTCCCTCCCACGCGCAATGGGCCCAGCAACCACGTGTGGCCACTAGAGAGAATAAACCATTAGCCCACGTGATCTTGGGCCCAATCAATCTCTCCCTCACATTAAACGACAAAACAAAAGCTCTTCTGGGTTAAATTGATAAATATCAAAACTTTAAAGGTAATTTGCTAAAATCGCCACACAAAAAAAGTCGCAGAAAATATATGAGGAAACAAAAAGCGAAGACGACAAAAAAAAAAAAAACTCTGATTTTTTTTTGTTATCTCTCTCTATCTGAGAGGCACACATTTTGCTTCGTCTTCTTCAATTTATTTTATTGGTTTCTCCACTTATCTCCGATCTCAATTCTCCCCATTTTCTTCTTCCTCAAGTTCAAAATTCTTGAGAATTTAGCTCTACCAGAATTCGTCTCCGATAACTAGTGGATGATGATTCACCCTAAATCCTTCCTTGTCTCGAGGTAATTCTGAGAAATTTCTCAAATTCAAAATCAAACGGCATGGTTTCCGGAGTCGGGGGTAGTGGCGGTGGCCGTGGCGGTGGCCGTGGCGGAGAAGAAGAACCGTCGTCA

This fragment includes the core promoter and regulatory regions required for stable expression. Functionally, PPHYB provides approximately 1.5-fold higher expression than the CaMV 35S promoter in mature tobacco leaves, with a more uniform expression pattern across leaf positions compared to PTSB1 (Shirasawa-Seo et al. 2002).

PNCR promoter (Soybean chlorotic mottle virus):

The PNCR promoter is a viral-derived constitutive promoter isolated from the large noncoding region of the Soybean chlorotic mottle virus (Conci et al. 1993). Based on the reported genome size (~8,175 bp), I identified the corresponding genomic sequence and retrieved it from GenBank accession X15828.2. I then defined the functional ~486 bp promoter fragment by mapping the reported PCR primers onto the genome (Conci et al. 1993):

  • 5’ Border (Forward primer): ATGTAGGACATGCCAGCTGTAA
  • 3’ Border (Reverse primer): CAAGCACAAGAGAAAAGAAAGG (Note: This is the reverse complement of the primer sequence CCGGATCCTTTCTTTTCTCTTGTGCTTG provided in the source, after removing the restriction enzyme site.): image image image image
    The extracted sequence of PNCR promoter:
ATGTAGGACATGCCAGCTGTAAAAGAAAGCTCACCTACTAATATGTGGTAGTGGACGCTTTACTTTATTAAAAGTGGTTGGTCAGTAATAATGTAAGACCCCACTTCTTTTCTTTTGCTTGCACGCGAAGGATGCCGCTCTACCCAGTTGTTAAGGCACCTATCGCATTATAAATAAGAGACCAAGGACTCTATTGTTCCTTGGAGTTTGATTGAGTAAGGAATATAGCCAATAGTGCCGTGTAAGGCCAAGTGCTTTTATCCATTTACACTCACTCCCAGTCGGTGGTTTAAAAACCTGGACCGGCAAAGTCGAGAGACTCTAAATTAGAAAAGGAGAAGTCCTTTATACTATCAAACAAGGAGAGATCCTAAATCTAAACACAAAATCCTTTATGAATAAGAAATTGTTCCAGCAACTACCAAGTCTTAAAAAGACCCAGGAAGCAAAAGCAAAGCAAGAACAAGCACAAGAGAAAAGAAAGG

This region contains key regulatory features including a TATA box, CAAT-like motifs, and multiple enhancer-related elements. Functionally, this promoter exhibits approximately five-fold higher expression than the CaMV 35S promoter in tobacco protoplasts (Conci et al. 1993), while showing moderate constitutive activity (~67% of P35S) in mature leaves (Shirasawa-Seo et al. 2002).

FMV promoter (Figwort mosaic virus):

The FMV promoter is a constitutive viral promoter derived from the Figwort mosaic virus genome. In this work, I used the promoter sequence obtained directly from the supplementary Benchling file provided in (Shakhova et al., 2022):

tcatcaaaatatttagcagcattccagattgggttcaatcaacaaggtacgagccatatcactttattcaaattggtatcgccaaaaccaagaaggaactcccatcctcaaaggtttgtaaggaagaattctcagtccaaagcctcaacaaggtcagggtacagagtctccaaaccattagccAaaagctacaggagatcaatgaagaatcttcaatcaaagtaaactactgttccagcacatgcatcatggtcagtaagtttcagaaaaagacatccaccgaGgacttaaagttagtgggcatctttgaaagtaatcttgtcaacatcgagcagctggcttgtggggaccagacaaaaaaggaatggtgcagaattgttaggcgcacctaccaaaagcatctttgcctttattgcaaagataaagcagattcctctagtacaagtggggaacaaaataacgtggaaaagagctgtcctgacagcccactcactaatgcgtatgacgaacgcagtgacgaccacaaaagaattccctctatataagaaggcattcattcccatttgaaggatcatcagatactGaaccaatatttctc

To verify its genomic origin, I performed a BLAST analysis using the NCBI nblast, and obtained a 100% sequence match corresponding to coordinates 6358 to 6955 of the reference genome (GenBank accession NC_003554.1), confirming the exact location of the promoter fragment within the FMV genome. According to (Shakhova et al., 2022), the FMV promoter exhibited lower activity compared to the CaMV 35S promoter under their experimental conditions, indicating that while it remains a functional constitutive promoter, it is not as strong as p35S in this specific system.

p35S (CAMV 35S promoter):

The p35S promoter is a canonical constitutive promoter derived from the Cauliflower mosaic virus and is one of the most widely used regulatory elements in plant biotechnology.

In my study, I used the specific p35S sequence provided in the supplementary Benchling file of (Shakhova et al., 2022):

tgagacttttcaacaaaggataatttcgggaaacctcctcggattccattgcccagctatctgtcacttcatcgaaaggacagtagaaaaggaaggtggctcctacaaatgccatcattgcgataaaggaaaggctatcattcaagatctctctgccgacagtggtcccaaagatggacccccacccacgaggagcatcgtggaaaaagaagaggttccaaccacgtctacaaagcaagtggattgatgtgacatctccactgacgtaagggatgacgcacaatcccactatccttcgcaagacccttcctctatataaggaagttcatttcatttggagaggaca

pAtUBQ10 promoter (Arabidopsis thaliana):

The pAtUBQ10 promoter (version 0.8) is a strong constitutive plant promoter derived from the Arabidopsis thaliana ubiquitin-10 gene (At4g05320). In this work, I used the exact ~800 bp upstream fragment as characterized in (Shakhova et al., 2022).

I obtained the sequence directly from the supplementary Benchling file provided in the study, ensuring that the construct corresponds precisely to the experimentally validated version used for expression analysis:

tgggacccacggttcaattattgccaattttcagctccaccgtatatttaaaaaataaaacgataatgctaaaaaaatataaatcgtaacgatcgttaaatctcaacggctggatcttatgacgaccgttagaaattgtggttgtcgacgagtcagtaataaacggcgtcaaagtggttgcagccggcacacacgagtcgtgtttatcaactcaaagcacaaatacttttcctcaacctaaaaataaggcaattagccaaaaacaactttgcgtgtaaacaacgctcaatacacgtgtcattttattattagctattgcttcaccgccttagctttctcgtgacctagtcgtcctcgtcttttcttcttcttcttctataaaacaatacccaaagagctcttcttcttcacaattcagatttcaatttctcaaaatcttaaaaactttctctcaattctctctaccgtgatcaaggtaaatttctgtgttccttattctctcaaaatcttcgattttgttttcgttcgatcccaatttcgtatatgttctttggtttagattctgttaatcttagatcgaagtcgattttctgggtttgatcgttagatatcatcttaattctcgattagggtttcatagatatcatccgatttgttcaaataatttgagttttgtcgaataattactcttcgatttgtgatttctatctagatctggtgttagtttctagtttgtgcgatcgaatttgtcgattaatctgagtttttctgattaaca

This fragment represents the regulatory region immediately upstream of the translation start site and includes key cis-regulatory elements responsible for its constitutive activity.

Functionally, in Nicotiana systems, this promoter provides high and stable expression levels, outperforming several endogenous plant promoters such as pAtAct2, pAtTCTP, and pAtPD7 (Shakhova et al., 2022). Although its activity is lower than the viral Cauliflower mosaic virus 35S promoter, it shows comparable expression strength to other viral promoters such as Figwort mosaic virus (FMV) and Cotton leaf curl Multan virus (CmYLCV), making it a reliable and predictable option for high-level gene expression in both Nicotiana benthamiana leaves and tobacco BY-2 cell packs.

pAtAct2 promoter (Arabidopsis thaliana):

The pAtAct2 promoter is a constitutive plant promoter derived from the Arabidopsis thaliana actin 2 gene (AT3G18780). In this work, I used the specific version characterized in (Shakhova et al., 2022).

I obtained the sequence directly from the supplementary Benchling file provided in the study, ensuring that the construct corresponds exactly to the experimentally tested version. In this configuration, the native promoter was fused to the 5′UTR omega sequence of the Tobacco mosaic virus (TMV), a common modification used to enhance translation efficiency in Nicotiana expression systems:

tcgacaaaatttagaacgaacttaattatgatctcaaatacattgatacatatctcatctagatctaggttatcattatgtaagaaagttttgacgaatatggcacgacaaaatggctagactcgatgtaattggtatctcaactcaacattatacttataccaaacattagttagacaaaatttaaacaactattttttatgtatgcaagagtcagcatatgtataattgattcagaatcgttttgacgagttcggatgtagtagtagccattatttaatgtacatactaatcgtgaatagtgaatatgatgaaacattgtatcttattgtataaatatccataaacacatcatgaaagacactttctttcacggtctgaattaattatgatacaattctaatagaaaacgaattaaattacgttgaattgtatgaaatctaattgaacaagccaaccacgacgacgactaacgttgcctggattgactcggtttaagttaaccactaaaaaaacggagctgtcatgtaacacgcggatcgagcaggtcacagtcatgaagccatcaaagcaaaagaactaatccaagggctgagatgattaattagtttaaaaattagttaacacgagggaaaaggctgtctgacagccaggtcacgttatctttacctgtggtcgaaatgattcgtgtctgtcgattttaattatttttttgaaaggccgaaaataaagttgtaagagataaacccgcctatataaattcatatattttcctctccgctttgaatactgtatttttac

Functionally, although pAtAct2 is historically described as a strong constitutive promoter in Arabidopsis, the results of (Shakhova et al., 2022) show that it exhibits relatively low activity in tobacco systems. When compared to the 0.4 kb version of the Cauliflower mosaic virus 35S promoter (p35S) used as the reference in this study, pAtAct2 ranks among the weakest promoters in the tested set. This indicates that, despite its native strength in Arabidopsis, pAtAct2 behaves as a moderate-to-low strength promoter in Nicotiana, even after optimization via the TMV omega 5′UTR fusion.

NOS promoter (Agrobacterium tumefaciens nopaline synthase):

The NOS promoter is a constitutive plant promoter derived from the nopaline synthase (nos) gene of Agrobacterium tumefaciens, and is widely used in plant transformation vectors for moderate gene expression.

In this work, I retrieved the NOS promoter sequence from GenBank entry AF485783.1, corresponding to the binary vector pBI121, using the coordinates 2519 to 2825. This fragment represents the regulatory region upstream of the nos gene as commonly implemented in plant expression constructs.

The sequence was directly extracted from the annotated GenBank record, ensuring consistency with a well-established and experimentally validated vector backbone frequently used in plant biotechnology.

>AF485783.1:7727-7979 Binary vector pBI121, complete sequence

GATCGTTCAAACATTTGGCAATAAAGTTTCTTAAGATTGAATCCTGTTGCCGGTCTTGCGATGATTATCATATAATTTCTGTTGAATTACGTTAAGCATGTAATAATTAACATGTAATGCATGACGTTATTTATGAGATGGGTTTTTATGATTAGAGTCCCGCAATTATACATTTAATACGCGATAGAAAACAAAATATAGCGCGCAAACTAGGATAAATTATCGCGCGCGGTGTCATCTATGTTACTAGATC

Functionally, the NOS promoter is considered a moderate-to low strength constitutive promoter, typically weaker than strong viral promoters such as the Cauliflower mosaic virus 35S promoter, but valued for its stable and reliable expression across different plant tissues.

PromoterOriginRelative Strength vs. CaMV 35SKey Advantage / NoteSource
TobUbi.u4Nicotiana tabacum (polyubiquitin)~7× strongerNative to tobacco; excellent stability for long-term expressionGenschik et al., 1994 (GenBank: X77456.1)
D100Synthetic (Dahlia mosaic virus)~2.2× strongerOne of the strongest synthetic promoters validated in tobaccoKhadanga et al., 2021; Sahoo et al., 2015
MSD3Synthetic chimeric (MMV + SCBV)~1.15× strongerWorks in both monocots and dicots; stable in tobaccoKumari et al., 2024; Dey & Maiti, 1999
DaMVFLt4Dahlia mosaic virus~5× strongerVery high activity in protoplasts and transgenic plantsSahoo et al., 2014; GenBank: JX272320.1
M24MMV-derived~10× strongerExtremely strong promoter with enhanced duplicated domainsSahoo et al., 2014
S100Synthetic (Strawberry vein banding virus)~1.8× strongerStrong synthetic alternative; slightly weaker than D100Khadanga et al., 2021; Pattanaik et al., 2004
SMSynthetic chimeric (SCBV + MMV)~2.1× strongerHighly effective in dicots like tobaccoKumari et al., 2024; Davies et al., 2014
BMSynthetic chimeric (BSV + MMV)~1.72× strongerGood alternative synthetic promoter for dicotsKumari et al., 2024; Remans et al., 2005
FMV 34SFigwort mosaic virus~2× strongerWidely used constitutive promoter in dicotsBhattacharyya et al., 2002
CaMV 35SCauliflower mosaic virus1× (reference)Gold standard promoter for plant expressionOdell et al., 1985; Shakhova et al., 2022
PTSB1Arabidopsis thaliana (TSB1)~2.4× strongerVery strong in mature leaves; tissue-dependent variationShirasawa-Seo et al., 2002
PPHYBArabidopsis thaliana (PHYB)~1.5× strongerUniform expression across tissuesShirasawa-Seo et al., 2002; Goosey et al., 1997
PNCRSoybean chlorotic mottle virus~5× (protoplasts), moderate in plantsStrong viral promoter distinct from CaMV and FMVConci et al., 1993; Shirasawa-Seo et al., 2002
PCisVPClSV FLt promoter~2× strongerStrong constitutive promoter comparable to FMVMaiti & Shepherd, 1998
dPCisVDouble enhancer PCisV~6× strongerHighly powerful promoter due to enhancer duplicationMaiti & Shepherd, 1998
CPV1Cassava vein mosaic virus~0.5× of CPV2Moderate activity; tissue-specific expressionVerdaguer et al., 1996; Calvert et al., 1995
CPV2Cassava vein mosaic virus~1× (similar to e35S)Stronger version; high activity in vascular tissuesVerdaguer et al., 1998
pFMVFigwort mosaic virus<1 (weaker than 35S)Common alternative but weaker in this systemShakhova et al., 2022
AtUBQ10 (0.8)Arabidopsis thaliana<1 (similar to pFMV)Stable expression across tissuesShakhova et al., 2022
AtAct2Arabidopsis thalianaModerate to lowConstitutive but weak in tobacco systemShakhova et al., 2022
P-NosAgrobacterium tumefaciensWeak to moderateCommonly used for selectable marker genesGenBank: AF485783
Terminator sequences:

The sequences of the tOCS, tHSP18.2, tATPase, tAtAct2, and tRBCS3C terminators were retrieved from the supplementary Benchling file provided in the study by Shakhova et al. Using this source ensured that the exact versions correspond to those experimentally validated in the study, maintaining consistency with the reported expression data.

tOCS terminator (Agrobacterium tumefaciens)

The tOCS terminator originates from the octopine synthase gene of Agrobacterium tumefaciens. In the comparative analysis reported by Shakhova et al. (2022), this terminator consistently showed the highest performance among all tested elements. It produced the strongest and most stable expression levels across both Nicotiana benthamiana leaves and tobacco BY-2 cell systems, making it the most reliable option when maximal transgene expression is required.

  • tOCS extracted sequences:
ctgctttaatgagatatgcgagaagcctatgatcgcatgatatttgctttcaattctgttgtgcacgttgtaaaaaacctgagcatgtgtagctcagatccttaccgccggtttcggttcattctaatgaatatatcacccgttactatcgtatttttatgaataatattctccgttcaatttactgattgtaccctactacttatatgtacaatattaaaatgaaaacaatatattgtgctgaataggtttatagcgacatctatgatagagcgccacaataacaaacaattgcgttttattattacaaatccaattttaaaaaaagcggcagaaccggtcaaacctaaaagactgattacataaatcttattcaaatttcaaaagtgccccaggggctagtatctacgacacaccgagcggcgaactaataacgctcactgaagggaactccggttccccgccggcgcgcatgggtgagattccttgaagttgagtattggccgtccgctctaccgaaagttacgggcaccattcaacccggtccagcacggcggccgggtaaccgacttgctgccccgagaattatgcagcatttttttggtgtatgtgggccccaaatgaagtgcaggtcaaaccttgacagtgacgacaaatcgttgggcgggtccagggcgaattttgcgacaacatgtcgaggctcagcag

tHSP18.2 terminator (Arabidopsis thaliana)

The tHSP18.2 terminator is derived from the heat shock protein 18.2 gene of Arabidopsis thaliana. According to Shakhova et al. (2022), it performs at a very high level, ranking just below tOCS in both experimental systems. Although previously considered optimal in Arabidopsis and rice, its activity in tobacco remains strong but slightly less efficient than tOCS.

  • tHSP18.2 extracted sequences:
TAGGTTAAatatgaagatgaagatgaaatatttggtgtgtcaaataaaaagcttgtgtgcttaagtttgtgtttttttcttggcttgttgtgttatgaatttgtggctttttctaatattaaatgaatgtaagatctcattataatgaataaacaaatgtttctataatccattgtgaatgttttgttggatctcttctgcagcatataactactgtatgtgctatggtatggactatggaatatgattaaagataag

tATPase terminator (Solanum lycopersicum)

The tATPase terminator, originating from a tomato (Solanum lycopersicum) ATPase gene, belongs to the group of high-performing terminators. Experimental data from Shakhova et al. (2022) indicate that it supports robust expression levels comparable to tHSP18.2 in Nicotiana systems. This makes it a solid alternative when strong but not necessarily maximal expression is sufficient.

  • tATPase extracted sequences:
accgcactgtgtgtggtttctcaagaccaagacagctaaagcctaaagtcagagatctaatatgtgtattgttattcatgacaccacagctgccacttttggtgttatgatctgtttgtagaagtaggaattcttttttttctacttaataatagcttaaagagctgtgcaatttggtctgtattttttgtgtattttgcactcattatttgtgaacagtttgagaactatttattttctaagatttgtgcacgtatgaaccacttttcatctatataccaccatgtttattctgcatctatgggattgagtttgaatattcgttgatcaacaaagttatatttggtggatactacttgaaggtgcatatactttgtgctcatatatttagttgatattctggattttgagctggacaaattgatcaaggtagtctaatctggtctggttactaataaaactcaagagatcact

tAtAct2 terminator (Arabidopsis thaliana)

The tAtAct2 terminator comes from the actin 2 gene of Arabidopsis thaliana. Despite the widespread use of actin-related regulatory elements, this terminator showed relatively weak performance in the tested tobacco systems. In Shakhova et al. (2022), it consistently resulted in low expression levels in both plant leaves and cell cultures, indicating limited efficiency for high-expression constructs.

  • tAtAct2 extracted sequences:
gctctcaagatcaaaggcttaaaaagctggggttttatgaatgggatcaaagtttctttttttcttttatatttgcttctccatttgtttgtttcatttccctttttgttttcgtttctatgatgcacttgtgtgtgacaaactctctgggtttttacttacgtctgcgtttcaaaaaaaaaaaccgctttcgttttgcgttttagtcccattgttttgtagctctgagtgatcgaattgatgcctctttattccttttgttccctataatttctttcaaaactcagaagaaaaaccttgaaactctttgcaatgttaatataagtattgtataagatttttattgatttggttattagtcttacttttgctacctccatcttcacttggaactgatattctgaatagttaaagcgttacatgtgttccattcacaaatgaacttaaactagcacaaagtcagatattttaagatcgcaccattt

tRBCS3C terminator (Solanum lycopersicum)

The tRBCS3C terminator is derived from the small subunit (3C) of the Rubisco gene in tomato. Similar to tAtAct2, it exhibited low expression output in all experimental conditions described by Shakhova et al. (2022). The data suggest that this terminator can significantly limit overall transcriptional efficiency, especially when paired with strong promoters.

  • tRBCS3C extracted sequences:
atatgtcaacagtgagaaactgttcgcattttccgttttgcttctttctttctattcaatgtatgttgttggattccagttgaatttattatgagaactaataataatagtaataatcatttgtttctttactaatttgcattttcacatatgatttctggtgcatatcataattttcattccaccaatattaatttcccccattcaagttacttatgaaatagaaatcctcttctccgactactttatttgtccgaaagtcttgtggctgctatataa

Important note! The study highlights that terminators do not act independently but interact strongly with the chosen promoter. With highly active promoters, the difference between a strong terminator (such as tOCS) and a weak one (such as tRBCS3C) can lead to expression changes of more than 50-fold. While this effect is less pronounced with weaker promoters, it remains an important factor in construct design.

T-35S (Cauliflower mosaic virus)

The T-35S terminator is a widely used viral transcriptional terminator derived from the Cauliflower mosaic virus (CaMV). For my construct, I retrieved its sequence from the binary vector pEAQ-HT available in GenBank under accession GQ497234.1. The fragment corresponds to the region spanning positions 2889 to 3588, which contains the full termination and polyadenylation signals commonly used in plant expression systems. This sequence was directly extracted from the annotated GenBank entry to ensure accuracy and consistency with experimentally validated vector designs.

