Homework

Weekly homework submissions:

  • Week X HW: Test

    Hello 1 World ↩︎

  • Week 1 HW: Principles and Practices

    A glorious space phage (with artistic license lol) Week 1 Biological Engineering Application Governance Exercise I’m interested in developing phage chassis capable of targeting bacteria that commonly cause infections during spaceflight. I’m interested in developing these phage chassis because:

  • Week 2 HW: DNA Read, Write, and Edit

    Part 0: Basics of Gel Electrophoresis Per instructions for this part, I attended the 02/10 lecture and 02/11. Additionally I attended all 3 Bootcamp sessions. Part 1: Benchling & In-silico Gel Art Make a free account at benchling.com Benchling Account Creation Confirmation

  • Week 3 HW: Lab Automation

    The Power of Lab Automation Assignment: Python Script for Opentrons Artwork 0: Attended this week’s recitation and reviewed the lab information on programming Opentrons 1: Generated an artistic design using Ronan’s Opentrons GUI 1 2: Artistic Design Python Script: See script in URL below: https://colab.research.google.com/drive/1-pgSJt_aF9MydtG0szxz2YKoogNRLRhH#scrollTo=PsOgJ2DndZzt 3: Listing my sfgfp point coordinates from Ronan’s Opentrons GUI below (the shape is a rightward-facing green arrow): [(6.6,11), (8.8,11), (11,11), (8.8,8.8), (11,8.8), (13.2,8.8), (11,6.6), (13.2,6.6), (15.4,6.6), (13.2,4.4), (15.4,4.4), (17.6,4.4), (15.4,2.2), (17.6,2.2), (19.8,2.2), (17.6,0), (19.8,0), (22,0), (-22,-2.2), (-19.8,-2.2), (-17.6,-2.2), (-15.4,-2.2), (-13.2,-2.2), (-11,-2.2), (-8.8,-2.2), (-6.6,-2.2), (-4.4,-2.2), (-2.2,-2.2), (0,-2.2), (2.2,-2.2), (4.4,-2.2), (6.6,-2.2), (8.8,-2.2), (11,-2.2), (13.2,-2.2), (15.4,-2.2), (17.6,-2.2), (19.8,-2.2), (22,-2.2), (24.2,-2.2), (-22,-4.4), (-19.8,-4.4), (-17.6,-4.4), (-15.4,-4.4), (-13.2,-4.4), (-11,-4.4), (-8.8,-4.4), (-6.6,-4.4), (-4.4,-4.4), (-2.2,-4.4), (0,-4.4), (2.2,-4.4), (4.4,-4.4), (6.6,-4.4), (8.8,-4.4), (11,-4.4), (13.2,-4.4), (15.4,-4.4), (17.6,-4.4), (19.8,-4.4), (22,-4.4), (24.2,-4.4), (26.4,-4.4), (-22,-6.6), (-19.8,-6.6), (-17.6,-6.6), (-15.4,-6.6), (-13.2,-6.6), (-11,-6.6), (-8.8,-6.6), (-6.6,-6.6), (-4.4,-6.6), (-2.2,-6.6), (0,-6.6), (2.2,-6.6), (4.4,-6.6), (6.6,-6.6), (8.8,-6.6), (11,-6.6), (13.2,-6.6), (15.4,-6.6), (17.6,-6.6), (19.8,-6.6), (22,-6.6), (24.2,-6.6), (17.6,-8.8), (19.8,-8.8), (22,-8.8), (15.4,-11), (17.6,-11), (19.8,-11), (13.2,-13.2), (15.4,-13.2), (17.6,-13.2), (11,-15.4), (13.2,-15.4), (15.4,-15.4), (8.8,-17.6), (11,-17.6), (13.2,-17.6), (6.6,-19.8), (8.8,-19.8), (11,-19.8)]

