Labs

Lab writeups:

  • Week 1 Lab: Pipetting

  • Week 5; Phage Lysis Protein Design Challenge

    Phage Lysis Protein Design Challenge L-Protein Engineering (Mutagenesis) Designing these mutants with good computational confidence is hard. It will show you limitations of some of the structure based models. Ultimately, you can pick various combinations of mutations and get lab results and then decide to pick the next round of mutations, but this assay will not be easy to run at scale in this class. L PROTEIN SEQ:

  • Week 7: Neuromorphic Circuits

    Overview | Background In this two-day lab, you will design and build your very own IANN using a library of plasmids from the Ron Weiss lab and human embryonic kidney (HEK) 293 cells. IANNs differ from traditional synthetic genetic circuits because IANNs can perform analog computations, rather than being limited to digital computations. IANNs are also universal function approximators–given an adequate number of intracellular artificial neurons, you can use an IANN to achieve any input/output behavior you’d like.

  • Week 12: Bioproduction of Beta-Carotene and Lycopene

    Post Lab Questions | Mandatory for All Students Which genes when transferred into E. coli will induce the production of lycopene and beta-carotene, respectively? Why do the plasmids that are transferred into the E. coli need to contain an antibiotic resistance gene? What outcomes might we expect to see when we vary the media, presence of fructose, and temperature conditions of the overnight cultures?

Subsections of Labs

Week 1 Lab: Pipetting

cover image cover image

Week 5; Phage Lysis Protein Design Challenge

Phage Lysis Protein Design Challenge

L-Protein Engineering (Mutagenesis)

  • Designing these mutants with good computational confidence is hard. It will show you limitations of some of the structure based models. Ultimately, you can pick various combinations of mutations and get lab results and then decide to pick the next round of mutations, but this assay will not be easy to run at scale in this class.

L PROTEIN SEQ:

METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

https://www.uniprot.org/uniprotkb/P03609/entry#sequences

To create the following mutations, I combined the seuqnce conservation analysis with the experimental mutational data. Cluster gave a good signaling to the mutations found in wild types of the protein, giving a map to where to and not to make changes without distroyign completely the whole protein and its domains, which gives the lytic effect to it. I created the changes and then compared with the lab tested L protein mutants to see if this variations have already been investigated.

  1. Q33E

METRFPQQSQQTPASTNRRRPFKHEDYPCRRQERSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

  • It is a change in the DNAJ interactive domain. We make a change from Q to a polar uncharged residue to E a negative one. This could disrupt the binding.

ptm":0.28,“iptm”:0.21

  1. R19K

METRFPQQSQQTPASTNRKRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

  • We are making a mutaltion in the interactive DNAJ domain. The change is conservative as we keep the characteristics of the aminoacis being positive charged.

“ptm”:0.26,“iptm”:0.19

  1. S35A

METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRASTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

  • Change near the end of the soluble domain, the change of S TO A, makes a big change form a polar residue to a small non polar one.

“ptm”:0.25,“iptm”:0.17

  1. L59A

METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSALEAVIRTVTTLQQLLT

  • We chose this positon to create a mutation in the transmembrane domain. We change L TO A, reducing the side chain slightly and still keeping the hydrophobic property.

“ptm”:0.24,“iptm”:0.17

  1. R65L

METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRASTLYVLIFLAIFLSKFTNQLLLSLLEAVILTVTTLQQLLT

  • Position 65, means we are making another mutation in the transmembrenae domain. We are changing R a charged residue to L, a hydrophobic one. This big change may improve the helix giving more stability to the pore and its lytic effect.

“ptm”:0.23,“iptm”:0.17

Alphafold2Multimer

The computational design results tell us that the L-protein soluble domain (1–40) lacks a folding trigger, as evidenced by pLDDT scores <40. However, the transmembrane region (41–75) successfully forms a multimeric bundle. Future design iterations should focus on mutations that increase the pLDDT of the soluble domain or co-fold the sequence with DnaJ to observe if stability increases at the binding interface.

Week 7: Neuromorphic Circuits

Overview | Background

In this two-day lab, you will design and build your very own IANN using a library of plasmids from the Ron Weiss lab and human embryonic kidney (HEK) 293 cells. IANNs differ from traditional synthetic genetic circuits because IANNs can perform analog computations, rather than being limited to digital computations. IANNs are also universal function approximators–given an adequate number of intracellular artificial neurons, you can use an IANN to achieve any input/output behavior you’d like.

Overview | Concepts Learned & Skills Gained

This is a lab with a dry and wet component. In the dry lab component, you will design a neuromorphic circuit in groups of 3. Once your design has been finalized, you will write instructions for an OT-2 to build your circuit for you. In the wet lab component, a TA will upload your OT-2 instructions and you will observe the OT-2 building and transfecting your IANN into HEK293 cells.