> GQ497234.1:2889-3588 Binary vector pEAQ-HT, complete sequence

CTCGAATTCGCTGAAATCACCAGTCTCTCTCTACAAATCTATCTCTCTCTATTTTCTCCATAAATAATGTGTGAGTAGTTTCCCGATAAGGGAAATTAGGGTTCTTATAGGGTTTCGCTCATGTGTTGAGCATATAAGAAACCCTTAGTATGTATTTGTATTTGTAAAATACTTCTATCAATAAAATTTCTAATTCCTAAAACCAAAATCCAGTACTAAAATCCAGATCTCCTAAAGTCCCTATAGATCTTTGTCGTGAATATAAACCAGACACGAGACGACTAAACCTGGAGCCCAGACGCCGTTCGAAGCTAGAAGTACCGCTTAGGCAGGAGGCCGTTAGGGAAAAGATGCTAAGGCAGGGTTGGTTACGTTGACTCCCCCGTAGGTTTGGTTTAAATATGATGAAGTGGACGGAAGGAAGGAGGAAGACAAGGAAGGATAAGGTTGCAGGCCCTGTGCAAGGTAAGAAGATGGAAATTTGATAGAGGTACGCTACTATACTTATACTATACGCTAAGGGAATGCTTGTATTTATACCCTATACCCCCTAATAACCCCTTATCAATTTAAGAAATAATCCGCATAAGCCCCCGCTTAAAAATTGGTATCAGAGCCATGAATAGGTCTATGACCAAAACTCAAGAGGATAAAACCTCACCAAAATACGAAAGAGTTCTTAACTCTAAAGATAAAAGAT

T-E9 (Pea Rubisco small subunit)

The T-E9 terminator originates from the small subunit of the Rubisco gene (rbcS) in pea (Pisum sativum) and is known for its efficient transcription termination and mRNA stabilization in plant systems. I obtained this sequence from the binary vector pKM24KH, using the GenBank accession HM036220.1. The selected region corresponds to positions 10721 to 11366, as defined in the annotated sequence. This fragment was directly extracted from the GenBank record to ensure that the version used matches the one functionally validated in plant transformation vectors.

> HM036220.1:10721-11366 Binary vector pKM24KH, complete sequence

GCTTTCGTTCGTATCATCGGTTTCGACAACGTTCGTCAAGTTCAATGCATCAGTTTCATTGCGCACACACCAGAATCCTACTGAGTTTGAGTATTATGGCATTGGGAAAACTGTTTTTCTTGTACCATTTGTTGTGCTTGTAATTTACTGTGTTTTTTATTCGGTTTTCGCTATCGAACTGTGAAATGGAAATGGATGGAGAAGAGTTAATGAATGATATGGTCCTTTTGTTCATTCTCAAATTAATATTATTTGTTTTTTCTCTTATTTGTTGTGTGTTGAATTTGAAATTATAAGAGATATGCAAACATTTTGTTTTGAGTAAAAATGTGTCAAATCGTGGCCTCTAATGACCGAAGTTAATATGAGGAGTAAAACACTTGTAGTTGTACCATTATGCTTATTCACTAGGCAACAAATATATTTTCAGACCTAGAAAAGCTGCAAATGTTACTGAATACAAGTATGTCCTCTTGTGTTTTAGACATTTATGAACTTTCCTTTATGTAATTTTCCAGAATCCTTGTCAGATTCTAATCATTGCTTTATAATTATAGTTATACTCATGGATTTGTAGTTGAGTATGAAAATATTTTTTAATGCATTTTATGACTTGCCAATTGATTGACAACATGCATCAATCGAT

Addional terminaters:

T-Nos (Nopaline Synthase)

> GQ497234.1:1596-1848 Binary vector pEAQ-HT, complete sequence

GATCGTTCAAACATTTGGCAATAAAGTTTCTTAAGATTGAATCCTGTTGCCGGTCTTGCGATGATTATCATATAATTTCTGTTGAATTACGTTAAGCATGTAATAATTAACATGTAATGCATGACGTTATTTATGAGATGGGTTTTTATGATTAGAGTCCCGCAATTATACATTTAATACGCGATAGAAAACAAAATATAGCGCGCAAACTAGGATAAATTATCGCGCGCGGTGTCATCTATGTTACTAGATC

T-PinII (Potato Proteinase Inhibitor II)

T-Mas (Mannopine Synthase)

TerminatorOriginRelative PerformanceKey CharacteristicsSequence Source
tOCSAgrobacterium tumefaciens (octopine synthase)Highest (Top performer)Most stable and strongest expression in Nicotiana systems; best overall choiceShakhova et al., 2022 (supplementary Benchling file)
tHSP18.2Arabidopsis thaliana (heat shock protein 18.2)Very high (slightly below tOCS)Strong expression; highly efficient but slightly less than tOCS in tobaccoShakhova et al., 2022 (supplementary Benchling file)
tATPaseSolanum lycopersicum (ATPase gene)HighRobust and consistent performance; comparable to tHSP18.2Shakhova et al., 2022 (supplementary Benchling file)
tAtAct2Arabidopsis thaliana (actin 2)LowWeak expression in Nicotiana; not suitable for high-expression constructsShakhova et al., 2022 (supplementary Benchling file)
tRBCS3CSolanum lycopersicum (Rubisco small subunit 3C)LowLimits transcription efficiency; weakest among tested terminatorsShakhova et al., 2022 (supplementary Benchling file)
T-35SCauliflower mosaic virusModerate to highWidely used standard terminator; reliable polyadenylation signalGenBank: GQ497234.1 (pEAQ-HT vector)
T-E9Pisum sativum (Rubisco small subunit)HighEfficient transcription termination and mRNA stabilization in plantsGenBank: HM036220.1 (pKM24KH vector)
CTP (Chloroplast Transit Peptde) sequences:

The three chloroplast transit peptides (RbcS CTP, Ferredoxin-2 CTP, and RecA CTP) were identified from Arabidopsis thaliana proteins using the UniProt database. For each protein, I first retrieved the corresponding entry (accessions P10795, P16972, and Q39199), then examined the “Features” section, specifically under PTM/Processing, to locate the annotated transit peptide regions. image image image image image image

The CTP sequences were directly extracted from the annotated transit peptide segments, which correspond to the N-terminal targeting signals responsible for directing proteins to the chloroplast. This approach ensures that the selected sequences match experimentally curated annotations and represent functional chloroplast-targeting peptides.

The extracted sequences are:

RbcS CTP (P10795):

MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVN
image image

Ferredoxin-2 CTP (P16972):

MASTALSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAM
image image

RecA CTP (Q39199):

MDSQLVLSLKLNPSFTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYA
image image

These sequences were selected to provide alternative chloroplast targeting signals with potentially different import efficiencies, enabling flexibility in construct design.

CTPSource ProteinOrganismUniProt AccessionLength (aa)Key Function
RbcS CTPRibulose-1,5-bisphosphate carboxylase/oxygenase small subunitArabidopsis thalianaP1079557Targets proteins to chloroplast stroma (photosynthetic pathway)
Ferredoxin-2 CTPFerredoxin-2 (chloroplastic)Arabidopsis thalianaP1697253Directs proteins to chloroplast electron transport system
RecA CTPDNA repair protein RecA homolog 1Arabidopsis thalianaQ3919957Targets proteins to chloroplast nucleoids (DNA maintenance)
Vector Backbones

pCAMBIA2300 (Construct 1: Structural genes – coxL, M, S)

image image

The pCAMBIA2300 vector (GenBank accession AF234315.1) was used as the backbone for the structural gene construct. It is a binary plant expression vector with an approximate size of 8.7 kb, designed as an empty cloning system without any reporter gene, allowing full customization of inserted expression cassettes.

This vector carries the nptII gene, which confers kanamycin resistance in plants, making it suitable for selecting transformants expressing the structural genes (coxL, coxM, coxS). For bacterial propagation, it also includes a kanamycin resistance marker, enabling selection in E. coli prior to Agrobacterium transformation.

The cloning region consists of a pUC18-derived multiple cloning site (MCS) containing standard restriction sites. Additionally, the presence of the pVS1 origin of replication ensures high plasmid stability in Agrobacterium. This vector is well-suited for accommodating multi-cassette inserts, such as the structural gene assembly used in this project.

pCAMBIA1300 (Construct 2: Maturation genes – coxD, E, F, G)

image image

The pCAMBIA1300 vector (GenBank accession AF234296.1) was selected as the backbone for the maturation gene construct. Similar to pCAMBIA2300, it is an empty binary vector (~8.9 kb) designed for flexible insertion of custom genetic elements.

Its key feature is the presence of a hygromycin resistance gene (HygR) for plant selection, which complements the kanamycin resistance used in pCAMBIA2300. This enables the implementation of a dual-selection strategy for identifying co-transformed plants carrying both constructs.

For bacterial selection, pCAMBIA1300 also carries a kanamycin resistance marker, allowing propagation in E. coli. The vector includes a standard pUC18-derived MCS, suitable for inserting large DNA fragments such as the multi-gene maturation cassette (coxD, coxE, coxF, coxG).

Dual-Vector Strategy and Considerations

The combined use of pCAMBIA2300 and pCAMBIA1300 allows efficient co-expression of multiple genes through independent constructs:

ConstructGenesVectorPlant Selection
StructuralcoxL, coxM, coxSpCAMBIA2300Kanamycin
MaturationcoxD, coxE, coxF, coxGpCAMBIA1300Hygromycin

This dual-selection system enables reliable identification of plants carrying both constructs. An important technical consideration is that both vectors use kanamycin for bacterial selection, which prevents simultaneous selection of both plasmids in E. coli. Therefore, each construct must be cloned and verified independently before being introduced into Agrobacterium. Co-transformation can then be achieved, followed by selection at the plant level using both antibiotics.

Plant Expression Vectors: pCAMBIA2300 and pCAMBIA1300

For my plant transformation system, I selected two complementary binary vectors: pCAMBIA2300 and pCAMBIA1300, enabling the independent construction and co-expression of structural and maturation gene cassettes. Detailed technical specifications for both vectors can be found in their respective datasheets provided by Abcam for pCAMBIA1300 and pCAMBIA2300.

FeaturepCAMBIA2300pCAMBIA1300
Construct UseStructural genes (coxL, coxM, coxS)Maturation genes (coxD, coxE, coxF, coxG)
Approx. Size~8.7 kb~8.9 kb
Plant Selection MarkerKanamycin (nptII)Hygromycin (HygR)
Bacterial SelectionKanamycinKanamycin
Reporter GeneNone (empty vector)None (empty vector)
Cloning SitepUC18-derived MCSpUC18-derived MCS
Replication in AgrobacteriumpVS1 origin (high stability)pVS1 origin (high stability)
Insert CapacitySuitable for large multi-cassette insertsSuitable for large multi-cassette inserts
Main AdvantageCompatible with kanamycin-based plant selectionEnables dual selection with hygromycin
AMV RNA4 Translation Enhancer Design

Sequence Selection and Modification Strategy

The AMV RNA4 enhancer sequence was selected based on the work of Jobling & Gehrke (1987), which demonstrated that this viral leader sequence can strongly enhance translation efficiency in plant systems.

The original viral RNA sequence reported in the article was: image image

5'-GUUUUUAUUUUUAAUUUUCUUUCAAAUACUUCCAUCAUGA-3’

Because the enhancer naturally exists as RNA, the sequence was converted into its complementary DNA (cDNA) equivalent for incorporation into the double-stranded DNA constructs designed for Twist Bioscience synthesis:

5'-GTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCATGA-3’

During sequence analysis, the native terminal ATG codon present at the 3′ end of the enhancer was identified as a potential problem. If retained, this endogenous ATG could initiate translation before the intended chloroplast transit peptide coding sequence, potentially producing non-functional proteins or frame-shifted translation products.

To prevent this issue, the terminal ATG codon was manually removed, generating the final modified enhancer sequence:

5′-GTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCA-3′

This modification ensured that the first translation initiation codon encountered by the ribosome corresponded to the optimized start codon of the chloroplast transit peptide fusion construct.

Sequence Verification and Validation

Several validation steps were performed after enhancer modification.

First, restriction enzyme screening was conducted to verify that problematic restriction sites such as EcoRI, BamHI, HindIII and XbaI were not unintentionally introduced into the final fused constructs. This step was important for preserving compatibility with downstream cloning verification and diagnostic digestion workflows.

Next, the modified enhancer sequence was evaluated for secondary structure formation to ensure that removal of the terminal ATG did not generate stable hairpins or inhibitory RNA structures that could interfere with ribosome binding or translation initiation.

The final modified AMV enhancer sequence remained structurally suitable for efficient translational enhancement and integration into the multi-cassette CODH system.

To improve protein production from the engineered CODH expression cassettes, the 5′ untranslated region (UTR) of Alfalfa Mosaic Virus (AMV) RNA4 was incorporated as a translational enhancer upstream of each coding sequence. The objective of this element was to increase translational efficiency and improve ribosome recruitment in Nicotiana tabacum cells.

Phage-Derived Stuffer/Spacer Sequences

Spacer Design Strategy and Selection

To minimize unwanted interactions between adjacent expression cassettes, neutral spacer sequences were introduced between transcriptional units in the final multi-gene constructs.

Rather than reusing the same spacer repeatedly, four different spacer sequences were designed for the different cassette junctions (Spacer 1–4). Using identical spacer sequences multiple times is generally discouraged because repeated DNA regions can increase the probability of homologous recombination during bacterial cloning or after plant transformation, potentially leading to construct rearrangement or partial deletion.

For this reason, unique spacer sequences were selected for each junction to improve structural stability of the final constructs.

To generate biologically neutral spacers, fragments derived from the genome of Enterobacteria phage lambda NC_001416.1) were used. Lambda phage DNA is commonly utilized in synthetic biology as inert “stuffer DNA” because it lacks known regulatory activity in plant cells, contains no plant-specific coding regions, is well characterized, and minimizes unintended interactions within eukaryotic systems.

image image

Each spacer was designed to be approximately 100 bp long. Although this represents the minimal recommended spacer size, it was considered sufficient to physically separate neighboring transcriptional units, reduce transcriptional and steric interference between cassettes, and improve overall construct organization during multi-cassette assembly.

Spacer Validation and Optimization

Before final selection, several validation steps were performed to ensure that the spacer sequences were suitable for stable multi-cassette assembly and plant expression.

First, all spacer sequences were designed to be different from one another in order to reduce repeated DNA regions and minimize the risk of homologous recombination within the construct.

Next, each spacer was analyzed against the Nicotiana tabacum reference genome GCF_000715075.1) using BLASTn to verify genome neutrality. The analysis confirmed the absence of significant similarity with endogenous tobacco genes or regulatory regions, reducing the risks of off-target recombination, post-transcriptional gene silencing (PTGS), and unintended genomic interactions.

image image image image image image image image image image

The spacer sequences were also screened to avoid problematic restriction enzyme recognition sites that could interfere with downstream cloning and Gibson Assembly workflows.

Finally, GC content was maintained within moderate ranges (~37–48%) to avoid extremely AT-rich or GC-rich regions that could negatively affect DNA synthesis stability, PCR amplification, or secondary structure formation.

The final validated spacer sequences are presented below:

Spacer 1: GAAGTTCTATGACTCAATTGTTCATAGTGTTTACATCACCGCCAATTGCTTTTAAGACTGAACGCATGAAATATGGTTTTTCGTCATGTTTTGAGTCTGC
image image
Spacer 2: GAATATTGGTTACGTCTGCATGTGCTATCTGCGCCCATATCATCCAGTGGTCGTAGCAGTCGTTGATGTTCTCCGCTTCGATAACTCTGTTGAATGGCTC
image image
Spacer 3: GATTGCGCCTACCCGGATATTATCGTGAGGATGCGTCATCGCCATTGCTCCCCAAATACAAAACCAATTTCAGCCAGTGCCTCGTCCATTTTTTCGATGA
image image
Spacer 4: GCGCGTTCTGCTTCCGATTAGAAACGTCAAGGCAGCAATCAGGATTGCAATCATGGTTCCTGCATATGATGACAATGTCGCCCCAAGACCATCTCTATGA
image image

To improve the structural stability and transcriptional insulation of the multi-cassette CODH constructs, neutral spacer sequences were introduced between adjacent expression cassettes. These spacers were designed to reduce promoter and terminator interference, minimize homologous recombination risks, and prevent unwanted interactions between neighboring transcriptional units during cloning and plant expression.


Sources:

  • Bhattacharyya, S., Dey, N., & Maiti, I. B. (2002). Analysis of cis-sequence of subgenomic transcript promoter from the Figwort mosaic virus and comparison of promoter activity with the cauliflower mosaic virus promoters in monocot and dicot cells. Virus Research, 90(1), 47–62. https://doi.org/10.1016/S0166-0934(02)00146-5
  • Calvert, L. A., Ospina, M. D., & Shepherd, R. J. (1995). Characterization of cassava vein mosaic virus: A distinct plant pararetrovirus. Journal of General Virology, 76(5), 1271–1278. https://doi.org/10.1099/0022-1317-76-5-1271
  • Conci, L. R., NISHIZAWA, Y., SAITO, M., DATE, T., HASEGAWA, A., MIKI, K., & HIBI, T. (1993). A strong promoter fragment from the large noncoding region of soybean chlorotic mottle virus DNA. Japanese Journal of Phytopathology, 59(4), 432-437.
  • Davies, J. P., Reddy, V., Liu, X. L., Reddy, A. S., Ainley, W. M., Thompson, M., Sastry-Dent, L., Cao, Z., Connell, J., Gonzalez, D. O., & Wagner, D. R. (2014). Identification and use of the sugarcane bacilliform virus enhancer in transgenic maize. BMC Plant Biology, 14(1), 359. https://doi.org/10.1186/s12870-014-0359-3
  • Dey, N., & Maiti, I. B. (1999). Structure and promoter/leader deletion analysis of mirabilis mosaic virus (MMV) full-length transcript promoter in transgenic plants. Plant Molecular Biology, 40(5), 771–782. https://doi.org/10.1023/A:1006285426523
  • Genschik, P., Marbach, J., Uze, M., Feuerman, M., Plesse, B., & Fleck, J. (1994). Structure and promoter activity of a stress and developmentally regulated polyubiquitin-encoding gene of Nicotiana tabacum. Gene, 148(2), 195–202. https://doi.org/10.1016/0378-1119(94)90689-0
  • Goosey, L., Palecanda, L., & Sharrock, R. A. (1997). Differential patterns of expression of the Arabidopsis PHYB, PHYD, and PHYE phytochrome genes. Plant physiology, 115(3), 959–969. https://doi.org/10.1104/pp.115.3.959
  • Jobling, S. A., & Gehrke, L. (1987). Enhanced translation of chimaeric messenger RNAs containing a plant viral untranslated leader sequence. Nature, 325(6105), 622–625. https://doi.org/10.1038/325622a0
  • Khadanga, B., Chanwala, J., Sandeep, I. S., & Dey, N. (2021). Synthetic Promoters from Strawberry Vein Banding Virus (SVBV) and Dahlia Mosaic Virus (DaMV). Molecular Biotechnology, 63(9), 792–806. https://doi.org/10.1007/s12033-021-00344-5
  • Kumari, K., Sherpa, T., & Dey, N. (2024a). Analysis of plant pararetrovirus promoter sequence(s) for developing a useful synthetic promoter with enhanced activity in rice, pearl millet, and tobacco plants. Frontiers in Plant Science, 15. https://doi.org/10.3389/fpls.2024.1426479
  • Kumari, K., Sherpa, T., & Dey, N. (2024b). Analysis of plant pararetrovirus promoter sequence(s) for developing a useful synthetic promoter with enhanced activity in rice, pearl millet, and tobacco plants. Frontiers in Plant Science, 15. https://doi.org/10.3389/fpls.2024.1426479
  • Norris, S. R., Meyer, S. E., & Callis, J. (1993). The intron of Arabidopsis thaliana polyubiquitin genes is conserved in location and is a quantitative determinant of chimeric gene expression. Plant molecular biology, 21(5), 895–906. https://doi.org/10.1007/BF00027120
  • Maiti, I. B., & Shepherd, R. J. (1998). Isolation and Expression Analysis of Peanut Chlorotic Streak Caulimovirus (PClSV) Full-Length Transcript (FLt) Promoter in Transgenic Plants. Biochemical and Biophysical Research Communications, 244(2), 440–444. https://doi.org/10.1006/bbrc.1998.8287
  • Pattanaik, S., Dey, N., Bhattacharyya, S., & Maiti, I. B. (2004). Isolation of full-length transcript promoter from the Strawberry vein banding virus (SVBV) and expression analysis by protoplasts transient assays and in transgenic plants. Plant Science, 167(3), 427–438. https://doi.org/10.1016/j.plantsci.2004.04.011
  • Remans, T., L. Grof, C. P., Ebert, P. R., & Schenk, P. M. (2005). Identification of functional sequences in the pregenomic RNA promoter of the Banana streak virus Cavendish strain (BSV-Cav). Virus Research, 108(1), 177–186. https://doi.org/10.1016/j.virusres.2004.09.005
  • Sahoo, D. K., Dey, N., & Maiti, I. B. (2014). pSiM24 Is a Novel Versatile Gene Expression Vector for Transient Assays As Well As Stable Expression of Foreign Genes in Plants. PLOS ONE, 9(6), e98988. https://doi.org/10.1371/journal.pone.0098988
  • Sahoo, D. K., Sarkar, S., Raha, S., Das, N. C., Banerjee, J., Dey, N., & Maiti, I. B. (2015). Analysis of Dahlia Mosaic Virus Full-length Transcript Promoter-Driven Gene Expression in Transgenic Plants. Plant Molecular Biology Reporter, 33(2), 178–199. https://doi.org/10.1007/s11105-014-0738-9
  • Shakhova, E. S., Markina, N. M., Mitiouchkina, T., Bugaeva, E. N., Karataeva, T. A., Palkina, K. A., Fakhranurova, L. I., Yampolsky, I. V., Sarkisyan, K. S., & Mishin, A. S. (2022). Systematic Comparison of Plant Promoters in Nicotiana spp. Expression Systems. International Journal of Molecular Sciences, 23(23), 15441. https://doi.org/10.3390/ijms232315441
  • Shirasawa-Seo, N., Mitsuhara, I., Nakamura, S., Murakami, T., Iwai, T., Nishizawa, Y., … & Ohashi, Y. (2002). Constitutive promoters available for transgene expression instead of CaMV 35S RNA promoter: Arabidopsis promoters of tryptophan synthase protein β subunit and phytochrome B. Plant Biotechnology, 19(1), 19-26.
  • Verdaguer, B., de Kochko, A., Beachy, R. N., & Fauquet, C. (1996). Isolation and expression in transgenic tobacco and rice plants, of the cassava vein mosaic virus (CVMV) promoter. Plant Molecular Biology, 31(6), 1129–1139. https://doi.org/10.1007/BF00040830
  • Verdaguer, B., de Kochko, A., Fux, C. I., Beachy, R. N., & Fauquet, C. (1998). Functional organization of the cassava vein mosaic virus (CsVMV) promoter. Plant Molecular Biology, 37(6), 1055–1067. https://doi.org/10.1023/A:1006004819398

Phase 2: Codon Optimization

The Codon Optimization and Its Critical Role:

Codon Optimization and Sequence Adaptation processes:

1. Start Codon Verification and Correction

As an initial step, all seven CODH genes were carefully inspected to verify the presence of a valid translation initiation codon. A critical adjustment was required for the coxM gene, which was the only gene using an alternative bacterial start codon (GTG) instead of the canonical ATG.