  • Week 4 HW: Protein Design Part 1

    Part A: Conceptual Questions Where did amino acids come from before enzymes that make them, and before life started? Amino acids come from metabolic molecules within the cell. These metabolic molecules consist of carbon atom chemical backbone, inorganic nitrogen, and enzyme-facilitated chemical reactions. Before life as we know it started, amino acids originated from abiotic (not from living organisms) chemical reactions on Earth before the emergence of life as we know it. The chemical reactions occurred in the atmosphere, hydrothermal and oceanic vents, and via meteorite and comet (i.e., extraterrestrial) delivery Supporting prompts for this section listed below:

Subsections of Homework

Week X HW: Test

  • Hello 1

  1. World ↩︎

Week 1 HW: Principles and Practices

Space Phage Space Phage
A glorious space phage (with artistic license lol)

Week 1 Biological Engineering Application Governance Exercise

  • I’m interested in developing phage chassis capable of targeting bacteria that commonly cause infections during spaceflight. I’m interested in developing these phage chassis because:

    • They would give astronauts and future space travelers more autonomy in countering ad hoc novel infections that may occur during long-duration missions
    • They would help contribute to greater personalization of medical care for broader ranges/more diverse spacefaring populations, who will likely travel, work, and live in space for extended periods of time/longer than traditional space missions to date
    • This development may help counter novel terrestrial infections for medically underserved populations
  • Governance Goal 1 (G1): Preventing/Mitigating Malicious Dual-Use (i.e., ensuring)

    • Appropriate biosecurity (including cyberbiosecurity) controls
    • Safe deployment conditions
  • Governance Goal 2 (G2): Empowering Autonmous and Equitable Use

    • ‘Plug-and-play’ functionality (i.e., any mission or crew should be able to intuitively use solution – advanced technical acumen not required)
    • Solution costs and distribution should develop with access across wide range(s) of demographics and socio-economic strata in mind
  • Governance Action 1: Phage Safety Refusal (PSR)

    Purpose:

    • Current State: There are no proactive mechansisms preventing malicious dual-use phage development (i.e., developing a phage speicifcally designed to degrade host mRNA in healthy cells).
    • Proposed Changes: Easily implementable phage production host ‘kill switches’ that can be deployed if nth concentrations of healthy cells accidentally or deliberately targeted by phage therapy

    Design:

    • Existing global space health biotechnology base (consisting of private firms, academia, and government-affiliated research centers) need to opt-in and actively invest in space-based phage therapies at adequate enough levels to ensure this notion of a phage defensive ‘kill switch’ can be validated and deployed, or invalidated and no longer pursued
    • Diverse space health regulators (consisting of a variety of agencies across nation-state governments) would need to approve said ‘kill switches’ (ex. Food and Drug Administration in the United States)
    • Patients participating in clinical trials of the ‘kill switch’ would need to feel comfortable enough with the solution to participate
    • Investors and members of private industry must see enough potential in the ‘kill switch that they see it as worthy of their time and investment
    • Astronauts and future spacefarers must be comfortable enough with the ‘kill switches’ to consent to their use

    Assumptions

    • The underlying notion of malicious dual-use phage applications, particularly in a space biotechnology context. Assumptions underneath this assumption include:
      • Viable malicious dual-use phage applications within a space health context and
      • Malicious actors would see and act on the benefits of phage interventions for targeted action against healthy cells in adversarial/antagonistic persons
    • That defensive anti-phage ‘kill switches’ even make sense to pursue technically

    Risks of Failure & “Success”

    • No viable malicious dual-use phage application concern (terrestrially or in a space context)
    • No interest in developing anti-phage ‘kill switches’
    • Developing anti-phage ‘kill switches’ is too technically intensive/not scalable to address the diverse needs of potential future users
    • Not enough funding to develop necessary research body of knowledge to make anti-phage ‘kill switches’ viable and safe to use in a space health context
    • Anti-phage ‘kill switches’ successfully developed and deployed and become another chapter in the never-ending story of phages v. bacteria (i.e., phages adapt to the ‘kill switches’ over time, rendering them ineffective)
  • Governance Action 2: Space Medicine Access Consortia (SMAC)