Circuit Assembling

Genetic Circuit Parts Available

My Circuit

Experiment Layout

Prediction

When looking at the template, the designed I ended up creating has the same 2-layered genetic network with a bias input. THe circuit uses endoribonucleases to process signals inside the cell and flourescent proteins to report activity we are looking for.

Components Chosen:

  • X1

    Csy4: first layer ern enzyme

    eBFP2: flourescent marker for X1 (BLUE)

Csy4 acts as a sensor detecting upstream signals and process DNA.

  • X2

    Csy4_rec_CasE: CasE expression is controlled by the sequences recognized by Cys4 from X1.

    mNeonGreen:reports activity in X2 (GREEN)

  • BIAS

    CasE_rec_mKO2: the bias helps tune the overall circuit response, giving a baseline signal and it not being stricly ON/OFF.

Week 12: Bioproduction of Beta-Carotene and Lycopene

Post Lab Questions | Mandatory for All Students

  • Which genes when transferred into E. coli will induce the production of lycopene and beta-carotene, respectively?

  • Why do the plasmids that are transferred into the E. coli need to contain an antibiotic resistance gene?

  • What outcomes might we expect to see when we vary the media, presence of fructose, and temperature conditions of the overnight cultures?

  • Generally describe what “OD600” measures and how it can be interpreted in this experiment.

  • What are other experimental setups where we may be able to use acetone to separate cellular matter from a compound we intend to measure?

  • Why might we want to engineer E. coli to produce lycopene and beta-carotene pigments when Erwinia herbicola naturally produces them?


Post Lab Questions | For Committed Listeners Only

Let’s get in touch with our metabolic pathway

  1. What are the enzymes of the carotene pathway?

  2. Within this pathway, which is the rate determining step (the step that takes the longest)? Which enzyme is responsible for this step?

Notes for design of a DNA construct for bioproduction

  1. The first thing to do is to decide what organism you are going to use for this (E. coli or S. cerevisiae) for production. Which would you choose and why (emphases on production differences)?

  2. Now choose one of the enzymes and lets outline the parts of the construct for expression

  3. For E. coli lets create a expression vector that works as a plasmid you choose E. coli let’s create a expression vector that works as a plasmids

Now, for making a functional construct there are a variety of biological parts needed for this, like ribosome binding sites, terminators, operators and promoters. The last ones are the most important in terms of enzyme or protein production. Let’s elaborate further on this biopart.

Promoter With the links below we are going to answer a few questions and think about the correct use of promoter: (https://blog.addgene.org/plasmids-101-the-promoter-region, https://www.addgene.org/mol-bio-reference/promoters/, https://blog.addgene.org/plasmids-101-repressible-promoters, https://blog.addgene.org/plasmids-101-inducible-promoters)

  • What is the function of a promoter?

  • What types of promoters do we have?

  • If we wanted to turn off the transcription of a gene in response to a metabolite, what type of promoter would be most useful? What if we wanted this to increase in the presence of the metabolite?

  • Now choose one of the genes of the metabolic pathway previously described (Carotene/lycopene )and choose one enzyme to make an expression construct. What promoter could you use for this? Why did you choose it?

Origin of replication of plasmid

With the links below we are going to answer a few questions and think about the correct use of origin of rep: (https://blog.addgene.org/plasmid-101-origin-of-replication, https://blog.addgene.org/plasmids-101-plasmid-incompatibility, https://blog.addgene.org/plasmids-101-ebook-4th-edition)

  • What is the origin of replication?

  • What types of origin of replication do we have?

  • (Extra) What are compatibility groups?

  • Now for the previously chosen promoter and gene what will be the best origin or replication?

  1. (Mandatory for Global listeners, Optional MIT/Harvard) Elaborate further on other bioparts like RBS, terminators, operators you would use for a correct design and further bioproduction?

  2. (Hot! Extra points) What are aptamers and riboswitches and how can they be used for metabolic tuning or engineering in prokaryotes?

  3. (Extra points) Now what approach can be used to join all these parts together? Make a quick analysis of their sequence in search of possibilities (search for restriction sites, etc)

  4. (Extra Hot!!! Extra Points) Try to elaborate further on a biosynthetic pathway you would want to engineer in E. coli for production of a metabolite or product. What use could this bio-product have? Imagine dream applications!!!

  5. (Extra points) For S. cerevisiae create an integration cassette for homologous recombination.

  • First let’s check some concepts of yeast engineering and homologous recombination this in this notes

  • As well as for prokaryotes, eukaryotic DNA designs need bioparts used for construction of a function design and further expresion. Now search for a biosynthetic pathway if interested and describe one of the genes of the pathway.

  • Now, remember that for making a functional construct there are a variety of biological parts needed for this, like ribosome binding sites or Kozak sequences, terminators, and promoters. List the ones you could use for DNA design.

  • In yeast engineering we use DNA construction designs for making genome integration. What chromosome site could you use for integration of these and why?

  • (Hot! Extra points) Following the next chart of how a DNA integration cassette should be designed and with the previously chosen parts elaborate the DNA sequence you could use to synthesize with Twist.