Since plant translation machinery, particularly in Nicotiana tabacum, strictly recognizes ATG as the initiation codon, the native GTG was manually corrected to ATG during the optimization process. This modification ensures proper translation initiation while preserving the original amino acid sequence of the CoxM protein.

2. Codon Optimization Strategy

Codon optimization was performed using the Benchling Codon Optimization Tool, applying the “Match Codon Usage” algorithm. This approach was selected because it reproduces the natural codon distribution of the target organism rather than overusing only the most frequent codons, thereby improving mRNA stability and translation efficiency.

image image cover image cover image image image image image

The optimization process was carried out under the following parameters:

  • Target organism: Nicotiana tabacum
  • Restriction site filtering: Removal of common restriction enzyme recognition sites (EcoRI, HindIII, BamHI, XbaI, PstI, and SpeI) to facilitate downstream cloning
  • Golden Gate compatibility: Elimination of BsaI and Esp3I sites to ensure compatibility with Modular Cloning (MoClo) systems
  • RNA stability optimization: Implementation of uridine depletion and avoidance of stable hairpin structures to reduce ribosomal stalling and improve translation efficiency

3. Results and Validation

Following optimization, all sequences were evaluated using CAIcal to assess codon adaptation and overall sequence quality. image image cover image cover image image image

The analysis demonstrated consistently strong performance across all seven genes as showed in the following table:

Gene NameLength (bp)CAI ScoreTotal GC%GC at 3rd PositionNc ValueExpression Potential
CoxL24300.77346.3%40.0%57.0Excellent
CoxE12000.76249.8%40.5%61.0Very Good
CoxG6180.76046.9%40.8%61.0Very Good
CoxS5010.75947.7%43.1%61.0Very Good
CoxD8880.75646.8%40.5%61.0Very Good
CoxF8430.74849.5%39.9%61.0Very Good
CoxM8670.74749.5%39.1%61.0Very Good

The Codon Adaptation Index (CAI) values ranged from 0.747 to 0.773, indicating a high level of similarity to codon usage patterns found in highly expressed genes of Nicotiana tabacum. This suggests that the optimized sequences are well-suited for efficient translation in the plant host.

The overall GC content was successfully adjusted to a range of 46.3% to 49.8%, aligning with the typical GC composition of plant genes. This represents a significant improvement compared to the original bacterial sequences and contributes to better transcriptional stability and compatibility with the host genome.

The Effective Number of Codons (Nc) values ranged from 57.0 to 61.0, reflecting a balanced codon usage without excessive repetition. This indicates that the sequences maintain sufficient variability, which is important for avoiding issues such as tRNA depletion or translational bottlenecks.

Additionally, the GC content at the third codon position was maintained at approximately 40%, which is considered optimal for the “wobble” position. This balance supports efficient recognition by plant tRNAs and contributes to overall translation efficiency.

To further validate the integrity of the optimization process, both the raw bacterial sequences and the codon-optimized sequences were translated into their corresponding amino acid sequences.

image image cover image cover image image image cover image cover image image image

A pairwise comparison was then performed using BLASTp alignment to assess sequence similarity. image image The results confirmed that all optimized proteins are identical to their native counterparts, with no changes in amino acid sequence. image image cover image cover image image image This verification step ensures that codon optimization only affected synonymous codon usage without altering protein structure or function, preserving the biological activity of all seven CODH components.

The resulting codon-optimized cox genes sequences are as follows:

  • coxD gene (codon optimized):
ATGAGACATCATGCTGAACGAGATAAGGTCGCCGAGAGGCTAGCCTATGCAGGTTATATTCCAGATCGTGATCTTGCTACCGCTGTTTGGCTGATGGAAAGCCTTTCCAGGCCCTTGTTGTTAGAAGGAGAAGCTGGTGTAGGTAAAACCGAGGTAGCTCTGACTCTTGCGCAAGCTAACGGAGCAAGGCTCATTCGCTTGCAATGCTATGAAGGGCTCGATCAAAACGCTGCATTATACGAGTGGAATTACCAACGGCAGTTGCTCGCTATCAAAACACGGGAAAGTCGTGCTGACGCAGTAGATGTTATCGAAGATCATATTTTCTCAGAGAAGTTTCTTCTTGAGCGACCTCTGTTGGCTGCAATACGTCAACCCAAATCAGCAGTGCTACTAATTGATGAGGTTGACAGGGCCGACGAGGAGTTCGAAGCCTTTTTACTCGAACTTCTAAGCGATTACCAGGTTTCTATTCCTGAACTTGGTACAATCCACGCAACAACGATTCCACAGGTGATATTAACTTCCAATGGCACGAGAGAGTTATCAGATGCCTTGAGGAGGAGATGTCTCTACCACTATGTCGACTATCCAGATGTTGAAAGAGAAGCGCGTATCATAACCACAAGAATGCCGAATATTGACGTTGCTCTGGCGTTGCAGATTGCCAGGATGATCGAGGGAATACGAAAAGAGGATTTACGCAAGAGTCCTGGAGTCGCAGAAACTCTCGACTGGGCAGCAGCATTGGCTGGGCTTGGCGTTGAGGATCTTAGAGCTGAACCAGAAGCTGTGTTTGAAACTATGATGTGCTTGATAAAGACAGTCGAAGATAAATCGAGAGTGACTAGAGAGGTTTCTGATAGACTGCTTGGAAAGGTGGCATAA
  • coxE gene (codon optimized):
ATGGTTGCAACTGCTGCCATTCATGAATCCAGCGCTGCTTCAGCAGGAGCTAGACGCAAGCTGGGCGATTTTGTTCGAGTACTCCGGGACAATGGTTTTATTGTGGGGCTCGCGGAGGCTGGAGATGCTCTTACTGTTCTTAGCAGGCCTGCCTCTTTGACACCTAGCAGACTACGACCGGCTCTTCGTGCATTGTTCTGCTCAAACAAGTCTGATTGGGAAAAGTTTGACGAGATTTTCGATGCTTTCTGGCTTGGACGAGGAATGAAATCCGCAACGAGAATTTCCGGAGTGCTTCAAAAAAGTCCTCCCGGTATGGAAAGTTCAAGGAGTGGCGATAGACCAGGTAATCCTGATGGGGCACCAGATCATGTTCAGCGGCGTATAGGCTTGGATCACGGCACCGATGAAAATAGTCCAGGACTTCGGGAAGGTGCATCACGCGCTGACTCACTGGCCAAGGCTGATTTTAGACATCTCACAAACCCGGACGATCTTGCTGCCGCTCATGCTGTAGCTGCAAGACTCGCAAAGGCTATGAGGGTGCGCTTAACCCGACGTGAACAGTCTCGCAGAACTGGTAGGAGGATCGACCTTAGAAGGACTATTCACAAAAATATAGCCCATGGAGGAATGCCACTGGAATTGGTCTGGCGACAGAGGAAACACAAACCATTAAGACTGGTTGTTCTACTCGACGCTTCCGGATCTATGAGCATGTATAGTGCAGTATTCTTAAGATTCATGCACGGGATTCTTGATAATTTTAGGGAGGCCGAAGCATTTGTTTTCCATACAAGGCTAATTCATATATCTCCAGCTTTGAGAGAACGTGATGCGACACGTTCTGTGGAGAGAATGAGCCTATTGGCCCAAGGCGTCGGTGGTGGAACACGGATCGGTGAATCACTTGCCACGTTTAATAGATGGCATGCAAAGAGAGCAATTCATTCGAGGACTTGCGTTATGATCGTGTCAGATGGTTACGATACCGGACCTGCCGAGCAATTGGAGCGAGAAATGTCGGCTTTAAGGCGTCGTTGTAGAAGAATCGCATGGCTCAACCCAATGATCGGTTGGAGGGGGTATGCGCCAGAGGCAGCTGGGATGAAAGCTGCACTGCCTCACGTCGACTTGTTTGCTCCCGCTCACAACTTAGAGAGCTTGCAAGCAATTGAGCCTTACTTAGCGAGGATATAA
  • coxF gene (codon optimized):
ATGACACCTACTCCTGACGTGTTAGATTTAGTCAACAATATGAAAGCCAGAGGAGAGCCATTCGCCCTTGCAACTGTAGTTCGGACGGTATCACTCACCGCAGCCAAGGCAGGTGCAAAGGCTATTATTTTGAGCGACGGTACTATGACAGCAGGATGGATTGGGGGCGGGTGTGCGAGAGCTAATGTGCTTAAGGCTGCTAGGCAAAGTCTTAGCGACGGAAAGCCGAGGCTGATTAGTGTTCAACCAAAGGATGTTCTTGAGGAACATGGTTTAACAGCAGGGGAAGCGCGAGAAGGAGTGCTATATGCCAACAACATGTGCCCAAGCCATGGTACCATGGATATTTTCGTTGAGCCAATATTGCCGCGACCTCAGCTCTATATCTGTGGAGCAAGCCCAGTTGCAGTGGCTATAGCTGCTATAGCACCTCGTATGGGATTTTTTGTGTCTGTTTGCGCTCCCAAAGCAGATCACACATTGTTTGGTGATACCGATAGGCTGATTGATGGTTATGAAATTCCCGCCGACAGCGGTACTAATCGGTACGTCGTTGTATCTACACAGGGACGTGGCGATACTGCTGCTCTGAAATCTGCACTATCCACGCCATCCGTCTACGTGGCTTTCGTTGGCAGTAGAAAGAAAGCCTCGGTTTTGAGGGAAGAGCTTACCGTAGCAGGAATTGCGCCATCACTATTGGAAACATTGCATGCTCCTGCCGGCCTCGACCTTGGCGGTATCACTCCTGATGAAATCGCTCTCTCAATCGTTGCTGAGATGGTCGAGATAAGACGCCACGGGCAAAGACAAAGCGATAATCAGAAAGAAGGAACATCATAA
  • coxG gene (codon optimized):
ATGGATATGAACGCAAGCCAGAGAATTGAAGCCTCAAGGGAAAAAGTCTACGCCGCTCTCAATGATGTTGAGGTGCTTAGGCCTTGCATTCCAGGTTGCGAGTCCATCGAAAAGATCTCTGATAGCGAGATGACTGCCAAGGTAACATTGCGCATAGGACCAGTGAAAGCATCTTTTACCGGTAAGGTGACCCTAAGTGATCTCGATCCTCCAAATGGTTACACCATAGCAGGGGAGGGTACAGGAGGAATGGCAGGATTCGCAAAGGGCGGTGCTACTGTGAAACTCGAAGCTGACGGGACTGCCACGATTCTTCATTATACTGTTAAAGCTGACGTCGGAGGCAAACTGGCGCAGCTTGGTGGTAGACTAATCGATGCAACAGCTACAAAACTTGCAGGAGAGTTTTTTGAAAAATTCGGAAATATTGTTGGGCCTGTAGTAGTCCAAGACGAAGAAGAGCCGGTTAAGAAGAAAGGTTGGTTGAAGAAGATAACTGGCGCTTTAAGTGTTTTGGTTTTCTCAATTTTGTTAGGAGCTCACTGGTGTTGTATTGGGGGCCATGCTCACGCTCAAAACGATCCCCTGATGTTAGCGATCTGTTCATCGCGAGTTTAA
  • coxL gene (codon optimized):
ATGAATATTCAGACAACAGTTGAACCAACTAGCGCTGAGAGAGCAGAAAAGTTGCAGGGTATGGGGTGCAAGAGGAAAAGAGTCGAAGATATTCGATTTACTCAGGGTAAGGGCAATTACGTCGATGATGTGAAATTACCGGGTATGTTGTTTGGTGATTTTGTTAGGAGTAGCCACGCTCATGCTAGGATTAAAAGTATTGATACCTCAAAAGCTAAGGCGCTTCCAGGTGTATTCGCTGTTTTAACAGCGGCAGATTTGAAGCCTCTGAATTTACATTATATGCCCACTCTGGCTGGAGATGTACAAGCAGTTCTTGCAGACGAGAAAGTTCTTTTCCAAAATCAAGAGGTTGCTTTTGTAGTGGCTAAAGATAGATACGTTGCGGCAGATGCGATCGAATTGGTAGAAGTAGATTATGAGCCATTACCAGTTCTAGTAGACCCATTCAAGGCAATGGAACCAGATGCACCTCTTCTAAGAGAAGATATTAAAGACAAAATGACTGGTGCACACGGTGCGAGGAAACATCACAACCATATATTCAGATGGGAAATAGGTGATAAGGAAGGAACTGATGCTACCTTCGCCAAAGCTGAAGTTGTGTCAAAAGATATGTTTACCTATCATCGGGTTCATCCGAGCCCACTGGAAACGTGTCAATGTGTTGCATCTATGGACAAGATCAAGGGTGAACTGACGTTGTGGGGCACATTTCAGGCTCCCCATGTCATTAGAACAGTAGTGTCATTGATCAGCGGTTTGCCAGAGCATAAAATCCACGTCATTGCACCTGACATAGGGGGAGGATTTGGAAACAAGGTGGGAGCTTATTCCGGGTACGTCTGTGCTGTGGTTGCCTCCATCGTGCTGGGAGTACCCGTTAAGTGGGTCGAAGATCGAATGGAGAACCTAAGCACTACATCATTTGCACGTGACTACCACATGACTACAGAACTCGCAGCTACAAAGGATGGAAAGATTCTTGCAATGCGCTGTCACGTCTTGGCTGATCACGGAGCTTTCGATGCCTGTGCTGATCCATCTAAATGGCCTGCTGGGTTTATGAACATATGTACAGGAAGCTATGACATGCCAGTTGCACATTTGGCCGTGGATGGTGTCTATACTAACAAAGCATCCGGCGGAGTAGCTTATAGGTGCTCATTCCGAGTTACAGAAGCTGTTTATGCCATTGAGAGGGCTATTGAGACTCTGGCTCAGCGGCTCGAGATGGATTCAGCTGATCTAAGAATAAAGAACTTTATACAACCTGAGCAGTTCCCTTATATGGCTCCTCTTGGCTGGGAGTACGACAGCGGAAATTATCCATTAGCGATGAAGAAAGCTATGGATACTGTTGGTTATCATCAACTTCGTGCTGAACAGAAAGCCAAACAAGAAGCATTTAAGCGGGGCGAGACACGCGAGATTATGGGAATTGGTATCTCGTTTTTCACCGAGATTGTTGGCGCCGGGCCGTCTAAGAATTGTGATATTCTCGGAGTTTCTATGTTTGATAGTGCAGAAATTCGTATTCATCCAACCGGTTCAGTGATTGCTAGAATGGGCACTAAGAGCCAGGGCCAGGGGCACGAGACTACTTACGCTCAAATCATAGCAACCGAACTCGGTATTCCCGCTGACGACATTATGATCGAAGAAGGGAATACCGATACTGCCCCTTATGGGCTTGGAACTTACGGAAGTCGCTCGACACCCACGGCTGGTGCTGCAACCGCTGTGGCCGCTCGTAAAATAAAAGCCAAGGCTCAAATGATTGCAGCACACATGCTCGAAGTGCATGAGGGAGATTTGGAATGGGACGTGGACAGATTTAGGGTTAAAGGTCTTCCGGAAAAATTCAAGACTATGAAGGAACTCGCATGGGCATCCTACAATAGTCCACCACCCAATCTTGAGCCTGGGCTCGAGGCTGTGAACTATTACGACCCTCCTAATATGACTTATCCTTTTGGTGCCTATTTTTGCATTATGGATATAGATGTGGATACTGGCGTCGCCAAAACCAGGAGGTTCTATGCATTAGACGATTGCGGAACAAGAATCAACCCGATGATTATAGAAGGGCAAGTTCATGGTGGTTTGACAGAGGCCTTCGCAGTAGCTATGGGGCAGGAGATCCGATACGACGAGCAAGGAAATGTGCTTGGAGCATCTTTTATGGACTTCTTCTTGCCAACGGCCGTCGAAACACCAAAGTGGGAGACAGATTACACAGTTACTCCATCTCCACATCATCCTATAGGAGCCAAAGGCGTTGGTGAAAGTCCTCATGTTGGCGGTGTGCCTTGCTTTTCAAATGCGGTTAATGATGCTTACGCATTTTTAAACGCAGGCCACATCCAAATGCCTCATGATGCATGGAGACTATGGAAGGTAGGAGAGCAACTTGGACTTCACGTCTAA
  • coxM gene (codon optimized):
ATGATACCTGGATCATTTGATTATCATAGACCAAAATCCATTGCAGACGCAGTTGCTCTTCTTACGAAATTAGGGGAGGATGCTAGACCTTTGGCCGGAGGCCACAGCCTAATTCCTATTATGAAGACCAGATTAGCTACACCAGAACATTTGGTTGATCTCAGGGATATTGGAGATTTAGTCGGAATTAGGGAGGAGGGTACGGACGTCGTCATCGGGGCAATGACAACTCAGCATGCGCTTATAGGTTCAGATTTCTTGGCAGCAAAATTGCCAATTATTCGCGAGACAAGCCTGTTGATAGCAGATCCACAAATAAGGTACATGGGAACCATTGGCGGCAATGCCGCTAACGGAGATCCTGGAAACGATATGCCGGCCCTCATGCAGTGCTTGGGTGCGGCTTACGAACTCACTGGCCCTGAAGGTGCTCGTATAGTTGCTGCACGAGATTACTATCAAGGGGCTTATTTCACTGCTATTGAGCCCGGTGAACTTCTTACAGCAATCAGAATCCCCGTGCCACCCACTGGACACGGGTACGCTTACGAAAAACTGAAGCGGAAAATTGGCGACTATGCCACCGCCGCGGCAGCTGTAGTACTAACAATGAGTGGTGGAAAATGTGTGACTGCATCGATCGGTCTAACTAATGTTGCGAACACACCACTTTGGGCAGAAGAGGCCGGAAAGGTGTTGGTTGGTACTGCTCTCGACAAACCTGCTTTAGACAAGGCTGTAGCTCTGGCTGAGGCTATCACAGCTCCGGCATCTGATGGTCGCGGGCCAGCAGAATATCGAACCAAGATGGCTGGTGTTATGCTTCGTAGGGCAGTTGAAAGAGCAAAGGCCAGAGCCAAGAATTAA
  • coxS gene (codon optimized):
ATGGCGAAAGCTCACATTGAACTCACGATCAACGGACATCCAGTGGAGGCATTGGTTGAACCTCGGACTTTACTAATTCACTTCATTAGAGAGCAACAGAACCTTACCGGCGCACATATCGGATGCGACACTTCACACTGCGGGGCTTGTACTGTTGATCTCGATGGTATGAGCGTGAAGAGCTGTACAATGTTTGCTGTCCAAGCTAATGGAGCTTCAATCACCACCATTGAAGGAATGGCAGCACCGGATGGTACACTGAGTGCTCTGCAAGAAGGGTTTAGGATGATGCATGGTTTGCAATGCGGTTACTGTACTCCAGGGATGATCATGCGATCCCATAGATTGCTTCAAGAGAATCCAAGCCCCACAGAAGCGGAAATAAGGTTCGGAATTGGTGGAAATCTTTGCCGCTGTACAGGCTACCAGAACATTGTTAAAGCAATACAGTATGCCGCCGCTAAGATAAATGGCGTACCTTTTGAGGAGGCCGCAGAATAA

Back-Translation and Codon Optimization of Engineered CTP Sequences

After designing and validating the engineered chloroplast transit peptides (CTPs) at the amino acid level, the next step was to convert these protein sequences into DNA sequences that are fully compatible with the plant expression system. This process ensures that the “targeting signals” (CTPs) are translated efficiently in Nicotiana tabacum, just like the CODH subunits.

Since these CTPs are fused directly to the N-terminus of the CODH proteins, it is essential that they follow the same genetic design rules as the rest of the system to guarantee consistent expression and proper chloroplast targeting.

Back-Translation Strategy

The engineered CTP amino acid sequences (RbcS, Fer2, and RecA), including the modified junction motifs (VNA–AM, VTA–AM, and TVY–AA), were back-translated into DNA sequences using the Benchling Codon Optimization tool.

This step converted the peptide sequences into nucleotide sequences optimized for expression in Nicotiana tabacum, ensuring compatibility with the plant’s codon usage preferences and translation machinery.

Codon Optimization Consistency

The same optimization framework used for the seven CODH genes was applied to the CTP sequences to maintain full compatibility and expression uniformity across the entire multigene construct. This guarantees that all components of the system follow the same expression logic within the plant cell.

Key Adjustment: Hairpin Structure Control

A specific adjustment was introduced during this step due to the short length of CTP sequences. The standard secondary structure analysis settings were not optimal for short peptide-encoding regions, which can lead to inaccurate prediction of stable RNA hairpins near the translation start site.

To address this, the hairpin analysis window was reduced to 100 to improve sensitivity for short sequences and to ensure that no stable secondary structures form at the 5’ region that could interfere with ribosome binding or early translation.

The following are the final codon-optimized CTP sequences generated in this step:

  • RbcS CTP Sequence (engineered and codon optimized):
ATGGCCTCATCAATGCTCAGTAGCGCCACAATGGTGGCAAGTCCTGCTCAAGCTACAATGGTCGCTCCCTTTAATGGTCTGAAGTCGTCCGCAGCATTCCCAGCAACTAGAAAAGCTAATAATGACATAACGAGCATTACCAGCAACGGAGGCAGGGTAAACGCTGCG
  • Fer2 CTP Sequence (engineered and codon optimized):
ATGGCTAGCACCGCACTGAGCTCAGCCATTGTGGGAACTTCCTTCATCCGGAGAAGTCCTGCGCCCATATCTCTACGATCACTCCCATCGGCAAACACACAATCTCTTTTTGGGTTGAAGAGTGGAACGGCAAGGGGTGGCAGAGTCACAGCTGCT
  • RecA CTP Sequence (engineered and codon optimized):
ATGGACTCTCAACTTGTATTAAGCCTGAAGTTGAACCCCTCTTTCACACCACTTAGTCCTTTGTTTCCGTTTACTCCATGTTCCAGTTTCTCCCCATCGCTAAGGTTTTCAAGCTGCTACTCACGAAGACTCTATTCACCTGTCACCGTGTACGCAGCT

Objective:

Codon optimization is a fundamental step in synthetic biology when expressing genes across different organisms. Although the genetic code is universal, meaning that most organisms use the same codons to encode the same amino acids, the frequency at which specific codons are used varies between species. This phenomenon is known as codon usage bias.

Each organism has evolved to preferentially use certain codons over others, largely reflecting the abundance of corresponding transfer RNAs (tRNAs). As a result, a gene originating from one organism may be inefficiently translated when introduced into another if its codon usage does not match the host’s preferences.

In this project, the seven genes encoding the Carbon Monoxide Dehydrogenase (CODH) system originate from a bacterium and are being expressed in a plant (Nicotiana tabacum). Without codon optimization, several issues can arise:

  • Reduced translation efficiency due to rare codons
  • Ribosome stalling or premature termination
  • Lower protein yield or misfolding
  • Overall failure of the multi-subunit complex to assemble correctly

Because the CODH system depends on the coordinated expression of multiple subunits and maturation proteins, balanced and efficient expression of each gene is essential. Even a single poorly expressed component could compromise the functionality of the entire enzyme complex.

Therefore, codon optimization is not just a technical adjustment but a critical requirement for functional expression. In this step, each gene sequence is redesigned to match the codon usage preferences of Nicotiana tabacum, while preserving the exact amino acid sequence of the encoded proteins. Additional considerations, such as avoiding mRNA secondary structures, eliminating cryptic splice sites, and maintaining appropriate GC content, are also taken into account.


Sources:

Phase 3: CTP Junction Design & SPP Cleavage Verification

Subcellular Targeting and Chloroplast Transit Peptide Engineering:

1. Selection of Chloroplast Transit Peptides

To improve targeting efficiency and avoid using repeated sequences, three different plant CTPs were selected:

  • RbcS CTP: is derived from the Rubisco small subunit, one of the most abundant proteins in the chloroplast, and is widely used as a strong and reliable targeting signal.
  • Fer2 CTP: comes from Ferredoxin-2, a chloroplast protein involved in electron transfer during photosynthesis, and is known for efficient import into the chloroplast stroma.
  • RecA CTP: is derived from a chloroplast-localized RecA protein, which plays a role in DNA repair and maintenance within the chloroplast, and provides an alternative targeting signal with a different sequence composition.

These CTPs are derived from naturally chloroplast-targeted plant proteins (Arabidopsis thaliana) and are known to efficiently direct proteins into the chloroplast. Instead of using the same CTP for all seven genes, different peptides were intentionally distributed across the CODH subunits.

2. Fusion Design and Junction Engineering

Each CODH protein was fused to a CTP at its N-terminus. To make sure the protein folds correctly after cleavage, the fusion included the first 60 amino acids of each CODH protein, which were obtained using the ExPASy ProtParam tool.

A very important step was designing the junction between the CTP and the CODH protein. This region was carefully modified to include a cleavage motif recognized by the chloroplast enzyme responsible for removing the transit peptide:

(Val/Ile)-X-(Ala/Cys) ↓ Ala

To create this motif, small changes were made at the end of the CTP sequence as showed in the following sequences:

  • RbcS CTP Sequence: MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVN(+AA)
  • Fer2 CTP Sequence: MASTALSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTA(M–>A)
  • RecA CTP Sequence: MDSQLVLSLKLNPSFTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYA(+A)

This allowed a smooth transition between the CTP and the CODH protein while keeping both targeting and protein structure intact.

3. In Silico Validation of Targeting and Cleavage

All fusion sequences were analyzed using TargetP 2.0 to check two things:

  • Whether the proteins are correctly targeted to the chloroplast
  • Where the CTP is predicted to be cleaved

image image image image image image

The results showed that all seven proteins are predicted to be targeted to the chloroplast, which confirms that the CTPs are working correctly:

coxD fusion: MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNAAMRHHAERDKVAERLAYAGYIPDRDLATAVWLMESLSRPLLLEGEAGVGKTEVALTLAQAN

Prediction: Chloroplast transfer peptide
CS pos: 55-56. VNA-AM. Pr: 0.5216
image image
coxE fusion: MASTALSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAAMVATAAIHESSAASAGARRKLGDFVRVLRDNGFIVGLAEAGDALTVLSRPASLTPSRLRP

Prediction: Chloroplast transfer peptide
CS pos: 51-52. VTA-AM. Pr: 0.3172
image image
coxF fusion: MDSQLVLSLKLNPSFTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYAAMTPTPDVLDLVNNMKARGEPFALATVVRTVSLTAAKAGAKAIILSDGTMTAGWIGGGCAR

Prediction: Chloroplast transfer peptide
CS pos: 51-52. TVY-AA. Pr: 0.4989
image image
coxG fusion: MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNAAMDMNASQRIEASREKVYAALNDVEVLRPCIPGCESIEKISDSEMTAKVTLRIGPVKASFT

Prediction: Chloroplast transfer peptide
CS pos: 55-56. VNA-AM. Pr: 0.5923
image image
coxL fusion: MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNAAMNIQTTVEPTSAERAEKLQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHA

Prediction: Chloroplast transfer peptide
CS pos: 55-56. VNA-AM. Pr: 0.4842
image image
coxM fusion: MASTALSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAAMIPGSFDYHRPKSIADAVALLTKLGEDARPLAGGHSLIPIMKTRLATPEHLVDLRDIGDL

Prediction: Chloroplast transfer peptide
CS pos: 51-52. VTA-AM. Pr: 0.7188
image image
coxS fusion: MDSQLVLSLKLNPSFTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYAAMAKAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVK

Prediction: Chloroplast transfer peptide
CS pos: 51-52. TVY-AA. Pr: 0.5011
image image

Summary of the results:

GeneCTP SourceCleavage Site (CS Position)Junction Motif (CTP → CODH)Cleavage Probability (Pr)Prediction
coxDRbcS55–56VNA ↓ AM0.5216Chloroplast transfer peptide
coxEFer251–52VTA ↓ AM0.3172Chloroplast transfer peptide
coxFRecA51–52TVY ↓ AA0.4989Chloroplast transfer peptide
coxGRbcS55–56VNA ↓ AM0.5923Chloroplast transfer peptide
coxLRbcS55–56VNA ↓ AM0.4842Chloroplast transfer peptide
coxMFer251–52VTA ↓ AM0.7188Chloroplast transfer peptide
coxSRecA51–52TVY ↓ AA0.5011Chloroplast transfer peptide

Interpretation of Results

Overall, the results indicate successful design of functional targeting signals for all CODH subunits:

All constructs were confidently predicted as chloroplast-targeted proteins, confirming that the added CTPs are functional. The cleavage sites align well with the engineered junction motifs, demonstrating that the proteins are likely to be correctly processed after import.

The coxM fusion showed the highest cleavage probability (Pr = 0.7188), indicating highly efficient targeting and processing. Other subunits showed moderate probabilities (around 0.48–0.59), which are still within acceptable ranges for functional targeting. The coxE fusion presented a lower probability (Pr = 0.3172). Although this suggests potentially less efficient cleavage, the sequence still satisfies the required motif and is expected to remain functional, as variability in cleavage efficiency is common in heterologous systems.

Most constructs showed cleavage occurring exactly at the designed motif, typically between amino acid positions 51–56, depending on the transit peptide used.

However, a notable observation was made for two constructs, coxF and coxS, where the predicted cleavage site occurred slightly upstream of the engineered junction, specifically just before the designed alanine-alanine region rather than directly within it.

This slight variation in cleavage position is consistent with the known behavior of the chloroplast Stromal Processing Peptidase. Rather than recognizing a single fixed sequence, the enzyme identifies a broader structural and sequence context, which allows for some flexibility in the exact cleavage position. As a result, small shifts of one or two amino acids relative to the designed motif are commonly observed in both native and engineered proteins.

In this case, although the cleavage in coxF and coxS occurs marginally earlier than expected, it remains within a functionally acceptable region. The resulting mature proteins retain nearly identical N-terminal sequences and are not expected to lose any essential structural or functional elements. Importantly, the targeting prediction remains strong, confirming that the proteins are still efficiently directed to the chloroplast.

Therefore, this variability does not compromise the overall design. All fusion constructs are considered valid, and no redesign was required. Instead, this observation reflects the inherent flexibility of chloroplast protein processing and further validates the robustness of the engineered system.

Objective

Subcellular targeting is a critical step in synthetic biology when expressing proteins in a new host organism. In plant cells, proteins must be directed to the correct organelle in order to function properly. This is especially important for metabolic pathways that depend on specific cellular environments.

In this project, the seven proteins forming the Carbon Monoxide Dehydrogenase (CODH) system originate from a bacterium. However, in plant cells, these proteins need to function inside the chloroplast, where photosynthesis occurs and where the produced CO₂ can be directly reused.

Bacterial proteins do not naturally contain signals that allow them to enter plant organelles. As a result, if they are expressed without modification, they will remain in the cytosol, where they may not fold correctly, may not interact properly with other subunits, and may fail to form a functional enzyme complex.

To solve this problem, each CODH protein must be fused to a chloroplast transit peptide (CTP). These short sequences are naturally found in plant proteins and act as targeting signals that guide newly synthesized proteins into the chloroplast. Once the protein reaches the chloroplast, the transit peptide is cleaved, releasing the mature protein in its functional form.


Sources:

  • An optimized transit peptide for effective targeting of diverse foreign proteins into chloroplasts in rice | Scientific Reports. (n.d.). Retrieved May 5, 2026, from https://www.nature.com/articles/srep46231
  • Caspari, O. D. (2022). Transit Peptides Often Require Downstream Unstructured Sequence for Efficient Chloroplast Import in Chlamydomonas reinhardtii. Frontiers in Plant Science, 13. https://doi.org/10.3389/fpls.2022.825797
  • Caspari, O. D., Garrido, C., Law, C. O., Choquet, Y., Wollman, F.-A., & Lafontaine, I. (2023). Converting antimicrobial into targeting peptides reveals key features governing protein import into mitochondria and chloroplasts. Plant Communications, 4(4), 100555. https://doi.org/10.1016/j.xplc.2023.100555
  • Chung, B. K.-S., & Lee, D.-Y. (2012). Computational codon optimization of synthetic gene for protein expression. BMC Systems Biology, 6, 134. https://doi.org/10.1186/1752-0509-6-134
  • Codon Adaptation Index. (2024). In Wikipedia. https://en.wikipedia.org/w/index.php?title=Codon_Adaptation_Index&oldid=1254549471
  • Dietel, A.-K., Merker, H., Kaltenpoth, M., & Kost, C. (2019). Selective advantages favour high genomic AT-contents in intracellular elements. PLoS Genetics, 15(4), e1007778. https://doi.org/10.1371/journal.pgen.1007778
  • Lee, S., Weon, S., Lee, S., & Kang, C. (2010). Relative Codon Adaptation Index, a Sensitive Measure of Codon Usage Bias. Evolutionary Bioinformatics Online, 6, 47–55. https://doi.org/10.4137/ebo.s4608
  • Li, Q., Luo, Y., Sha, A., Xiao, W., Xiong, Z., Chen, X., He, J., Peng, L., & Zou, L. (2023). Analysis of synonymous codon usage patterns in mitochondrial genomes of nine Amanita species. Frontiers in Microbiology, 14. https://doi.org/10.3389/fmicb.2023.1134228
  • Monjezi, Z., Rooshanfekr, H. allah, Nazari, M., Salabi, F., & Tabandeh, M. R. (2024). Codon optimization of voraxin α sequence enhances the immunogenicity of a recombinant vaccine against Hyalomma anatolicum infestation in rabbits. Veterinary Immunology and Immunopathology, 275, 110817. https://doi.org/10.1016/j.vetimm.2024.110817
  • Puigbò, P., Bravo, I. G., & Garcia-Vallve, S. (2008). CAIcal: A combined set of tools to assess codon usage adaptation. Biology Direct, 3, 38. https://doi.org/10.1186/1745-6150-3-38
  • Richter, S., & Lamppa, G. K. (1999). Stromal Processing Peptidase Binds Transit Peptides and Initiates Their Atp-Dependent Turnover in Chloroplasts. The Journal of Cell Biology, 147(1), 33–44. https://doi.org/10.1083/jcb.147.1.33
  • Supek, F., & Šmuc, T. (2010). On Relevance of Codon Usage to Expression of Synthetic and Natural Genes in Escherichia coli. Genetics, 185(3), 1129–1134. https://doi.org/10.1534/genetics.110.115477
  • Thagun, C., Odahara, M., Kodama, Y., & Numata, K. (2024). Identification of a highly efficient chloroplast-targeting peptide for plastid engineering. PLOS Biology, 22(9), e3002785. https://doi.org/10.1371/journal.pbio.3002785
  • Willems, T., Hectors, W., Rombaut, J., De Rop, A.-S., Goegebeur, S., Delmulle, T., De Mol, M. L., De Maeseneire, S. L., & Soetaert, W. K. (2023). An exploratory in silico comparison of open-source codon harmonization tools. Microbial Cell Factories, 22, 227. https://doi.org/10.1186/s12934-023-02230-y

Phase 4: Promoter-Terminator Pairing and Expression Simulation (Asimov Kernel)

Promoter–Terminator Pairing and Expression Design:

Initial Design Strategy

I first assembled a promoter library containing 20 plant promoters with different reported expression strengths, together with a smaller library of seven plant terminators.

The initial strategy was to generate multiple promoter–terminator combinations for each CODH gene and then computationally simulate their predicted expression behavior using the Asimov Kernel platform. This simulation step was intended to help compare the different expression architectures before final construct selection.

The design process was based on several important principles:

  • Stronger genes or more critical proteins should receive stronger promoters
  • Structural subunits should maintain relatively balanced stoichiometry
  • Strong promoters should generally be paired with stronger terminators
  • Construct size should remain compatible with cloning and synthesis workflows
  • Extremely high expression should be avoided when possible to reduce metabolic stress and instability risks

Using these principles, multiple candidate expression sets were generated for both the structural genes and the maturation genes.

Structural Gene Expression Sets

The structural construct contains the three genes directly forming the CODH enzyme complex:

  • coxL —> the large catalytic subunit
  • coxM —> the electron transfer medium subunit
  • coxS —> the iron-sulfur small subunit

Set 1 — High Balanced Expression (Primary Candidate)

GenePromoterRelative StrengthRecommended TerminatorReasoning
coxLdPCisV6×tOCSStrongest terminator paired with the strongest promoter to maximize CoxL expression. CoxL is the largest catalytic subunit and requires the highest transcriptional support.
coxMPNCR5×tHSP18.2Second strongest terminator matched with a highly active promoter to maintain balanced expression relative to CoxL.
coxSDaMVFLt45×tATPaseHigh-performance terminator selected to provide expression levels comparable to coxM while preserving subunit stoichiometry.

This configuration was designed to maximize structural gene expression while maintaining relatively balanced production between the three subunits.

Set 2 — Medium-High Balanced Expression (Alternative)

GenePromoterRelative StrengthRecommended TerminatorReasoning
coxLD1002.2×tOCSAgain, the strongest terminator was paired with the lead structural gene to maximize transcriptional output and support high CoxL accumulation.
coxMSM2.1×tHSP18.2Promoters and terminators with similar strengths were combined to maintain balanced intermediate expression levels.
coxSFMV 34S (Sgt)2×tATPaseThe same stepwise promoter–terminator pairing strategy was maintained to preserve proportional expression among structural subunits.

This set provided a more moderate expression profile. Although weaker than Set 1, it was expected to reduce cellular burden and lower the risks associated with excessive transgene expression.

Set 3 — Very High Expression Configuration

GenePromoterRelative StrengthRecommended TerminatorReasoning
coxLM2410×tOCSM24 is an extremely strong promoter and therefore requires pairing with the strongest terminator to ensure efficient transcription termination and prevent premature transcript instability.
coxMCPV 2Comparable to e35StHSP18.2tHSP18.2 was selected to support stable expression; however, CPV2 is substantially weaker than M24, creating a potential stoichiometric imbalance between CoxL and CoxM expression levels.
coxSTobUbi.u47×tATPaseA strong terminator was retained to match the high activity of the TobUbi.u4 promoter and maintain efficient expression of the coxS subunit.

This configuration aimed to maximize expression output. However, because of the extremely strong promoters involved, it also carried higher risks of stoichiometric imbalance, metabolic stress, transcriptional instability, and possible silencing effects.

Maturation Gene Expression Sets

The maturation construct contains four accessory genes involved in CODH assembly and activation:

coxD coxE coxF coxG

Unlike the structural genes, these proteins are not part of the final catalytic complex itself but are essential for proper enzyme maturation, sulfur insertion, and cofactor incorporation.

Special attention was given to coxD because it plays a central role in active-site maturation.

Set 4 — Balanced Maturation Expression

GenePromoterRelative StrengthRecommended TerminatorReasoning
coxDPTSB1~2.4×tOCSThe strongest promoter in this maturation construct was paired with the strongest terminator because CoxD is the most critical maturation protein and should not become rate-limiting during enzyme assembly.
coxED1002.2×tHSP18.2The second strongest promoter was matched with a highly efficient terminator to maintain balanced and stable expression of the coxE maturation factor.
coxFSM2.1×T-35SA moderately strong viral terminator was selected to support stable transcription while avoiding repeated use of the same terminator combinations across constructs.
coxGFMV 34S (Sgt)2×tATPaseThe strong tATPase terminator was used to compensate for the relatively weaker promoter and maximize final transcript accumulation for coxG.

This set was designed to maintain balanced maturation-protein production while prioritizing coxD expression because of its importance in catalytic-site activation.

Set 5 — Lower Expression Configuration

GenePromoterRelative StrengthRecommended TerminatorReasoning
coxDS1001.8×tOCSWeaker promoters benefit the most from highly efficient terminators; therefore, tOCS was selected to compensate for the lower promoter strength and maximize transcript stability.
coxEBM1.72×tHSP18.2The same compensation strategy was applied by pairing a moderately weak promoter with a high-performance terminator to improve overall expression efficiency.
coxFPPHYB~1.5×tATPaseA robust terminator was retained to stabilize transcripts produced from the moderate-strength PPHYB promoter.
coxGMSD31.15×T-E9The T-E9 terminator was selected as a reliable transcriptional terminator to support expression from the weakest promoter within this construct set.

This configuration represented a weaker-expression alternative intended to minimize cellular burden and reduce possible stress associated with transgene overexpression.

The original plan for this phase was to computationally simulate all designed expression sets using the Asimov Kernel platform.

The objective of these simulations was to:

  • Predict relative expression behavior
  • Evaluate stoichiometric balance between genes
  • Identify potential bottlenecks in the pathway
  • Detect excessive or insufficient expression levels
  • Refine promoter–terminator combinations before DNA synthesis

At the current stage of the project, access to the Asimov Kernel platform is still pending. To avoid delaying the workflow, provisional promoter–terminator combinations were selected manually based on promoter strength, expected biological balance, construct compactness, and cloning feasibility.

If access to Asimov Kernel becomes available later, the selected systems will still be computationally validated, and additional adjustments may be introduced if simulation results suggest improved expression architectures.

Final Selected Expression Systems

Final Structural Construct Selection

For the structural genes, Set 2 was selected as the final configuration.

Although Set 1 and Set 3 could potentially generate stronger expression, Set 2 was considered more biologically balanced and technically safer. The moderate promoter strengths reduce the likelihood of excessive chloroplast burden, instability, or transcriptional silencing while still maintaining relatively balanced subunit expression.

Final structural configuration:

GenePromoterTerminator
coxLD100tOCS
coxMSMtHSP18.2
coxSFMV 34StATPase

Final Maturation Construct Selection

For the maturation genes, a modified version of Set 4 was selected.

Initially, the promoter PTSB1 was assigned to coxD because of its relatively strong expression profile. However, this promoter was approximately 1.5 kb long, which significantly increased construct size and cloning complexity.

To maintain a more compact and synthesis-friendly construct, PTSB1 was replaced with D100 while preserving the overall balanced-expression strategy.

Final maturation configuration:

GenePromoterTerminator
coxDD100tOCS
coxESMtHSP18.2
coxFS100tATPase
coxGFMV 34ST-35S

This final configuration aimed to preserve balanced maturation-gene expression while improving construct compactness and compatibility with downstream Gibson Assembly and DNA synthesis workflows.

Objective

After completing sequence collection, codon optimization, chloroplast transit peptide fusion, and cleavage site verification, the next objective was to design the regulatory architecture controlling expression of the seven CODH genes inside Nicotiana tabacum cells.

The CODH pathway is composed of multiple interacting structural and maturation proteins that must function together in a coordinated manner. Because of this, maintaining balanced expression between the genes is critical. Excessive or insufficient expression of specific subunits could negatively affect protein folding, complex assembly, chloroplast burden, and overall enzyme functionality.

Therefore, the main goal of this phase was to design a biologically balanced expression system by selecting suitable promoter–terminator combinations capable of driving efficient and coordinated expression of all seven CODH genes.

The initial plan for this phase was to:

  • Build multiple promoter–terminator combinations for each gene
  • Simulate their expression behavior using the Asimov Kernel platform
  • Compare predicted expression outputs
  • Select the most balanced and stable expression architecture for the final constructs

The final promoter–terminator combinations were selected based on relative promoter strengths, functional compatibility between regulatory elements, and expected expression balance across the CODH pathway. Terminator efficiency values were taken from reported comparative plant expression data in Shakhova et al. (2022). The overall performance scores were predicted using an AI-based evaluation (Claude AI) integrating promoter strength, terminator efficiency, and expected transcriptional balance.

GenePromoterStrengthTerminatorCombined Performance
coxLD1002.2×tOCS★★★★
coxMSM2.1×tHSP18.2★★★★
coxSFMV 34S2.0×tATPase★★★
coxDD1002.2×tOCS★★★★
coxESM2.1×tHSP18.2★★★★
coxFS1001.8×tATPase★★★
coxGFMV 34S2.0×T-35S★★★

Phase 5: Cassette Design & Twist Bioscence Preparation

Cassette Architecture & Synthesis Preparation:

Cassette Architecture Design

Each expression cassette was designed using the same general architecture: Promoter → AMV Enhancer → Chloroplast Transit Peptide (CTP) → CODH Gene → Tag (if applicable) → Terminator image image All seven cassettes were designed individually in Benchling before being assembled into the larger Structural and Maturation multicassette constructs.

Selection of Regulatory and Functional Elements

  1. Promoter–Terminator Combinations

The promoter–terminator pairs selected during the previous phase were incorporated into the final cassette designs to drive constitutive expression in tobacco cells. Different promoter strengths were intentionally distributed across the genes to maintain balanced expression between structural and maturation proteins.

  1. AMV RNA4 Translational Enhancer

Each cassette included the modified AMV RNA4 translational enhancer immediately downstream of the promoter. The endogenous ATG codon was previously removed from the enhancer sequence to ensure that translation initiates only at the intended chloroplast transit peptide start codon.

This enhancer was incorporated to improve ribosome recruitment and increase translational efficiency of the engineered mRNAs.

  1. Chloroplast Transit Peptides (CTPs)

Because the CODH pathway must function inside chloroplasts, chloroplast transit peptides were fused upstream of each CODH coding sequence. These CTPs act as molecular targeting signals directing the newly synthesized proteins from the cytoplasm into the chloroplast after translation. Different transit peptides were selected based on predicted compatibility and chloroplast import efficiency.

  1. CODH Gene Fusion

Each codon-optimized CODH gene was fused directly downstream of its corresponding chloroplast transit peptide in order to generate a continuous translational fusion protein.

This design ensures that the targeting peptide is translated first and recognized by the chloroplast import machinery before cleavage by stromal processing peptidase (SPP).

  1. Epitope Tag Integration

Specific epitope tags were incorporated into selected cassettes to facilitate downstream protein detection, purification, and complex characterization. The following tags were used: FLAG tag for coxL and coxD; His tag for coxS

These tags were included to support future protein purification, Co-IP experiments, PAGE analysis, and enzyme characterization workflows during the experimental validation phase.

image image

Final Cassette Components

The final regulatory combinations and chloroplast targeting peptides used for each cassette are summarized below.

GenePromoterCTP SourceTerminatorTag
coxLD100RbcStOCSFLAG
coxMSMFer2tHSP18.2—
coxSFMV 34SRecAtATPaseHis
coxDD100RbcStOCSFLAG
coxESMFer2tHSP18.2—
coxFS100RecAtATPase—
coxGFMV 34SRbcST-35S—

The objective of this step was to design each cox gene as an independent plant expression cassette containing all the required regulatory elements for efficient expression in Nicotiana tabacum. This included selecting appropriate promoters, terminators, chloroplast transit peptides (CTPs), translational enhancers, purification tags, and spacer sequences, while organizing the multicassette constructs in a modular format compatible with DNA synthesis and Gibson Assembly.

Vector Linearization and Homology Arm Design:

Before assembling the large Structural and Maturation multicassette inserts, the next objective was to identify suitable insertion sites within the pCAMBIA backbones and generate homology arms compatible with Gibson Assembly.

This step was essential to ensure seamless integration of the final multicassette constructs into the plant transformation vectors.

Selection of the Restriction Site

To determine the optimal vector opening site, the multiple cloning site (MCS) maps of both pCAMBIA1300 and pCAMBIA2300 were analyzed in Benchling.

The restriction enzymes previously excluded during gene and cassette design (“Clean List”) were cross-referenced against the vector maps to avoid conflicts with internal restriction sites present in the final constructs.

Following this analysis, XbaI was selected as the universal linearization site for both vectors because:

  • It was absent from the designed multicassette inserts
  • It produced a clean single-cut linearization
  • It was positioned appropriately within the MCS regionIt simplified downstream Gibson Assembly design

Both pCAMBIA vectors were virtually digested in Benchling using XbaI:

  • pCAMBIA2300 → designated for the Structural multicassette
  • pCAMBIA1300 → designated for the Maturation multicassette

image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image image

This generated linearized vector backbones with defined left and right insertion junctions.

Homology Arm Design

To enable Gibson Assembly, homology arms were generated directly from the terminal sequences of the XbaI-linearized vectors.

For each construct, 40 bp regions located at the ends of the digested vectors were extracted and incorporated as terminal overlaps (“tails”) on the outer fragments of the multicassette inserts.

These homology arms provide complementary regions between the vector backbone and the insert, allowing seamless enzymatic assembly during Gibson Assembly.

Because both vectors were linearized at the same XbaI site, the resulting homology arms were identical for the two constructs.

Final Homology Arms

  • Left Homology Arm : gaccatgattacgaattcgagctcggtacccggggatcct image image

  • Right Homology Arm: ctagagtcgacctgcaggcatgcaagcttggcactggccg image image

These sequences were directly extracted from the terminal regions of the XbaI-digested pCAMBIA vectors after virtual linearization in Benchling.

The objective of this step was to prepare the pCAMBIA2300 and pCAMBIA1300 backbones for Gibson Assembly by virtually linearizing the vectors at a selected restriction site and generating homologous overlap regions. These homology arms were designed to guide the precise insertion and seamless assembly of the multicassette fragments into the plasmid backbones.

Twist Fragment Preparation & Troubleshooting:

After finishing the design of all seven expression cassettes in Benchling, I prepared the sequences for synthesis by Twist Bioscience. The objective of this step was to divide the large multicassette constructs into smaller DNA fragments compatible with DNA synthesis and Gibson Assembly.

Initially, I tried to submit each complete fragment directly to the Twist synthesis platform. Although several fragments were accepted immediately, others were rejected because the algorithm detected highly repetitive DNA regions.

The major problem came from the synthetic promoters D100 and S100, which contain repeated enhancer motifs. Repetitive DNA is problematic for commercial DNA synthesis because it can:

  • Reduce synthesis accuracy
  • Increase recombination risks
  • Create instability during cloning
  • Interfere with sequence assembly algorithms

To solve these issues, I performed several optimization and troubleshooting steps directly in Benchling.

Fragment A

Fragment A was designed for the structural multicassette construct cloned into the pCAMBIA2300 backbone.

This fragment initially contained: [Left Homology Arm] – [Spacer 1] – [coxL Cassette] – [40 bp Spacer 2]

The fragment was rejected by the Twist algorithm because the D100 promoter contained two repeated enhancer regions. image image

image image

To solve this issue, I first tried to identify the functional transcription factor binding regions inside the promoter sequence. Using the promoter map from the original publication, I localized the consensus sequences (functional boxes) and carefully avoided modifying them.

image image

I then introduced small nucleotide substitutions only in the non-functional repeated regions. The modifications included: A ↔ T, G ↔ C substitutions

image image

I specifically used complementary substitutions in order to maintain approximately the same GC content and preserve promoter stability.

These modifications reduced the number of repeated regions detected by Twist, but the fragment was still rejected.

I also tried to optimize the repeated region located near the end of the coxL cassette. Several synonymous sequence modifications were tested: GGAGAGCAACTTGGACTT→ GGTGAACAGCTGGGTTTG→ GGCGAGCAACTTGGACTT→ GGAGAACAGCTCGGCTTG

image image

However, the Twist algorithm continued detecting problematic repeats.

  • Final Solution: Fragment Splitting

Since sequence optimization alone was insufficient, I decided to split Fragment A into two smaller fragments, A1 and A2.

The objective was to physically separate the repeated enhancer regions of the D100 promoter into different synthesis fragments.

After splitting the construct, both fragments were accepted successfully by Twist Bioscience without additional problems.

  • Final Fragment Design

  • Fragment A1 : [Left Homology Arm] – [Spacer 1] – [First Part of D100]

gaccatgattacgaattcgagctcggtacccggggatcctGAAGTTCTATGACTCAATTGTTCATAGTGTTTACATCACCGCCAATTGCTTTTAAGACTGAACGCATGAAATATGGTTTTTCGTCATGTTTTGAGTCTGCGCTCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCcccgacAATCCTCCTCAGGAAATGAAGGATTCAGGAGATCTTCTCTATCAACTTGCTCAAGTAAGGACAAACGGGTTCACCCGGATCCTCCAGAAGACCCAGTCTATCAACGGAGAAACAAAGATAAAAATCAATTACTCACATGAAAGAGTATTGATCACGAGTCACTATGGAGCGACAATCTCCAGACAGGATGTCAGCATCTTATCTTCCTTTGAAGAAAGCATCATCAATAACGATGTAATGGTGGGGAC
  • Fragment A2 : [40 bp overlap from A1] – [Remaining D100 region + Full coxL cassette] – [40 bp Spacer 2]
TTGAAGAAAGCATCATCAATAACGATGTAATGGTGGGGACATCCACTAAGTTATTGCTCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCTATATAATGGCATTCACCCCTCAGTTGAAGAGCATCAGGAGTTTCAGCATAGAAACTTTCTCTTTAACAAATCTATCTTTTCTTTAAAGCATGTGTGAGTAGAAACCCATATAGGGTTATAATGTGTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCAATGGCCTCATCAATGCTCAGTAGCGCCACAATGGTGGCAAGTCCTGCTCAAGCTACAATGGTCGCTCCCTTTAATGGTCTGAAGTCGTCCGCAGCATTCCCAGCAACTAGAAAAGCTAATAATGACATAACGAGCATTACCAGCAACGGAGGCAGGGTAAACGCTGCGATGAATATTCAGACAACAGTTGAACCAACTAGCGCTGAGAGAGCAGAAAAGTTGCAGGGTATGGGGTGCAAGAGGAAAAGAGTCGAAGATATTCGATTTACTCAGGGTAAGGGCAATTACGTCGATGATGTGAAATTACCGGGTATGTTGTTTGGTGATTTTGTTAGGAGTAGCCACGCTCATGCTAGGATTAAAAGTATTGATACCTCAAAAGCTAAGGCGCTTCCAGGTGTATTCGCTGTTTTAACAGCGGCAGATTTGAAGCCTCTGAATTTACATTATATGCCCACTCTGGCTGGAGATGTACAAGCAGTTCTTGCAGACGAGAAAGTTCTTTTCCAAAATCAAGAGGTTGCTTTTGTAGTGGCTAAAGATAGATACGTTGCGGCAGATGCGATCGAATTGGTAGAAGTAGATTATGAGCCATTACCAGTTCTAGTAGACCCATTCAAGGCAATGGAACCAGATGCACCTCTTCTAAGAGAAGATATTAAAGACAAAATGACTGGTGCACACGGTGCGAGGAAACATCACAACCATATATTCAGATGGGAAATAGGTGATAAGGAAGGAACTGATGCTACCTTCGCCAAAGCTGAAGTTGTGTCAAAAGATATGTTTACCTATCATCGGGTTCATCCGAGCCCACTGGAAACGTGTCAATGTGTTGCATCTATGGACAAGATCAAGGGTGAACTGACGTTGTGGGGCACATTTCAGGCTCCCCATGTCATTAGAACAGTAGTGTCATTGATCAGCGGTTTGCCAGAGCATAAAATCCACGTCATTGCACCTGACATAGGGGGAGGATTTGGAAACAAGGTGGGAGCTTATTCCGGGTACGTCTGTGCTGTGGTTGCCTCCATCGTGCTGGGAGTACCCGTTAAGTGGGTCGAAGATCGAATGGAGAACCTAAGCACTACATCATTTGCACGTGACTACCACATGACTACAGAACTCGCAGCTACAAAGGATGGAAAGATTCTTGCAATGCGCTGTCACGTCTTGGCTGATCACGGAGCTTTCGATGCCTGTGCTGATCCATCTAAATGGCCTGCTGGGTTTATGAACATATGTACAGGAAGCTATGACATGCCAGTTGCACATTTGGCCGTGGATGGTGTCTATACTAACAAAGCATCCGGCGGAGTAGCTTATAGGTGCTCATTCCGAGTTACAGAAGCTGTTTATGCCATTGAGAGGGCTATTGAGACTCTGGCTCAGCGGCTCGAGATGGATTCAGCTGATCTAAGAATAAAGAACTTTATACAACCTGAGCAGTTCCCTTATATGGCTCCTCTTGGCTGGGAGTACGACAGCGGAAATTATCCATTAGCGATGAAGAAAGCTATGGATACTGTTGGTTATCATCAACTTCGTGCTGAACAGAAAGCCAAACAAGAAGCATTTAAGCGGGGCGAGACACGCGAGATTATGGGAATTGGTATCTCGTTTTTCACCGAGATTGTTGGCGCCGGGCCGTCTAAGAATTGTGATATTCTCGGAGTTTCTATGTTTGATAGTGCAGAAATTCGTATTCATCCAACCGGTTCAGTGATTGCTAGAATGGGCACTAAGAGCCAGGGCCAGGGGCACGAGACTACTTACGCTCAAATCATAGCAACCGAACTCGGTATTCCCGCTGACGACATTATGATCGAAGAAGGGAATACCGATACTGCCCCTTATGGGCTTGGAACTTACGGAAGTCGCTCGACACCCACGGCTGGTGCTGCAACCGCTGTGGCCGCTCGTAAAATAAAAGCCAAGGCTCAAATGATTGCAGCACACATGCTCGAAGTGCATGAGGGAGATTTGGAATGGGACGTGGACAGATTTAGGGTTAAAGGTCTTCCGGAAAAATTCAAGACTATGAAGGAACTCGCATGGGCATCCTACAATAGTCCACCACCCAATCTTGAGCCTGGGCTCGAGGCTGTGAACTATTACGACCCTCCTAATATGACTTATCCTTTTGGTGCCTATTTTTGCATTATGGATATAGATGTGGATACTGGCGTCGCCAAAACCAGGAGGTTCTATGCATTAGACGATTGCGGAACAAGAATCAACCCGATGATTATAGAAGGGCAAGTTCATGGTGGTTTGACAGAGGCCTTCGCAGTAGCTATGGGGCAGGAGATCCGATACGACGAGCAAGGAAATGTGCTTGGAGCATCTTTTATGGACTTCTTCTTGCCAACGGCCGTCGAAACACCAAAGTGGGAGACAGATTACACAGTTACTCCATCTCCACATCATCCTATAGGAGCCAAAGGCGTTGGTGAAAGTCCTCATGTTGGCGGTGTGCCTTGCTTTTCAAATGCGGTTAATGATGCTTACGCATTTTTAAACGCAGGCCACATCCAAATGCCTCATGATGCATGGAGACTATGGAAGGTAGGAGAGCAACTTGGACTTCACGTCCATCATCATCATCATCATTAActgctttaatgagatatgcgagaagcctatgatcgcatgatatttgctttcaattctgttgtgcacgttgtaaaaaacctgagcatgtgtagctcagatccttaccgccggtttcggttcattctaatgaatatatcacccgttactatcgtatttttatgaataatattctccgttcaatttactgattgtaccctactacttatatgtacaatattaaaatgaaaacaatatattgtgctgaataggtttatagcgacatctatgatagagcgccacaataacaaacaattgcgttttattattacaaatccaattttaaaaaaagcggcagaaccggtcaaacctaaaagactgattacataaatcttattcaaatttcaaaagtgccccaggggctagtatctacgacacaccgagcggcgaactaataacgctcactgaagggaactccggttccccgccggcgcgcatgggtgagattccttgaagttgagtattggccgtccgctctaccgaaagttacgggcaccattcaacccggtccagcacggcggccgggtaaccgacttgctgccccgagaattatgcagcatttttttggtgtatgtgggccccaaatgaagtgcaggtcaaaccttgacagtgacgacaaatcgttgggcgggtccagggcgaattttgcgacaacatgtcgaggctcagcagGAATATTGGTTACGTCTGCATGTGCTATCTGCGCCCATAT

I added a 40 bp overlap between A1 and A2 to allow seamless Gibson Assembly during the final plasmid construction.

Fragment B was accepted directly by the Twist algorithm without requiring any optimization. This fragment contained: [Spacer 2] – [Full coxM Cassette] – [Spacer 3]

GAATATTGGTTACGTCTGCATGTGCTATCTGCGCCCATATCATCCAGTGGTCGTAGCAGTCGTTGATGTTCTCCGCTTCGATAACTCTGTTGAATGGCTCGAACACCGTTCGAGTGTCATCGACAGGCCAAGGCCAACAGATGATCATTTCAGACCATGGGGGGATGTTACATACTGGCTGAATAAAGAAGCAGAAGAGTGCCACACAAGGGGCGACAACGTCGAAGGCGCAGAAGACGCAGTCGATCTCACTGACGTAAGCAATGACGACCAGTGGAGGAGATCGTAAGCAATGACGTATGGAGCGTGGAGGACCCATGAAAGCACTGAGAAGGCATCTCAACTTTCGGTGTGTGAGTGCGCATCCTATGCGATGCTTTGTTTCGTCCACAGACATCAACATCTTATCGTCCTTTGAAGATAAGATAATAATGTTGAAGATAAGAGTGGGAGCCACCACTAAAACATTGCTTTGTCAAAAGCTAAAAAAGATGATGCCCGACAGCCACTTGTGTGAAGCATGTGAAGCCGGTCCCTCCACTAAGAAAATTAGTGAAGCATCTTCCAGTGGTCCCTCCACTCACAGCTCAATCAGTGAGCAACAGGACGAAGGAAATGACGTAAGCCATGACGTCTAATCCCGTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCAATGGCTAGCACCGCACTGAGCTCAGCCATTGTGGGAACTTCCTTCATCCGGAGAAGTCCTGCGCCCATATCTCTACGATCACTCCCATCGGCAAACACACAATCTCTTTTTGGGTTGAAGAGTGGAACGGCAAGGGGTGGCAGAGTCACAGCTGCTATGATACCTGGATCATTTGATTATCATAGACCAAAATCCATTGCAGACGCAGTTGCTCTTCTTACGAAATTAGGGGAGGATGCTAGACCTTTGGCCGGAGGCCACAGCCTAATTCCTATTATGAAGACCAGATTAGCTACACCAGAACATTTGGTTGATCTCAGGGATATTGGAGATTTAGTCGGAATTAGGGAGGAGGGTACGGACGTCGTCATCGGGGCAATGACAACTCAGCATGCGCTTATAGGTTCAGATTTCTTGGCAGCAAAATTGCCAATTATTCGCGAGACAAGCCTGTTGATAGCAGATCCACAAATAAGGTACATGGGAACCATTGGCGGCAATGCCGCTAACGGAGATCCTGGAAACGATATGCCGGCCCTCATGCAGTGCTTGGGTGCGGCTTACGAACTCACTGGCCCTGAAGGTGCTCGTATAGTTGCTGCACGAGATTACTATCAAGGGGCTTATTTCACTGCTATTGAGCCCGGTGAACTTCTTACAGCAATCAGAATCCCCGTGCCACCCACTGGACACGGGTACGCTTACGAAAAACTGAAGCGGAAAATTGGCGACTATGCCACCGCCGCGGCAGCTGTAGTACTAACAATGAGTGGTGGAAAATGTGTGACTGCATCGATCGGTCTAACTAATGTTGCGAACACACCACTTTGGGCAGAAGAGGCCGGAAAGGTGTTGGTTGGTACTGCTCTCGACAAACCTGCTTTAGACAAGGCTGTAGCTCTGGCTGAGGCTATCACAGCTCCGGCATCTGATGGTCGCGGGCCAGCAGAATATCGAACCAAGATGGCTGGTGTTATGCTTCGTAGGGCAGTTGAAAGAGCAAAGGCCAGAGCCAAGAATTAATAGGTTAAatatgaagatgaagatgaaatatttggtgtgtcaaataaaaagcttgtgtgcttaagtttgtgtttttttcttggcttgttgtgttatgaatttgtggctttttctaatattaaatgaatgtaagatctcattataatgaataaacaaatgtttctataatccattgtgaatgttttgttggatctcttctgcagcatataactactgtatgtgctatggtatggactatggaatatgattaaagataagGATTGCGCCTACCCGGATATTATCGTGAGGATGCGTCATCGCCATTGCTCCCCAAATACAAAACCAATTTCAGCCAGTGCCTCGTCCATTTTTTCGATGA

The fragment already satisfied all synthesis requirements because it did not contain repetitive regions or problematic GC-rich structures. This overlap design ensured proper assembly continuity during Gibson Assembly.

Fragment C was also accepted directly without major issues. This fragment contained: [Last 40 bp of Spacer 3] – [Full coxS Cassette] – [Right Homology Arm]

AAACCAATTTCAGCCAGTGCCTCGTCCATTTTTTCGATGATTTACAGTAAGAACTGATAACAAAAATTTTACTTATTTCCTTAGAATTAATCTTAAAGGTGATAGTAAACAAGGACGATTAGTCCGTTGGCAAAATTGGTTCAGCAAGTATCAATTTGATGTCGAACATCTTGAAGGTGTAAAAAACGTTTTAGCAGATTGCCTCACGAGAGATTTTAATGCTTAAAAACGTAAGCGCTGACGTATGATTTCAAAAAACGCAGCTATAAAAGAAGCCCTCCAGCTTCAAAGTTTTCATCAACACAAATTCTAAAAACAAAATTTTTAGAGAGGGGGAGTGGTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCAATGGACTCTCAACTTGTATTAAGCCTGAAGTTGAACCCCTCTTTCACACCACTTAGTCCTTTGTTTCCGTTTACTCCATGTTCCAGTTTCTCCCCATCGCTAAGGTTTTCAAGCTGCTACTCACGAAGACTCTATTCACCTGTCACCGTGTACGCAGCTATGGCGAAAGCTCACATTGAACTCACGATCAACGGACATCCAGTGGAGGCATTGGTTGAACCTCGGACTTTACTAATTCACTTCATTAGAGAGCAACAGAACCTTACCGGCGCACATATCGGATGCGACACTTCACACTGCGGGGCTTGTACTGTTGATCTCGATGGTATGAGCGTGAAGAGCTGTACAATGTTTGCTGTCCAAGCTAATGGAGCTTCAATCACCACCATTGAAGGAATGGCAGCACCGGATGGTACACTGAGTGCTCTGCAAGAAGGGTTTAGGATGATGCATGGTTTGCAATGCGGTTACTGTACTCCAGGGATGATCATGCGATCCCATAGATTGCTTCAAGAGAATCCAAGCCCCACAGAAGCGGAAATAAGGTTCGGAATTGGTGGAAATCTTTGCCGCTGTACAGGCTACCAGAACATTGTTAAAGCAATACAGTATGCCGCCGCTAAGATAAATGGCGTACCTTTTGAGGAGGCCGCAGAAGACTACAAGGACGACGATGACAAGTAAaccgcactgtgtgtggtttctcaagaccaagacagctaaagcctaaagtcagagatctaatatgtgtattgttattcatgacaccacagctgccacttttggtgttatgatctgtttgtagaagtaggaattcttttttttctacttaataatagcttaaagagctgtgcaatttggtctgtattttttgtgtattttgcactcattatttgtgaacagtttgagaactatttattttctaagatttgtgcacgtatgaaccacttttcatctatataccaccatgtttattctgcatctatgggattgagtttgaatattcgttgatcaacaaagttatatttggtggatactacttgaaggtgcatatactttgtgctcatatatttagttgatattctggattttgagctggacaaattgatcaaggtagtctaatctggtctggttactaataaaactcaagagatcactctagagtcgacctgcaggcatgcaagcttggcactggccg

The fragment was designed to terminate the structural multicassette assembly inside the pCAMBIA2300 backbone.

This organization ensured proper circularization of the final plasmid during Gibson Assembly.

  • Fragment D

Fragment D belonged to the maturation multicassette construct cloned into pCAMBIA1300. Initially, the fragment contained: [Left Homology Arm] – [Spacer 1] – [coxD Cassette] – [Spacer 2]

Like Fragment A, this fragment was rejected because the D100 promoter contained repeated enhancer regions detected by the Twist algorithm. Instead of modifying the sequence extensively, I decided to split the fragment into two smaller fragments. The objective was again to physically separate the repeated promoter regions.

  • Final Fragment Design

  • Fragment D1: [Left Homology Arm] – [Spacer 1] – [First Part of D100]

gaccatgattacgaattcgagctcggtacccggggatcctGAAGTTCTATGACTCAATTGTTCATAGTGTTTACATCACCGCCAATTGCTTTTAAGACTGAACGCATGAAATATGGTTTTTCGTCATGTTTTGAGTCTGCGCTCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCcccgacAATCCTCCTCAGGAAATGAAGGATTCAGGAGATCTTCTCTATCAACTTGCTCAAGTAAGGACAAACGGGTTCACCCGGATCCTCCAGAAGACCCAGTCTATCAACGGAGAAACAAAGATAAAAATCAATTACTCACATGAAAGAGTATTGATCACGAGTCACTATGGAGCGACAATCTCCAGACAGGATGTCAGCATCTTATCTTCCTTTGAAGAAAGCATCATCAATAACGATGTAATGGTGG
  • Fragment D2: [40 bp overlap from D1] – [Rest of D100 + Full coxD cassette] – [Spacer 2]
TCCTTTGAAGAAAGCATCATCAATAACGATGTAATGGTGGGGACATCCACTAAGTTATTGCTCTGCAAACAGCTCAAAAAGCTACTGGCCGACAATCATAATTGCTCGGCATGTGCAGGTGGGGCCTCCACTAGCAATAATACAAGCTTTACAGCTTGCAGTGACTCATCCTCCAATAATGAGGAAAAAGACGTCAGCAGTGACGAACAAGGGCCTGAAGACTTGCCTATATAATGGCATTCACCCCTCAGTTGAAGAGCATCAGGAGTTTCAGCATAGAAACTTTCTCTTTAACAAATCTATCTTTTCTTTAAAGCATGTGTGAGTAGAAACCCATATAGGGTTATAATGTGTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCAATGGCCTCATCAATGCTCAGTAGCGCCACAATGGTGGCAAGTCCTGCTCAAGCTACAATGGTCGCTCCCTTTAATGGTCTGAAGTCGTCCGCAGCATTCCCAGCAACTAGAAAAGCTAATAATGACATAACGAGCATTACCAGCAACGGAGGCAGGGTAAACGCTGCGATGAGACATCATGCTGAACGAGATAAGGTCGCCGAGAGGCTAGCCTATGCAGGTTATATTCCAGATCGTGATCTTGCTACCGCTGTTTGGCTGATGGAAAGCCTTTCCAGGCCCTTGTTGTTAGAAGGAGAAGCTGGTGTAGGTAAAACCGAGGTAGCTCTGACTCTTGCGCAAGCTAACGGAGCAAGGCTCATTCGCTTGCAATGCTATGAAGGGCTCGATCAAAACGCTGCATTATACGAGTGGAATTACCAACGGCAGTTGCTCGCTATCAAAACACGGGAAAGTCGTGCTGACGCAGTAGATGTTATCGAAGATCATATTTTCTCAGAGAAGTTTCTTCTTGAGCGACCTCTGTTGGCTGCAATACGTCAACCCAAATCAGCAGTGCTACTAATTGATGAGGTTGACAGGGCCGACGAGGAGTTCGAAGCCTTTTTACTCGAACTTCTAAGCGATTACCAGGTTTCTATTCCTGAACTTGGTACAATCCACGCAACAACGATTCCACAGGTGATATTAACTTCCAATGGCACGAGAGAGTTATCAGATGCCTTGAGGAGGAGATGTCTCTACCACTATGTCGACTATCCAGATGTTGAAAGAGAAGCGCGTATCATAACCACAAGAATGCCGAATATTGACGTTGCTCTGGCGTTGCAGATTGCCAGGATGATCGAGGGAATACGAAAAGAGGATTTACGCAAGAGTCCTGGAGTCGCAGAAACTCTCGACTGGGCAGCAGCATTGGCTGGGCTTGGCGTTGAGGATCTTAGAGCTGAACCAGAAGCTGTGTTTGAAACTATGATGTGCTTGATAAAGACAGTCGAAGATAAATCGAGAGTGACTAGAGAGGTTTCTGATAGACTGCTTGGAAAGGTGGCAGACTACAAGGACGACGATGACAAGTAActgctttaatgagatatgcgagaagcctatgatcgcatgatatttgctttcaattctgttgtgcacgttgtaaaaaacctgagcatgtgtagctcagatccttaccgccggtttcggttcattctaatgaatatatcacccgttactatcgtatttttatgaataatattctccgttcaatttactgattgtaccctactacttatatgtacaatattaaaatgaaaacaatatattgtgctgaataggtttatagcgacatctatgatagagcgccacaataacaaacaattgcgttttattattacaaatccaattttaaaaaaagcggcagaaccggtcaaacctaaaagactgattacataaatcttattcaaatttcaaaagtgccccaggggctagtatctacgacacaccgagcggcgaactaataacgctcactgaagggaactccggttccccgccggcgcgcatgggtgagattccttgaagttgagtattggccgtccgctctaccgaaagttacgggcaccattcaacccggtccagcacggcggccgggtaaccgacttgctgccccgagaattatgcagcatttttttggtgtatgtgggccccaaatgaagtgcaggtcaaaccttgacagtgacgacaaatcgttgggcgggtccagggcgaattttgcgacaacatgtcgaggctcagcagGAATATTGGTTACGTCTGCATGTGCTATCTGCGCCCATATCATCCAGTGGTCGTAGCAGTCGTTGATGTTCTCCGCTTCGATAACTCTGTTGAATGGCTC  

I introduced 40 bp overlaps between the fragments to allow Gibson Assembly reconstruction of the complete cassette. After splitting, both fragments were accepted successfully by Twist Bioscience.

Fragment E was accepted directly without requiring optimization. This fragment contained:[Last 40 bp of Spacer 2] – [coxG Cassette] – [Spacer 3]

CGTTGATGTTCTCCGCTTCGATAACTCTGTTGAATGGCTCTTTACAGTAAGAACTGATAACAAAAATTTTACTTATTTCCTTAGAATTAATCTTAAAGGTGATAGTAAACAAGGACGATTAGTCCGTTGGCAAAATTGGTTCAGCAAGTATCAATTTGATGTCGAACATCTTGAAGGTGTAAAAAACGTTTTAGCAGATTGCCTCACGAGAGATTTTAATGCTTAAAAACGTAAGCGCTGACGTATGATTTCAAAAAACGCAGCTATAAAAGAAGCCCTCCAGCTTCAAAGTTTTCATCAACACAAATTCTAAAAACAAAATTTTTAGAGAGGGGGAGTGGTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCAATGGCCTCATCAATGCTCAGTAGCGCCACAATGGTGGCAAGTCCTGCTCAAGCTACAATGGTCGCTCCCTTTAATGGTCTGAAGTCGTCCGCAGCATTCCCAGCAACTAGAAAAGCTAATAATGACATAACGAGCATTACCAGCAACGGAGGCAGGGTAAACGCTGCGATGGATATGAACGCAAGCCAGAGAATTGAAGCCTCAAGGGAAAAAGTCTACGCCGCTCTCAATGATGTTGAGGTGCTTAGGCCTTGCATTCCAGGTTGCGAGTCCATCGAAAAGATCTCTGATAGCGAGATGACTGCCAAGGTAACATTGCGCATAGGACCAGTGAAAGCATCTTTTACCGGTAAGGTGACCCTAAGTGATCTCGATCCTCCAAATGGTTACACCATAGCAGGGGAGGGTACAGGAGGAATGGCAGGATTCGCAAAGGGCGGTGCTACTGTGAAACTCGAAGCTGACGGGACTGCCACGATTCTTCATTATACTGTTAAAGCTGACGTCGGAGGCAAACTGGCGCAGCTTGGTGGTAGACTAATCGATGCAACAGCTACAAAACTTGCAGGAGAGTTTTTTGAAAAATTCGGAAATATTGTTGGGCCTGTAGTAGTCCAAGACGAAGAAGAGCCGGTTAAGAAGAAAGGTTGGTTGAAGAAGATAACTGGCGCTTTAAGTGTTTTGGTTTTCTCAATTTTGTTAGGAGCTCACTGGTGTTGTATTGGGGGCCATGCTCACGCTCAAAACGATCCCCTGATGTTAGCGATCTGTTCATCGCGAGTTTAACTCGAATTCGCTGAAATCACCAGTCTCTCTCTACAAATCTATCTCTCTCTATTTTCTCCATAAATAATGTGTGAGTAGTTTCCCGATAAGGGAAATTAGGGTTCTTATAGGGTTTCGCTCATGTGTTGAGCATATAAGAAACCCTTAGTATGTATTTGTATTTGTAAAATACTTCTATCAATAAAATTTCTAATTCCTAAAACCAAAATCCAGTACTAAAATCCAGATCTCCTAAAGTCCCTATAGATCTTTGTCGTGAATATAAACCAGACACGAGACGACTAAACCTGGAGCCCAGACGCCGTTCGAAGCTAGAAGTACCGCTTAGGCAGGAGGCCGTTAGGGAAAAGATGCTAAGGCAGGGTTGGTTACGTTGACTCCCCCGTAGGTTTGGTTTAAATATGATGAAGTGGACGGAAGGAAGGAGGAAGACAAGGAAGGATAAGGTTGCAGGCCCTGTGCAAGGTAAGAAGATGGAAATTTGATAGAGGTACGCTACTATACTTATACTATACGCTAAGGGAATGCTTGTATTTATACCCTATACCCCCTAATAACCCCTTATCAATTTAAGAAATAATCCGCATAAGCCCCCGCTTAAAAATTGGTATCAGAGCCATGAATAGGTCTATGACCAAAACTCAAGAGGATAAAACCTCACCAAAATACGAAAGAGTTCTTAACTCTAAAGATAAAAGATGATTGCGCCTACCCGGATATTATCGTGAGGATGCGTCATCGCCATTGCTCCCCAAATACAAAACCAATTTCAGCCAGTGCCTCGTCCATTTTTTCGATGA

I designed the overlaps carefully to maintain assembly continuity with the neighboring fragments. The fragment did not contain problematic repeats or synthesis instability regions.

Fragment F

Fragment F contained: [Last 40 bp of Spacer 3] – [coxE Cassette] – [Spacer 4]

AAACCAATTTCAGCCAGTGCCTCGTCCATTTTTTCGATGAGAACACCGTTCGAGTGTCATCGACAGGCCAAGGCCAACAGATGATCATTTCAGACCATGGGGGGATGTTACATACTGGCTGAATAAAGAAGCAGAAGAGTGCCACACAAGGGGCGACAACGTCGAAGGCGCAGAAGACGCAGTCGATCTCACTGACGTAAGCAATGACGACCAGTGGAGGAGATCGTAAGCAATGACGTATGGAGCGTGGAGGACCCATGAAAGCACTGAGAAGGCATCTCAACTTTCGGTGTGTGAGTGCGCATCCTATGCGATGCTTTGTTTCGTCCACAGACATCAACATCTTATCGTCCTTTGAAGATAAGATAATAATGTTGAAGATAAGAGTGGGAGCCACCACTAAAACATTGCTTTGTCAAAAGCTAAAAAAGATGATGCCCGACAGCCACTTGTGTGAAGCATGTGAAGCCGGTCCCTCCACTAAGAAAATTAGTGAAGCATCTTCCAGTGGTCCCTCCACTCACAGCTCAATCAGTGAGCAACAGGACGAAGGAAATGACGTAAGCCATGACGTCTAATCCCGTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCAATGGCTAGCACCGCACTGAGCTCAGCCATTGTGGGAACTTCCTTCATCCGGAGAAGTCCTGCGCCCATATCTCTACGATCACTCCCATCGGCAAACACACAATCTCTTTTTGGGTTGAAGAGTGGAACGGCAAGGGGTGGCAGAGTCACAGCTGCTATGGTTGCAACTGCTGCCATTCATGAATCCAGCGCTGCTTCAGCAGGAGCTAGACGCAAGCTGGGCGATTTTGTTCGAGTACTCCGGGACAATGGTTTTATTGTGGGGCTCGCGGAGGCTGGAGATGCTCTTACTGTTCTTAGCAGGCCTGCCTCTTTGACACCTAGCAGACTACGACCGGCTCTTCGTGCATTGTTCTGCTCAAACAAGTCTGATTGGGAAAAGTTTGACGAGATTTTCGATGCTTTCTGGCTTGGACGAGGAATGAAATCCGCAACGAGAATTTCCGGAGTGCTTCAAAAAAGTCCTCCCGGTATGGAAAGTTCAAGGAGTGGCGATAGACCAGGTAATCCTGATGGGGCACCAGATCATGTTCAGCGGCGTATAGGCTTGGATCACGGCACCGATGAAAATAGTCCAGGACTTCGGGAAGGTGCATCACGCGCTGACTCACTGGCCAAGGCTGATTTTAGACATCTCACAAACCCGGACGATCTTGCTGCCGCTCATGCTGTAGCTGCAAGACTCGCAAAGGCTATGAGGGTGCGCTTAACCCGACGTGAACAGTCTCGCAGAACTGGTAGGAGGATCGACCTTAGAAGGACTATTCACAAAAATATAGCCCATGGAGGAATGCCACTGGAATTGGTCTGGCGACAGAGGAAACACAAACCATTAAGACTGGTTGTTCTACTCGACGCTTCCGGATCTATGAGCATGTATAGTGCAGTATTCTTAAGATTCATGCACGGGATTCTTGATAATTTTAGGGAGGCCGAAGCATTTGTTTTCCATACAAGGCTAATTCATATATCTCCAGCTTTGAGAGAACGTGATGCGACACGTTCTGTGGAGAGAATGAGCCTATTGGCCCAAGGCGTCGGTGGTGGAACACGGATCGGTGAATCACTTGCCACGTTTAATAGATGGCATGCAAAGAGAGCAATTCATTCGAGGACTTGCGTTATGATCGTGTCAGATGGTTACGATACCGGACCTGCCGAGCAATTGGAGCGAGAAATGTCGGCTTTAAGGCGTCGTTGTAGAAGAATCGCATGGCTCAACCCAATGATCGGTTGGAGGGGGTATGCGCCAGAGGCAGCTGGGATGAAAGCTGCACTGCCTCACGTCGACTTGTTTGCTCCCGCTCACAACTTAGAGAGCTTGCAAGCAATTGAGCCTTACTTAGCGAGGATATAATAGGTTAAatatgaagatgaagatgaaatatttggtgtgtcaaataaaaagcttgtgtgcttaagtttgtgtttttttcttggcttgttgtgttatgaatttgtggctttttctaatattaaatgaatgtaagatctcattataatgaataaacaaatgtttctataatccattgtgaatgttttgttggatctcttctgcagcatataactactgtatgtgctatggtatggactatggaatatgattaaagataagGCGCGTTCTGCTTCCGATTAGAAACGTCAAGGCAGCAATCAGGATTGCAATCATGGTTCCTGCATATGATGACAATGTCGCCCCAAGACCATCTCTATGA

Unlike the previous problematic fragments containing the D100 or S100 promoters, this fragment used the SM promoter, which did not contain repetitive enhancer regions.

Therefore, Fragment F was accepted directly by the Twist Bioscience algorithm from the first submission without requiring any optimization, sequence modification, or fragment splitting.

The fragment was synthesized as a complete cassette exactly as originally designed in Benchling.

  • Fragment G

Fragment G corresponded to the coxF cassette region.

Initially, I designed the complete coxF cassette as a single large fragment containing the S100 promoter. However, the Twist algorithm rejected the sequence because the S100 promoter contained repetitive enhancer regions similar to those previously observed with the D100 promoter. image image To solve this problem, I divided the large region into multiple smaller fragments. Some fragments were accepted immediately, while the fragment containing the S100 promoter continued to fail.Therefore, I followed the same strategy previously used for the D100 promoter. image image First, I localized the functional consensus regions inside the S100 promoter using the original promoter publication. image image Then, I introduced minimal nucleotide substitutions only outside the functional boxes: A ↔ T, G ↔ C substitutions image image These modifications preserved: GC content balance, Promoter architecture, Functional regulatory motifs

After these adjustments, the fragment was finally accepted by the Twist algorithm. Fragment G corresponded to the coxF cassette region. Initially, I designed the fragment as a single large sequence, but the S100 promoter repeats again caused synthesis rejection.

To solve this issue, I split the region into two smaller fragments:

  • Fragment G1: [First 40 bp of Spacer 4] – [First Part of coxF Cassette]
TGCATATGATGACAATGTCGCCCCAAGACCATCTCTATGAGAAGCCCGCTTTACAAGTGGCCAGCTAGCTATCACTGAAAAGACAGCAAGACAATGGTGTCTCGATGCACCAGAACCACATCTTTGCAGCAGATGTGAAGCAGCCAGAGTGGTCCACAAGACGCACTCAGAAAAGGCATCTTCTACCGACACAGAAAAAGACAACCACAGCTCATCATCCAACATGTAGACTGTCGTTATGCGTCGGCTGAAGATAAGACTGACCCCAGGCCAGCACTAAAGAAGAAATAAcccgacGAAGGCCGCTTTAGAAGTGGCCTGCTAGCTAACACTGAAATGACAGCATGACAATCGTGTCACGATGCAGCAGAAGCACATCTATGCAGCAGTTGTGAAGCTGCCAGAGTGCTCCACAAGTCGCAGTCAGAAAAGGGATCATCTACCGTCACAGAAATAGACAACCAGAGCTCATGATCCATCATGTACAGTGACGTTAAGCGTCGCCTGAAGATATGACTGACCGCAGGCCTGCAGTAAAGTAGATATAATGCAAGTGGTCCTAGCTCCACTTTAGCTTTAATAATTATGTTTCATTATTATTCTCTGCTTTTGCTCTCTATATAAAGAGCTTGTATTTTCATTTGAAGGCAGAGGCGAACACACACACAGTTTTTATTTTTAATTTTCTTTCAAATACTTCCATCAATGGACTCTCAACTTGTATTAAGCCTGAAGTTGAACCCCTCTTTCACACCACTTAGTCCTTTGTTTCCGTTTACTCCATGTTCCAGTTTCTCCCCATCGCTAAGGTTTTCAAGCTGCTACTCACGAAGACTCTATTCACCTGTCACCGTGTACGCAGCTATGACACCTACTCCTGACGTGTTAGATTTAGTCAACAATATGAAAGCCAGAGGAGAGCCATTCGCCCTTGCAACTGTAGTTCGGACGGTATCACTCACCGCAGCCAAGGCAGGTGCAAAGGCTATTATTTTGAGCGACGGTACTATGACAGCAGGATGGATTGGGGGCGGGTGTGCGAGAGCTAATGTGCTTAAGGCTGCTAGGCAAAGTCTTAGCGACGGAAAGCCGAGGCTGATTAGTGTTCAACCAAAGGATGTTCTTGAGGAACATGGTTTAACAGCAGGGGAAGCGCGAGAAGGAGTGCTATATGCCAACAACATGTGCCCAAGCCATGGTACCATGGATATTTTCGTTGAGCCAATATTGCCGCGACCTCAGCTCTATATCTGTGGAGCAAGCCCAGTTGCAGTGGCTATAGCTGCTATAGCACCTCGTATGGGATTTTTTGTGTCTGTTTGCGCTCCCAAAGCAGATC
  • Fragment G2: [40 bp overlap from G1] – [Remaining coxF Cassette] – [Right Homology Arm]
ATGGGATTTTTTGTGTCTGTTTGCGCTCCCAAAGCAGATCACACATTGTTTGGTGATACCGATAGGCTGATTGATGGTTATGAAATTCCCGCCGACAGCGGTACTAATCGGTACGTCGTTGTATCTACACAGGGACGTGGCGATACTGCTGCTCTGAAATCTGCACTATCCACGCCATCCGTCTACGTGGCTTTCGTTGGCAGTAGAAAGAAAGCCTCGGTTTTGAGGGAAGAGCTTACCGTAGCAGGAATTGCGCCATCACTATTGGAAACATTGCATGCTCCTGCCGGCCTCGACCTTGGCGGTATCACTCCTGATGAAATCGCTCTCTCAATCGTTGCTGAGATGGTCGAGATAAGACGCCACGGGCAAAGACAAAGCGATAATCAGAAAGAAGGAACATCATAAaccgcactgtgtgtggtttctcaagaccaagacagctaaagcctaaagtcagagatctaatatgtgtattgttattcatgacaccacagctgccacttttggtgttatgatctgtttgtagaagtaggaattcttttttttctacttaataatagcttaaagagctgtgcaatttggtctgtattttttgtgtattttgcactcattatttgtgaacagtttgagaactatttattttctaagatttgtgcacgtatgaaccacttttcatctatataccaccatgtttattctgcatctatgggattgagtttgaatattcgttgatcaacaaagttatatttggtggatactacttgaaggtgcatatactttgtgctcatatatttagttgatattctggattttgagctggacaaattgatcaaggtagtctaatctggtctggttactaataaaactcaagagatcactctagagtcgacctgcaggcatgcaagcttggcactggccg

The 40 bp overlap allowed seamless Gibson Assembly between both fragments. After splitting and promoter optimization, both fragments were accepted successfully.

Final twist validated fragments:

FragmentConstructMain ComponentsSpecial Notes
A1Structural construct (pCAMBIA2300)Left homology arm + Spacer 1 + First part of D100 promoterFragment created after splitting Fragment A to separate repeated enhancer regions
A2Structural construct (pCAMBIA2300)40 bp overlap from A1 + Remaining D100 promoter + Complete coxL cassette + First 40 bp of Spacer 2Accepted after promoter splitting
BStructural construct (pCAMBIA2300)Spacer 2 + Complete coxM cassette + Spacer 3Accepted directly without optimization
CStructural construct (pCAMBIA2300)Last 40 bp of Spacer 3 + Complete coxS cassette + Right homology armAccepted directly without optimization
D1Maturation construct (pCAMBIA1300)Left homology arm + Spacer 1 + First part of D100 promoterGenerated after splitting Fragment D to separate repeated promoter regions
D2Maturation construct (pCAMBIA1300)40 bp overlap from D1 + Remaining D100 promoter + Complete coxD cassette + Spacer 2Accepted after fragment splitting
EMaturation construct (pCAMBIA1300)Last 40 bp of Spacer 2 + Complete coxG cassette + Spacer 3Accepted directly without optimization
FMaturation construct (pCAMBIA1300)Last 40 bp of Spacer 3 + Complete coxE cassette + Spacer 4Contains SM promoter; accepted directly from the first submission
G1Maturation construct (pCAMBIA1300)First 40 bp of Spacer 4 + First part of coxF cassetteFragment generated after splitting the coxF region because of S100 promoter repeats
G2Maturation construct (pCAMBIA1300)40 bp overlap from G1 + Remaining coxF cassette + Right homology armAccepted after S100 promoter optimization and fragment splitting

The objective of this step was to adapt the designed multicassette constructs to the synthesis requirements of Twist Bioscience by identifying and resolving problematic repetitive regions, optimizing synthesis compatibility, and ensuring that all final fragments could be successfully synthesized and assembled through Gibson Assembly.

Phase 6: Twist Bioscience Order Simulation

Twist Bioscience Order Simulation:

After completing the design and optimization of all fragments in Benchling , I exported the finalized sequences in FASTA format. Each fragment corresponded to a specific part of the structural or maturation multicassette constructs and already contained the required overlaps for Gibson Assembly. image image

I then uploaded the FASTA files into the Twist Bioscience Platform using the gene synthesis workflow. The platform automatically analyzed each sequence to evaluate synthesis compatibility, including repetitive regions, GC balance, and sequence complexity. image image image image image image image image image image image image image image image image image image image image image image

Fragments that failed the screening due to repetitive promoter regions were optimized during the previous phase either by introducing minimal nucleotide modifications in non-functional regions or by splitting the constructs into smaller fragments. After re-uploading the corrected sequences, all fragments were successfully accepted by the Twist algorithm. image image

This final simulation confirmed that the complete multicassette constructs were synthesis-compatible and ready for downstream Gibson Assembly and cloning experiments.

The objective of this phase was to simulate the commercial DNA synthesis workflow by exporting the finalized multicassette fragments from Benchling in FASTA format and evaluating their compatibility with the synthesis requirements of Twist Bioscience. This step aimed to verify sequence manufacturability, detect potential synthesis issues such as repetitive regions or sequence complexity, and confirm that all fragments were fully ready for commercial synthesis and downstream Gibson Assembly.

Phase 7: Multicassette Assembly (structural + maturation inserts)

Multicassette Assembly (Structural & Maturation Inserts):

After preparing and validating all the synthesis fragments, I moved to the in silico assembly step in Benchling to digitally reconstruct the complete Structural and Maturation multicassettes before any physical cloning work. For this step, I used the native Gibson Assembly tool available in Benchling because all fragments were already designed with 40 bp overlaps to enable seamless assembly.

First, I opened Benchling and clicked on the Create (+) button from the left sidebar. Then, from the Assembly options, I selected “Assemble DNA sequences by cloning.” This opened the Gibson Assembly workflow interface where I configured all the assembly parameters. image image For the assembly settings, I selected the destination project folder dedicated to the multicassette constructs. Since I wanted to generate standalone insert sequences rather than circular plasmids at this stage, I set the construct topology to Linear. Then, I selected Gibson Assembly as the cloning method. For fragment joining, I chose the option “Find existing overlaps” because all overlaps had already been engineered during the previous fragment preparation phase.

Next, I adjusted the homology parameters to match the overlaps used in my fragment design. I fixed both the minimum and maximum overlap length to 40 bp, corresponding to the overlaps added between all neighboring fragments. I also kept the minimum melting temperature around 39°C to ensure proper overlap recognition during the digital assembly process. image image image image image image After configuring the assembly settings, Benchling generated a linear assembly lane containing several fragment bins. I then imported all fragments sequentially from left to right according to their assembly order. image image For the Structural multicassette, I imported the fragments in the following order:

  • Fragment_A1
  • Fragment_A2
  • Fragment_B
  • Fragment_C

For the Maturation multicassette, I imported:

  • Fragment_D1
  • Fragment_D2
  • Fragment_E
  • Fragment_F
  • Fragment_G1
  • Fragment_G2

Inside each bin, I used the “Search for sequences” option to retrieve the fragments directly from my Benchling project files. I also ensured that every junction remained configured on “Find existing overlaps” so Benchling could automatically detect and validate the engineered Gibson homology regions between adjacent fragments. image image image image image image Once all fragments were added, Benchling automatically analyzed the overlaps between neighboring fragments. image image image image image image image image image image image image image image When all homology regions matched correctly, the assembly status changed from 0 constructs to 1 construct, confirming that the fragments were compatible and could assemble successfully into a continuous sequence. I then clicked the “Assemble” button to generate the final multicassette sequences. Benchling created new linear DNA constructs corresponding to the complete Structural and Maturation inserts assembled from all validated sub-fragments. image image image image image image image image image image image image image image Finally, I opened the resulting linear maps to verify the integrity of both assembled structural and maturation multicassettes. I carefully checked that all annotations were preserved correctly across the final constructs, including promoters, AMV enhancers, chloroplast transit peptides (CTPs), coding sequences, purification tags, spacers, and terminators. I also verified that all junctions were seamless and that no gaps, inversions, or frame disruptions appeared between adjacent fragments. image image image image image image This final in silico Gibson Assembly simulation confirmed that both multicassette inserts were correctly designed and fully ready for downstream cloning and plasmid integration steps.

The objective of this phase was to digitally assemble all synthesized DNA fragments into the final structural and maturation multicassette constructs using Gibson Assembly simulation in Benchling . This step allowed me to verify fragment compatibility, overlap integrity, correct orientation, and successful reconstruction of the complete plasmids before experimental cloning.

Phase 8: Full Construct Assembly (insert into pCAMBIA1300 and pCAMBIA2300)

Full Construct Assembly:

After successfully assembling the Structural and Maturation multicassette inserts in Phase 7, I moved to the final cloning step where I inserted each complete multicassette block into its corresponding binary vector backbone using in silico Gibson Assembly in Benchling.

For this phase, I followed the same general Gibson Assembly workflow previously used for multicassette reconstruction. However, instead of assembling several independent fragments together, I assembled only two major components: the linearized pCAMBIA vector backbone and the complete multicassette insert.

I first opened the Benchling Assembly tool by selecting Create (+) → Assemble DNA sequences by cloning. Then, I configured the assembly parameters similarly to the previous phase. The cloning method was set to Gibson Assembly, and the overlap detection mode remained configured on “Find existing overlaps.” image image Unlike Phase 7, where the constructs were generated as linear inserts, I configured the topology of the final constructs as Circular because the insert and vector backbone needed to re-circularize to form complete binary plasmids.

For the Structural construct, I imported:

  • –> The linearized pCAMBIA2300 backbone digested at the XbaI site
  • –> The complete Structural multicassette insert assembled in Phase 7

For the Maturation construct, I imported:

  • –> The linearized pCAMBIA1300 backbone digested at the XbaI site
  • –> The complete Maturation multicassette insert assembled in Phase 7 image image image image Benchling automatically analyzed the homology regions between the insert ends and the vector backbone extremities to validate correct assembly compatibility.

Once both components were loaded into the assembly bins, Benchling successfully detected the overlap regions and generated one valid construct for each assembly. I then clicked the “Assemble” button to create the final circular plant expression plasmids. image image image image image image The resulting constructs were then analyzed using both the Plasmid Map and Linear Map visualization modes in Benchling. This final verification step allowed me to confirm that the multicassette inserts were correctly integrated into the vectors without inversions, sequence interruptions, or junction mismatches. image image The final Structural construct generated a circular plasmid of approximately 16,488 bp, while the final Maturation construct generated a circular plasmid of approximately 18,070 bp. image image image image

During the final quality-control inspection, I verified that the entire multicassette payload was correctly positioned between the Left Border (LB) and Right Border (RB) T-DNA sequences, ensuring compatibility with future Agrobacterium-mediated plant transformation.

I also confirmed that all original backbone features remained intact after assembly. In pCAMBIA2300, the nptII kanamycin resistance cassette used for plant selection was preserved correctly. Similarly, the hygromycin resistance cassette of pCAMBIA1300 remained unaffected.

Finally, I checked the integrity of the essential bacterial backbone elements outside the T-DNA region, including the pVS1 replication/stability regions, the pBR322 origin of replication, and the bacterial antibiotic resistance marker. All these elements remained fully conserved after circularization of the final plasmids.

The objective of this phase was to digitally assemble the fully reconstructed Structural and Maturation multicassette inserts into their corresponding binary plant expression vectors, pCAMBIA2300 and pCAMBIA1300, using in silico Gibson Assembly in Benchling. This step aimed to generate complete circular plant transformation plasmids, verify the integrity of all assembly junctions and vector backbone elements, and confirm that the final constructs were fully compatible with downstream cloning, bacterial propagation, and Agrobacterium-mediated plant transformation applications.

Phase 9: Protein Structure Prediction (Alphafold)

Protein Structure Prediction and analysis:

Verification 1 — Monomer Architecture, Confidence Profiles (pLDDT), & Tag Exposure Analysis

Objective & Methods

To comprehensively evaluate the structural integrity, predictive confidence, and purification tag behavior of my engineered plant-targeted constructs, I performed an integrated macro-scale monomer analysis using AlphaFold 3. For this first verification step, I analyzed each engineered fusion protein separately as an individual monomeric prediction. This allowed me to specifically evaluate the local structural effects of the added chloroplast transit peptides (CTPs) and purification tags on each protein independently before studying higher-order assembly behavior in later verification steps.

For each fusion protein, I systematically cross-examined four key design parameters within a single diagnostic profile:

  1. Core Catalytic Domain Structure & Folding: Ensuring the functional enzyme and chaperone cores fold into active configurations without structural collapse or internal blockages.
  2. Per-Residue Confidence & Color Mapping: Utilizing AlphaFold’s Predicted Local Distance Difference Test (pLDDT) scoring matrix to map local modeling certainty. Residues with absolute structural reliability score above 90 (dark blue), while highly flexible, intrinsically disordered regions register below 50 (bright orange).
  3. Secondary Structures Within the CTP: Confirming that the added N-terminal Chloroplast Transit Peptides (CTPs) maintain a flexible configuration necessary to interact cleanly with the chloroplast Toc/Tic translocon complexes.
  4. Epitope Tag Spatial Exposure and Accessibility: Verifying that my engineered purification/detection tags (HA and FLAG) protrude freely into the solvent as unstructured random coils, allowing immediate antibody recognition without steric hindrance from the folded protein body.

Structural Subunits Analysis

  1. CoxL Monomer
image image
  • Core Catalytic Domain Structure & Colors: The massive core domain of CoxL is highly structured, composed of complex beta-sheets and flanking alpha-helices. The entire core mass is uniformly shaded in dark blue ribbons (pLDDT > 90), demonstrating absolute model confidence in the catalytic scaffold.
  • CTP Region Structure & Colors (RbcS CTP): Located at the N-terminus, this 53aa sequence is displayed as a loose loop shaded entirely in bright orange (pLDDT < 50).
  • Secondary Structures within CTP: Close inspection reveals that this CTP behaves entirely as an intrinsically disordered random coil. There are no hidden or unintended alpha-helices or beta-strands within the orange tail. It stays completely open and unbonded, keeping it fully solvent-accessible for import machinery.
  • Epitope Tags Protrude Freely: The HA tag is attached to the extreme C-terminus of the subunit. It projects directly outward away from the folded alpha/beta catalytic body into the surrounding solvent. It is mapped as a low-confidence profile (pLDDT < 50, bright orange), confirming it acts as a hyper-flexible, disordered “tether” that is perfectly exposed for anti-HA antibody binding during Western blots.

–> Design Verdict: PASSED ✅.

  1. CoxM Monomer
image image
  • Core Catalytic Domain Structure & Colors: CoxM folds as a dense alpha-helical bundle (long corkscrew-like spirals). The entire core is uniformly colored in deep dark blue (>90 pLDDT), showing that AlphaFold is highly certain of this arrangement.
  • CTP Region Structure (Fer2 CTP) & Colors: The Fer2 transit peptide projects outward from the top of the bundle. It begins as a highly flexible, un-bonded string shaded in bright orange (<50 pLDDT).
  • Secondary Structures within CTP: As the sequence approaches the junction where it merges into the core domain, it transitions to yellow (50 – 70 pLDDT) and forms a distinct, short alpha-helix segment. This temporary micro-helix is a common biological feature in Fer2 transit peptides, often aiding membrane docking during chloroplast translocation. Because it points directly out into the solvent and does not collapse back into or bury the main helical core, it is completely non-disruptive.

–> Design Verdict: PASSED ✅. The Fer2 transit peptide preserves necessary terminal flexibility despite containing a brief, non-interfering junctional alpha-helix.

  1. CoxS Monomer
image image
  • Core Catalytic Domain Structure & Colors: The small iron-sulfur cluster-binding core consists of short, rigid beta-hairpins and alpha-helices, mapped entirely in high-confidence dark blue (pLDDT > 90).
  • CTP Region Structure & Colors (RecA CTP): The N-terminal RecA CTP (51aa) projects outward as an extended loop colored in bright orange (pLDDT < 50).
  • Secondary Structures within CTP: The RecA CTP is mostely devoid of secondary structures, forming a random disordered coil. It exists as a highly dynamic, whipping tail.
  • Epitope Tags Protrude Freely: The C-terminal FLAG epitope tag (9aa) appears as a dangling loop colored in yellow and orange (pLDDT 50 – 70). It is completely unstructured, forms a pure random coil, and projects cleanly into the solvent without wrapping back onto the cluster core, making it fully optimized for anti-FLAG antibody binding during downstream assays.

–> Design Verdict: PASSED ✅.

Maturation Component Analysis

  1. CoxD Fusion Monomer
image image
  • Core Catalytic Domain Structure & Colors: The main core of CoxD is a large, globular alpha/beta mixed domain. The entire core is beautifully map-colored in dark blue ribbons (pLDDT > 90), confirming absolute confidence in the structural stability of this maturation factor.
  • CTP Region Structure & Colors (RbcS CTP): The N-terminal RbcS CTP is visible as a loose string colored in bright orange (pLDDT < 50).
  • Secondary Structures within CTP: The transit peptide is a 100% disordered random coil containing zero secondary structures, ensuring it remains unconstrained.
  • Epitope Tags Protrude Freely: The C-terminal FLAG tag projects outward as an extended, highly flexible random coil colored in yellow (pLDDT 50 – 70) and orange (pLDDT < 50). It floats cleanly away from the blue functional body, guaranteeing unhindered accessibility for antibody capture.

–> Design Verdict: PASSED ✅.

  1. CoxE Fusion Monomer
image image
  • Core Catalytic Domain Structure & Colors: The structural core of CoxE is a complex, multi-domain chaperone factor. In its native state (CoxE Alone), the protein exhibits two distinct rigid terminal domains separated by an intrinsically disordered, highly flexible central linker.
  • Global vs. Segmented Alignment Metrics: When running a global alignment on the core sequence, the engineered CoxE Fusion matches the control with a sequence identity of 99 % across 257 residues, returning a global backbone RMSD = 1.93 Å and a TM-score = 0.64. To investigate the source of this 1.93 Å coordinate displacement, I executed a high-resolution segmented alignment targeting the individual rigid blocks:

o The N-Terminal Domain Block: Aligning native residues 1 – 85 against engineered residues 53 – 136 confirmed a highly preserved structural match (RMSD = 0.4 Å and a TM-score = 0.98). image image o The C-Terminal Domain Block: Aligning native residues 138 – 399 against engineered residues 190 – 451 yielded an identical, unwarped topology (RMSD = 0.95 Å and a TM-score = 1.48). image image

  • Mathematical Proof of Chaperone Hinge Dynamics: This segmented analysis provides flawless mathematical proof of my design’s success. The individual functional blocks are rigidly identical to the native control. The minor 1.93 Å global shift is not a folding failure; it is a signature of native structural dynamics. The flexible linker loop situated between the two domains acts as a molecular hinge. Because this loop is completely unconstrained, it adopts a slightly alternative bend in the prediction window when accommodating the adjacent N-terminal Fer2 CTP. Crucially, the internal folds of the functional chaperone targets remain pristine.
  • CTP Region Structure & Colors (Fer2 CTP): The attached Fer2 CTP maps entirely as a low-confidence loop (pLDDT < 50, bright orange) projecting cleanly away from the main body.
  • Secondary Structures within CTP: The transit peptide acts as a pure disordered random coil, preserving the native flexibility required to engage chloroplast translocation machinery.
  • Epitope Tags Protrude Freely: N/A. To maintain this highly precise, native inter-domain flexibility and avoid interface crowding, CoxE was intentionally engineered without terminal epitope tags.

–> Design Verdict: PASSED ✅. Segmented domain matching confirms the rigid blocks are structurally pristine, and the global variation is mathematically proven to be a harmless reflection of native hinge flexibility.

  1. CoxF Fusion Monomer
image image
  • Core Catalytic Domain Structure & Colors: CoxF forms an exquisite, compact globular fold dominated by prominent alpha-helices. The entire core mass is a solid block of dark blue ribbons (>90 pLDDT), proving superb structural configuration.
  • CTP Region Structure (RecA CTP) & Colors: The N-terminal RecA CTP is clearly visible as an extended loop extending out from the bottom corner of the protein, colored mostly in orange (<50 pLDDT).
  • Secondary Structures within CTP: The RecA transit peptide exhibits a 100% disordered random coil conformation. There are no hidden alpha-helices or sheets. It acts as an open, loose string perfectly suited for interacting with the chloroplast envelope channels.

–> Design Verdict: PASSED ✅.

  1. CoxG Fusion Monomer
image image
  • Core Catalytic Domain Structure & Colors: The structural core of the maturation factor CoxG displays a dense alpha/beta mixed core domain. While the structural scaffolds are mapped in high-confidence dark blue (pLDDT > 90), the core contains a localized low-confidence loop region shaded in orange (pLDDT < 50). To verify that this orange pocket does not indicate structural failure, I executed a pairwise structural alignment isolating the core of my engineered CoxG Fusion against a native CoxG Alone control.
  • Alignment Metric Analysis: The quantitative alignment yielded a sequence identity of 97 % across 156 aligned residues, returning a global backbone RMSD = 1.6 Å and a highly reliable TM-score = 0.76. Because the TM-score sits well above the 0.50 structural biology threshold, both models are mathematically proven to share the exact same global structural topology.

Justification of Internal Core Flexibility: The minor coordinate displacement (RMSD = 1.6 Å) and unaligned residue window capture a native functional mechanism. As an accessory maturation chaperone, CoxG natively utilizes localized, flexible loop segments to bind and process its target enzyme partners. The orange patch you see inside the core is an intrinsically flexible docking loop. AlphaFold models this loop in alternative sweeping orientations when accommodating the added N-terminal RbcS CTP, confirming that the structural framework remains completely uncompromised.

  • CTP Region Structure & Colors (RbcS CTP): The N-terminal RbcS CTP spans outward as a long peripheral loop structure, colored primarily in bright orange (pLDDT < 50).
  • Secondary Structures within CTP: This CTP forms a completely unstructured random coil with no secondary structure elements (no helices or strands), meaning it remains highly flexible, dynamic, and solvent-exposed for transit channels.

–> Design Verdict: PASSED ✅. Control alignments mathematically validate that the core fold is conserved (TM-score = 0.76), and the internal core orange region is verified as a native, flexible chaperone loop.

Verification 2 — Is the Core Enzyme Domain Fold Preserved?

Objective & Methods

To verify that my engineered, codon-optimized plant-targeted fusions folded into their native, active bacterial conformations, I performed a high-resolution pairwise structural alignment. I compared each predicted monomer structure against the corresponding chain from the Oligotropha carboxidovorans gold-standard crystal structure (PDB: 1N5W) using the RCSB PDB alignment server. To achieve this, I isolated the core catalytic domains of my models to bypass the unaligned, highly flexible synthetic additions (specifically the N-terminal chloroplast transit peptides (CTPs) and C-terminal purification tags) allowing the algorithm to evaluate the true functional enzyme scaffolds. image image

image image image image image image Results & Quantitative Metrics

The alignment yielded exceptionally strong quantitative validation metrics across all three structural blocks:

Target SubunitReference Chain (1N5W)Sequence IdentityAligned / Native ResiduesBackbone RMSD (Å)Global TM-scoreDesign Validation Status
CoxL FusionChain B100 %804 / 8090.19 Å1.00✅ PASSED: Flawless active core preservation.
CoxM FusionChain C100 %287 / 2880.17 Å1.00✅ PASSED: Pristine backbone trace topology.
CoxS FusionChain A99 %159 / 1660.87 Å0.98✅ PASSED: Core stable; score captures flexible terminal loops.

Structural Interpretation

  1. CoxL Subunit An RMSD of 0.19 Å alongside a perfect global TM-score of 1.00 is a flawless mathematical result. This proves that out of the 809 total native residues, the 804 modeled positions share an identical structural topology with the native bacterial active fold. The engineered addition of my N-terminal RbcS CTP and C-terminal HA tag caused absolutely zero structural drift or conformational distortion within the mature catalytic scaffold. image image
  2. CoxM Subunit By achieving a global TM-score of 1.00 and a backbone trace deviation of just 0.17 Å across 287 out of 288 residues, the mature flavoprotein core is verified to be completely identical to the bacterial template. My added N-terminal Fer2 transit peptide sequence does not introduce any structural warps or constraints to the vital FAD-binding fold. image image
  3. CoxS Subunit This alignment provides an honest and highly refined math profile. A TM-score of 0.98 confirms that the global fold of the iron-sulfur subunit is completely conserved. The backbone RMSD stands at 0.87 Å, and the sequence identity registers at 99 % across 159 aligned residues. This slight variance is a predictable mathematical signature of my dual-ended terminal modifications (N-terminal RecA CTP and C-terminal FLAG tag). image image

Verification 3 — Is the Active Site Geometry of CoxL Preserved?

Objective & Methods

While global backbone alignments (Verification 2) verify macroscopic folding, true enzymatic function strictly depends on the micro-spatial positioning of active site side-chains. To prove that my plant-targeted, codon-optimized fusions preserve these crucial chemical environments, I executed a high-resolution, atom-by-atom visual audit using the Mol* molecular viewer. For each subunit, I applied a two-tiered inspection method:

  1. Macroscopic Volume Assessment (Cartoon Ribbon Presentation): Used to confirm that the secondary structure frameworks wrapping around the internal binding clefts remain uncollapsed and geometrically accommodating.
  2. Microscopic Trajectory Assessment (Ball-and-Stick Presentation): Used to explicitly analyze side-chain rotamers, hydrogen-bonding networks, and backbone trajectories. I rendered my engineered variants’ residues and superimposed them directly onto the native bacterial template coordinates (PDB: 1N5W).

Note on Sequence Numbering: Due to the engineered addition of N-terminal chloroplast transit peptides (CTPs) required for organelle targeting, the amino acid coordinates in my custom fusions are shifted forward relative to the historical bacterial literature numbering:

  • CoxL: Shifted forward by exactly 56 residues (+56) due to the RbcS CTP.
  • CoxM: Shifted forward by exactly 52 residues (+52) due to the Fer2 CTP.
  • CoxS: Shifted forward by exactly 53 residues (+53) due to the RecA CTP.

Literature Context & Key Residues

According to foundational structural data (Schübel et al., 1995; Dobbek et al., 1999):

L Subunit (Molybdoprotein Subunit)

The massive CoxL subunit forms the catalytic heart of the carbon monoxide dehydrogenase complex. It coordinates the unique bimetallic molybdenum-copper [CuSMoO_2] cluster and a molybdopterin cytosine dinucleotide (MCD) cofactor:

  • Cys388L (S-selanylcysteine): This is a highly unusual modified residue where a selenium group is attached to the sulfur of Cys388. It is essential for the catalytic oxidation of CO, likely reacting with CO to form a selenocarbonyl species.
  • Gln240L: This highly conserved residue forms a hydrogen bond with the apical oxo-group of the molybdenum ion.
  • Glu763L: A conserved glutamate that is part of the molybdenum ion’s second coordination sphere, positioned trans to the apical oxo group.
  • Ala385L: The amide nitrogen of this residue helps stabilize selenium/selenocyanate through hydrogen bonding.
  • VAYRC388LSFR Loop: This sequence forms the active-site loop, which is unique to CO dehydrogenases and may be involved in substrate binding.

M Subunit (Flavoprotein Subunit)

The CoxM flavoprotein subunit binds a flavin adenine dinucleotide (FAD) cofactor to facilitate electron transport from the molybdenum center to downstream cellular acceptors:

  • Tyr193M: This residue is part of a “Q loop” and shields the isoalloxazine ring of FAD from the solvent, though the ring remains accessible from one side for potential hydride transfer.
  • FAD-Binding Motifs: Two conserved double-glycine motifs, 32MAGGHS36 and 111MTIGG114, interact with the pyrophosphate and adenosine portions of FAD.
  • Arg29, Pro30, Leu37, Ala102, Asn115, Asp124, Leu167, and Lys185: These residues are specifically identified as forming hydrogen bonds with different parts of the FAD cofactor.
  • Gly119M, Asn123M, and Ala156M: These residues cluster near the solvent-exposed side of the FAD and are thought to define the docking site for NAD+, as mutations in equivalent residues in other enzymes affect NAD+ affinity.

S Subunit (Iron-Sulfur Subunit)

The small CoxS subunit acts as an electronic wire, channeling electrons from the molybdenum active site in CoxL to the FAD cofactor in CoxM via two distinct iron-sulfur ([2Fe-2S]) clusters. Literature establishes that CoxS is split into two rigid functional domains:

  • Residues 3–76 (N-terminal domain): This domain binds the distal [2Fe–2S] cluster (FeS II), which is exposed to the solvent and mediates electron transfer from the proximal cluster to the FAD in the M subunit
  • Residues 77–161(C-terminal domain): This domain binds the proximal [2Fe–2S] cluster (FeS I), which is buried 11 Å below the surface at the interface with the L subunit to receive electrons from the molybdenum center.

CoxL Subunit Molybdoprotein Active Site Validation

The Catalytic Core Anchor (Cys-444L & Ala-441L)

VAYRC388LSFR Loop sequence forms the active-site loop, which is unique to CO dehydrogenases and may be involved in substrate binding, it includes two critical amino acides : Cys388L (S-selanylcysteine) and Ala385L: image image image image

  • Residues Verified: Native Cys-388L –> Engineered Cys-444L; Native Ala-385L –> Engineered Ala-441L.
  • Ball-and-Stick Analysis: Cys-444L is the single most critical residue in the enzyme, responsible for supplying the sulfur atom that binds directly to the active site Copper (Cu) atom. The atomic overlay shows that its side-chain thiol group projects along the exact same spatial vector as the native structure, ensuring the copper-coordination sphere remains perfectly intact. Additionally, the backbone amide nitrogen of Ala-441L aligns flawlessly, preserving the hydrogen bonding network necessary to stabilize the active site selenium intermediate. image image image image

Molybdenum Sphere Stabilization (Gln-296L)

  • Residues Verified: Native Gln-240L –> Engineered Gln-296L.
  • Ball-and-Stick Analysis: This highly conserved glutamine forms an essential electrostatic shield, using its side-chain amide nitrogen to create a hydrogen bond with the apical oxo-group (M=O) of the molybdenum ion. The carboxamide functional group is perfectly rigidified in the active rotamer orientation, guaranteeing the pocket can accept and secure the molybdenum center without clashing. image image image image

The Catalytic Base Proxy (Glu-819L)

  • Residues Verified: Native Glu-763L –> Engineered Glu-819L.
  • Ball-and-Stick Analysis: Situated trans to the apical oxo group in the molybdenum ion’s second coordination sphere, Glu-819L must be positioned with extreme accuracy to help activate and deprotonate the incoming water molecule during CO oxidation. The atomic stick overlay shows that its terminal carboxylate group snaps approximately into position with no twisting or spatial displacement, preserving its chemical trajectory. image image image image The plant-targeted, codon-optimized CoxL subunit is an exact spatial duplicate of the native Oligotropha carboxidovorans enzyme. The structural preservation proven macroscopically in Verification 2 holds true all the way down to individual chemical atoms in Verification 3. The addition of the N-terminal RbcS CTP and the C-terminal HA-tag induces no structural tension or side-chain displacement inside the catalytic core, ensuring that the engineered enzyme is fully capable of binding its cofactors and conducting chemical carbon monoxide oxidation.

CoxM Flavoprotein Subunit & FAD-Binding Pocket Validation

In Verification 2, the global alignment of the CoxM flavoprotein subunit achieved a backbone trace matching down to a 0.17 Å RMSD. To verify that this structural preservation translates to biochemical functionality, we must confirm that the micro-spatial positioning of the FAD cofactor cage is maintained.

The Solvent-Shielding Gatekeeper (Tyr-193M)

  • Residues Verified: Native Tyr-193M –> Engineered Tyr-245M (193 + 52).

  • Ball-and-Stick Analysis: Tyr-245M plays a crucial gatekeeping role by shielding the reactive isoalloxazine ring of FAD from unwanted solvent interactions. The phenolic ring of this tyrosine shows excellent spatial overlay with no steric conflicts, preserving its native capacity to swing out slightly during hydride transfer pathways. image image image image By switching to a ball-and-stick rendering, the engineered variant’s residues (rendered in light green) were compared directly to the native bacterial template (rendered in pink). The Pyrophosphate-Binding Motif (AGGHS loop):

  • Residues Verified: Native 32MAGGHS36 on the M subunit  Engineered 84MAGGHS88 (32 + 52).

  • Ball-and-Stick Analysis: This loop contains a highly conserved double-glycine fingerprint. Because glycine lacks a bulky side-chain, its backbone is highly flexible, allowing it to wrap closely around the charged pyrophosphate arm of the FAD molecule. The atomic overlay demonstrates a very similar match, ensuring that the main anchoring loop for the FAD center remains unwarped. image image image image

The Adenosine-Binding Motif (TIGG loop):

  • Residues Verified: Native 111TIGG114 on the M subunit  Engineered 163TIGG166 (111 + 52).
  • Ball-and-Stick Analysis: This second double-glycine motif interacts precisely with the adenosine moiety of the FAD molecule to secure it inside the pocket. The light green custom model maps atom-for-atom onto the template, confirming that the structural pocket is fully capable of stabilizing the cofactor. image image image image

The FAD Stabilization Hydrogen-Bonding Network

  • Residues Verified: Arg-29 –> Arg-81, Pro-30 –> Pro-82), Leu-37 –> Leu-89, Ala-102 –> Ala-154, Asn-115 –> Asn-167, Asp-124 –> Asp-176, Leu-167 –> Leu-219, and Lys-185 –> Lys-237.
  • Ball-and-Stick Analysis: This extensive network of amino acids acts as the physical “glue” holding the massive FAD cofactor tail inside CoxM. As you can see in the screenshots, every single one of these light-green side-chains locks flawlessly onto the pink reference coordinates. Functional side-chain groups (like the basic guanidinium of Arg-81 and the acidic carboxylate of Asp-176) display no rotamer deviation, fully preserving the exact hydrogen-bonding distances needed to secure the cofactor. image image image image

The NAD+ Electron-Exit Docking Gateway

  • Residues Verified: Native Gly-119M –> Engineered Gly-171; Native Asn-123M –> Engineered Asn-175; Native Ala-156M –> Engineered Ala-208.
  • Ball-and-Stick Analysis: These residues cluster together on the solvent-exposed side of CoxM, creating the physiological landing pad where mobile NAD+ molecules dock to receive electrons from FAD. The atomic models verify that this entire interface surface is pristine. By preserving this exact landscape, the plant-targeted complex remains fully optimized for downstream biochemical electron transfers without losing affinity for its co-substrates. image image image image

Subunit S Iron-Sulfur Subunit validation

Globally, when looking at the cartoon representations, the engineered variant’s ribbon layout (light green) matches the native bacterial template beautifully. Both the N-terminal domain (FeS II) and the C-terminal domain (FeS I) fold into their correct secondary structure orientations. This macroscopic overlay proves that the general physical envelope required to cradle the two vital [2Fe-2S] clusters is fully preserved.

  • Residues 3–76 (56-129) (the N-terminal domain) image image
  • Residues 77–161 (130-214) (The C-terminal domain) image image

However, when we zoom in to inspect the explicit amino acid trajectories using stick representations, we can find clear structural divergences in some specific amino acids at both the absolute N-terminus and C-terminus boundaries. image image These local mismatches are predictable computational phenomena that do not compromise enzymatic function. The absolute terminal ends of CoxS directly border the engineered modifications: the RecA transit peptide junction at the N-terminus and the 9-amino-acid FLAG epitope tag at the C-terminus. Terminal tails are inherently highly dynamic, flexible “flapping tails” that lack fixed secondary structure constraints in monomeric predictions. While they adopt alternative loop paths in a relaxed fluid simulation, the core alpha-helices and beta-sheets holding the iron-sulfur clusters remain stable and unwarped.

Verification 4 — Complex Assembly and Interface Accessibility Analysis

Objective & method

To verify whether the engineered system correctly assembles into its expected functional macromolecular complex, I performed a full structural validation of the predicted heterohexameric enzyme. The goal was to confirm that all engineered subunits properly assemble without disrupting native-like interaction networks, and that chloroplast targeting sequences and fusion modifications do not interfere with oligomerization.

Instead of analyzing isolated subunits, the full biological assembly was evaluated as a complete six-chain heterohexameric complex predicted by AlphaFold Multimer.

System Architecture (Hexameric Model)

The modeled system corresponds to a functional symmetric heterohexamer composed of two trimeric units:

  • Chain A, B → CoxL subunits (L)
  • Chain C, D → CoxM subunits (M)
  • Chain E, F → CoxS subunits (S)

This defines a complete (LMS)₂ assembly, representing two identical trimeric functional units forming a higher-order oligomer.

Global Structural Validation (AlphaFold Multimer)

The full six-chain complex was first evaluated using AlphaFold Multimer prediction. image image The model shows: A stable and symmetric heterohexameric assembly with proper organization of all six subunits. The model displayed well-defined packing between the functional chains, indicating that the proteins assemble correctly into the expected complex. The Predicted Aligned Error (PAE) analysis revealed low-error values at the different interfaces, supporting a high level of confidence in the inter-chain interactions and overall oligomeric arrangement. No signs of chain dissociation, structural deformation, or collapse were observed in the predicted structure. In addition, the chloroplast transit peptides were oriented outward toward solvent-exposed regions and remained separated from the structural core, indicating that the introduced targeting sequences do not interfere with protein folding or complex assembly. image image

These results confirm that the global architecture is structurally consistent with a functional oligomeric enzyme.

Unbiased Interaction Mapping Strategy (PyMOL Analysis)

To identify all possible atomic interactions without bias toward predefined interfaces, I used a fully unrestricted contact-scan approach in PyMOL. image image Instead of selecting specific interfaces manually, the script:

  • Scanned all atoms in every chain
  • Calculated all inter-chain distances within a 4.0 Å cutoff
  • Automatically classified interactions based on residue chemistry: Hydrophobic contacts, Polar interactions / hydrogen bonds, Salt bridges, General atomic contacts. This approach ensured an unbiased, global detection of all physically relevant interfaces across the full hexamer.

Although all possible chain combinations were allowed in the script (A–B–C–D–E–F), the analysis naturally converged into only four physically meaningful interaction networks, indicating that only specific interfaces are structurally stable and biologically relevant:

A–C Interface (CoxL ↔ CoxM core interaction)

CoxL (Chain A) and CoxM (Chain C) form a strong central interface where both proteins are tightly packed together and build the structural core of the trimer.

This interface is stabilized by different types of interactions, including salt bridges, hydrogen bonds, and hydrophobic contacts. The residues listed below are examples taken from the full interaction set identified in PyMOL (not the complete list):

  • Salt bridge: ASP725(A) <–> ARG329(C) | 3.58 Å
  • Polar/H-bond: THR728(A) <–> TYR318(C) | 3.48 Å
  • Salt bridge: ASP786(A) <–> ARG240(C) | 3.74 Å
  • Contact: GLU794(A) <–> ILE242(C) | 3.61 Å image image

These interactions show that CoxL and CoxM are strongly connected through a combination of electrostatic attraction and hydrophobic packing, which stabilizes the core structure of each trimer unit.

A–E Interface (CoxL ↔ CoxS interaction)

CoxS (Chain E), the smaller functional subunit, interacts with CoxL on the external surface of the complex. This interface ensures that CoxS is properly anchored and positioned for its functional role.

The residues shown below are representative examples from the full set of interactions detected in PyMOL (not exhaustive):

  • Salt bridge: ASP99(A) <–> ARG83(E) | 3.54 Å
  • Contact: TYR183(A) <–> HIS80(E) | 3.93 Å
  • Polar/H-bond: ARG357(A) <–> GLY94(E) | 3.02 Å
  • Contact: PRO790(A) <–> TYR195(E) | 3.73 Å image image

These interactions confirm that CoxS is firmly attached to the main complex and is not loosely associated or freely moving.

C–E Interface (CoxM ↔ CoxS outer stabilization interface)

CoxM (Chain C) and CoxS (Chain E) form additional stabilizing interactions that reinforce the outer structure of each trimer unit.

The interactions below are examples selected from the complete interaction network detected by PyMOL (not the full list):

  • Contact: PRO55(C) <–> ARG75(E) | 3.52 Å
  • Salt bridge: LYS94(C) <–> ASP96(E) | 3.35 Å
  • Salt bridge: ASP155(C) <–> LYS113(E) | 3.96 Å
  • Contact: GLN157(C) <–> ASN188(E) | 3.67 Å image image

These interactions indicate that the outer surface of the trimer is stabilized by multiple weak and strong forces working together.

A–B Interface (CoxL ↔ CoxL dimerization axis)

This interface represents the central dimerization boundary where two trimeric units assemble into the full hexameric structure. The interaction is highly symmetric and indicates a strong and specific docking interface.

The residues shown below are examples from the full symmetric interaction network identified in PyMOL (not exhaustive):

  • Contact : GLY558(A) <–> ASN690(B) | 3.64 Å
  • Contact : TYR619(A) <–> TYR689(B) | 3.70 Å
  • Salt bridge : LYS642(A) <–> GLU697(B) | 3.18 Å
  • Polar/H-bond : ASN704(A) <–> GLU697(B) | 3.25 Å image image

These interactions are further stabilized by nearby charged residues, including ASP605 and ASP606, which contribute to the electrostatic stability of the interface. This confirms that the two trimer halves assemble in a highly specific and symmetric manner, forming a stable functional hexamer.

I used the Gemini AI tool to interpret the structural results and to predict how these specific CTP modifications and AA junctions influence protein folding, stability, and chloroplast targeting efficiency. while ChatGPT was employed for technical editing, ensuring the documentation was clear, concise, and grammatically precise.

Objective:

The objective of this verification step was to evaluate whether the engineered fusion subunits retained their ability to correctly assemble into the complete functional enzyme complex after the addition of chloroplast transit peptides (CTPs) and purification tags. Instead of predicting only the CoxL–CoxM–CoxS trimer, I modeled the entire (LMS)2 heterohexameric complex using AlphaFold 3 in order to perform a more realistic structural validation of the final engineered system.

This analysis aimed to verify that all modified subunits still formed stable inter-chain interactions comparable to the native enzyme architecture, while also confirming that the added CTP regions remained solvent-exposed and spatially separated from the subunit–subunit interaction interfaces. In addition, this step was used to assess whether the native assembly surfaces between CoxL, CoxM, and CoxS remained structurally accessible and unaffected by the engineered modifications, ensuring that the final enzyme complex could theoretically self-assemble correctly inside the chloroplast environment.


Sources:

  • Dobbek, H., Gremer, L., Meyer, O., & Huber, R. (1999). Crystal structure and mechanism of CO dehydrogenase, a molybdo iron-sulfur flavoprotein containing S-selanylcysteine. Proceedings of the National Academy of Sciences, 96(16), 8884-8889.
  • Schübel, U., Kraut, M., Mörsdorf, G., & Meyer, O. (1995). Molecular characterization of the gene cluster coxMSL encoding the molybdenum-containing carbon monoxide dehydrogenase of Oligotropha carboxidovorans. Journal of bacteriology, 177(8), 2197–2203. https://doi.org/10.1128/jb.177.8.2197-2203.1995

Phase 10: CTP-GFP Reporter Constructs Design

Golden Gate Assembly of Reporter Constructs:

Golden Gate Assembly Design Strategy

To enable modular Golden Gate Assembly, all fragments were flanked with BsaI recognition sites and custom-designed overhangs. These overhangs were selected to guide the ordered assembly of the fragments into the pCAMBIA1300 backbone after digestion.

The same assembly architecture was used for all three constructs, with the only difference being the CTP sequence.

The assembly order was:

Vector → FMV promoter → AMV enhancer → CTP → eGFP → tE9 terminator

Design of Junction Overhangs

  1. Vector–Promoter Junction (TCCT)

The pCAMBIA1300 vector was linearized using XbaI digestion. The last four nucleotides remaining from the digested vector (“TCCT”) were directly incorporated as the assembly scar between the vector backbone and the FMV promoter fragment. image image This strategy avoided unnecessary sequence modifications and maintained compatibility with the Golden Gate assembly design.

  1. Promoter–Enhancer Junction (TACT)

A custom “TACT” overhang was designed between the FMV promoter and the AMV RNA4 enhancer. image image This sequence functioned as a neutral assembly scar that allowed directional ligation while preserving the integrity of both regulatory elements.

  1. Enhancer–CTP Junction (AATG)

The “AATG” overhang was designed between the AMV enhancer and the chloroplast transit peptide (CTP) sequence. image image This overhang was selected because it contains the ATG start codon required for translation initiation. The design therefore allowed the translational start site to be incorporated directly into the assembly junction while preserving the correct reading frame.

  1. CTP–eGFP Junction (GCTA)

The junction between the CTP coding sequence and eGFP was designed carefully to preserve the open reading frame and avoid frameshift mutations.

Because this junction connected two coding sequences, the overhang was designed using:

  • “GCT” from the last codon of the CTP sequence
  • “A” from the ATG start codon of eGFP

Together, these nucleotides formed the “GCTA” overhang. image image

For the RbcS chloroplast transit peptide construct, the last two alanine codons were simply rearranged by switching: GCT↔GCG

Because both codons encode alanine, this modification did not alter the amino acid sequence of the transit peptide. The change was performed only to expose the required “GCT” sequence needed for the Golden Gate Assembly overhang at the CTP–eGFP junction while preserving the correct reading frame and maintaining the native peptide composition.

This strategy allowed the translational reading frame to remain continuous across the fusion protein while minimizing unnecessary amino acid changes.

The reading frame continuity was verified during sequence design, as represented by the “|” positions in the coding sequences.

  1. eGFP–Terminator Junction (CGCT)

For the junction between eGFP and the tE9 terminator, the “CGCT” overhang was designed.

In this case:

  • “GCT” originated from the beginning of the terminator-associated region
  • An additional “C” nucleotide was added to complete the 4 bp overhang image image This overhang was added at the end of the eGFP fragment after the stop codon, ensuring proper assembly without affecting the translated protein sequence.

Golden Gate Assembly of Reporter Constructs in Benchling

First, I opened Benchling and clicked on the Create (+) button from the left sidebar. From the cloning options, I selected “Assemble DNA sequences by cloning”, then chose the Golden Gate Assembly workflow. This opened the assembly interface where all cloning parameters were configured.

For the assembly settings, I selected the destination project folder dedicated to the reporter constructs. Since the final products were designed as plasmids, I set the construct topology to Circular. I then selected Golden Gate Assembly as the cloning method and specified BsaI as the Type IIS restriction enzyme used for assembly. image image image image image image Next, I imported all DNA fragments in their correct assembly order. The fragments included: image image image image image image image image image image image image image image

  • Linearized pCAMBIA1300 backbone
  • FMV promoter
  • AMV RNA4 enhancer
  • Chloroplast transit peptide (RbcS, Fer2, or RecA depending on the construct)
  • eGFP reporter gene
  • tE9 terminator

After importing all fragments, Benchling automatically analyzed the BsaI digestion products and checked the compatibility of all adjacent overhangs. When all overhangs matched correctly and fragment orientation was valid, Benchling generated a complete circular assembly product corresponding to the final reporter plasmid. image image image image image image I then clicked the “Assemble” button to generate the final constructs. image image image image image image Benchling created three independent circular plasmid sequences corresponding to:

Rbcs-CTP_EGFP_Benchling_Design: FMV promoter → AMV enhancer → RbcS CTP → eGFP → tE9 image image Fer-CTP_EGFP_Benchling_Design: FMV promoter → AMV enhancer → Fer2(M→A) CTP → eGFP → tE9 image image RecA-CTP_EGFP_Benchling_Design: FMV promoter → AMV enhancer → RecA CTP → eGFP → tE9 image image

Finally, I opened the resulting plasmid maps to verify construct integrity. I carefully checked that all annotations were preserved correctly across the assembled plasmids, including promoters, enhancers, transit peptides, coding sequences, and terminators. I also verified that all junctions were seamless, that the reading frame remained continuous across fusion regions, and that no inversions, missing fragments, or unintended mutations were introduced during the assembly simulation.

Objective

The objective of this step was to design three plant expression constructs that could be efficiently assembled into circular plasmids using the Golden Gate Assembly (GGA) method. All three constructs were designed with the same regulatory and reporter elements, while only the chloroplast transit peptide (CTP) sequence was changed in order assess the correct localization of the three engineered ctp sequences using a GFP reporter and confocal microscopy. The final constructs were designed as follows:

  • Reporter 1: FMV promoter → AMV enhancer → RbcS CTP + AA junction → eGFP → tE9
  • Reporter 2: FMV promoter → AMV enhancer → Fer2(M→A) CTP → eGFP → tE9
  • Reporter 3: FMV promoter → AMV enhancer → RecA CTP + AA junction → eGFP → tE9

Each construct was assembled using BsaI-mediated Golden Gate cloning with specifically designed 4 bp overhangs to ensure correct orientation and seamless ligation between adjacent fragments.

Group Final Project

cover image cover image