    Purpose

    • Current State: The field of space medicine is still in its relative nascency. While space health consortia exist, there are no consortia explicitly aimed at making space medicine advancements as broadly accessible as possible to both spacefaring and terrestrial populations.
    • Proposed Changes: Charter and develop a consortia explicitly aimed at making space medicine advancements as broadly accessible as possible to both spacefaring and terrestrial populations. Ideally this consortia should comprise members from private industry, academia, government-affiliated research centers, and allied partners

    Design:

    • Potential and future committed consortia partners from across private industry, academia, government-affiliated research centers, and allied partners need to see the value of the consortia’s mission (i.e., they need to see and align with how the consortia’s explicit charter to make space medicine advancements as broadly accessible as possible to both spacefaring and terrestrial populations would benefit their organization)
    • Consortia partners need to agree on:
      • Rules of the road (this will likely need to be contractual)
      • Research scope(s) for their organizations
    • Concrete milestones indicating consortia success, stagnation, or failure in achieving its goals
    • Adequate funding to see consortia from inception through the point where most of its charter has been fulfilled (a somewhat analogous example might be the pool of institutions the Information Processing Technology Office (IPTO) at the Defense Advanced Research Projects Agency (DARPA) pooled together when creating the ARPANET, which later evolved to become the modern Internet, and the shifts in IPTO’s mission over time as a result of these developments)

    Assumptions

    • Critical mass of stakeholders:
      • cares about making space medicine advancements accessible to spacefaring and terrestrial populations
      • can see the value of a dedicated consortia to make space medicine advancements more accessible for spacefaring and terrestrial populations
      • can agree to the rules of the road necessary to make consortia viable
      • see the value of making phage chassis capable of targeting bacteria that commonly cause infections during spaceflight ‘plug-and-play’ and cost-effective for end-users (i.e., they wouldn’t prioritize some other space medicine intervention)
    • Consortia can achieve its charter, with greater phage chassis accessiblity as a step on its path to success

    Risks of Failure & “Success”

    • No or not enough interest in:
      • making space medicine advancements more accessible for spacefaring and terrestrial populations
      • developing consortia to make space medicine advancements more accessible for spacefaring and terrestrial populations
    • SMAC not viable due to:
      • Too much burden/not enough return on investment for potential consortia members (i.e., they don’t see the value)
      • Disagreeements over rules of engagement
      • Disagreement over research scope for participating members (i.e. who does what)
      • Inadequate implementation pathways (i.e., most of SMAC’s work languishes in the ‘valley of death’)
    • SMAC prioritizes other space medicine interventions over making phage chassis capable of targeting bacteria that commonly cause infections during spaceflight ‘plug-and-play’ and cost-effective for end-users
    • SMAC might ‘succeed’ too much, and as a result, the loudest or wealthiest SMAC members might eventually see value in exercising disproportionate control over the entity, diluting its charter
  • Governance Action 3: Space Applied Biomedicine Repository (SABR)

    Purpose

    • Current State: Numerous space medicine guides have been developed by NASA, including the NASA Astronaut Medical Operations Handbook, Advanced Diagnostic Ultrasound in Microgravity (ADUM) Protocols, and OCHMO-STD-100.1A, otherwise known as the NASA Medical Standard. Commercial space missions largely lean on these guides for their missions
    • Proposed Changes: While NASA’s precedent is useful and organizations like the Translational Research Institue for Space Health (TRISH) have proposed tailored guidance for commercial space travelers, there is no existing repository explicitly focused on lessons learned and best practices for applied biomedicine in a space context. As opposed to a static guide, this work be more like a git-based repo, that could be updated with lessons learned, remaining customaizable for large numbers of future spacefarers and their medicial needs

    Design

    • User base:
      • willing to contribute to and derive value from SABR
      • with enough technical know-how to contribute to and derive value from SABR
    • Stakeholder(s) willing to pay subscription costs to run (likely git-based) SABR technical back-end
    • Easy to understand guidance and lessons learned that can be easily ingested in text, video, or audio form on (likely) simple, non-bandwidth intensive network connected devices

    Assumptions:

    • A (likely git-based) repository is an optimal vehicle for distributing recursively improving or community-based applied biomedicine lessons-learned for the space medicine community and future missions
    • This repository would contain accumulated, useful insights regarding how phage chassis capable of targeting bacteria that commonly cause infections during spaceflight can be deployed or administered:
      • safely (i.e. without malicious dual-use) across a wide variety of space missions
      • in a ‘plug-and-play’ or affordable manner
    • Enough of a user base:
      • willing to contribute to and derive value from SABR
      • with enough technical know-how to contribute to and derive value from SABR
    • Stakeholder(s) willing to pay subscription costs to run (likely git-based) SABR technical back-end
    • Easy to understand guidance and lessons learned that can be easily ingested in text, video, or audio form on (likely) simple, non-bandwidth intensive network connected devices (i.e., SABR can adequately work even in very bandwidth constrained conditions)

    Risks of Failure & “Success”

    • Not enough interest in SABR (potential users or contributors don’t see its value)
    • SABR is:
      • too:
        • early/the timing’s not right
        • abstract and remote in its guidance (i.e., the actual users or contributors who might derive value from its content see its content as too over their heads, technical, jargon-filled, or not applicable for their specific use cases)
      • a useful application, just not for the safe, easy-to-use, or cost-efective deployment of phage chassis capable of targeting bacteria that commonly cause infections during spaceflight
      • bandwidth-constrained to such a degree that it’s untenable for all intensive purposes
    • Can’t find stakeholder(s) willing to pay subscription costs to run (likely git-based) SABR technical back-end
    • SABR works so well and grows to such an extent that discerning actual mission-relevant content of value from the repository becomes a challenge for uninitiated users (i.e., filtering is a challenge – hard to separate filler from useful content)
  • Biological Engineering Application Governance Scoring Rubric

  • Biological Engineering Application: Phage chassis capable of targeting bacteria that commonly cause infections during spaceflight

  • The rubric below works as follows: Policy goals and sub-goals are listed vertically, while each of the governance actions are listed next to the respective column header titled ‘Option’. Governance actions are scored from 1-3 based on how well they fulfil each policy goal and sub-goal. A score of 1 indicates a governance action does a poor job at fulfilling a policy goal, a 2 indicated a governance action does an OK job at fulfilling a policy goal, and a 3 indicates a governance action is the best at fulfilling a policy goal.

Does the option:Option 1: Phage Safety Refusal (PSR)Option 2: Space Medicine Access Consortia (SMAC)Option 3: Space Applied Biomedicine Repository (SABR)
Preventing/Mitigating Malicious Dual-Use31.51
• By implementing appropriate biosecurity (including cyberbiosecurity) controls212
• By promoting safe deployment conditions322
Empowering Autonmous and Equitable Use133
• By encouraging ‘plug-and-play’ functionality123
• By promoting cost and distribution accessibility132
  • Based on the scoring above, I’d probably prioritize SABR. Given the difficulties around space-based governance or governance in remote conditions, I think an organization like a TRISH or the Organization for Space Medicine, Engineering, and Design (OSMED) might be a good starting point, promoter, or convener to begin making something like SABR a reality. The more I think about it, the varied jurisdictions and varied, unclear regualtory regimes at the nation-state level make the idea of a more open-source/tribal knowledge-based self-governing solution appealing (or at bare minimum it shows a gap that could potentially be filled). I also think that if the timing was right (i.e., enough useful information could be added by a community of contributors) this could actually help fulfill some of the policy goals associated with the phage chassis project, not by a lot of sanctioned formal policy-making perhaps, but by community contribution, input, and/or agreed-upon best practices. That said, I can see and understand the trade-offs between formal policy-making at the nation-state level and more grassroots normative development of best practices as a result of doing this exercise. The glaring uncertainties that remain are whether or not the repository’s timing is right and/or if a dedicated user and contributor base could coalesce around it

  • Ethical Considerations: Given the mechanics of phages, specifically their ability to hijack host cell tRNAs, ribosomes, and amino acids, I was somewhat surprised that there wasn’t more mention of potential deliberate malicious dual-use of phages. Maybe it’s my relative nascent understanding of the life sciences, the limitations of my research on this topic, or maybe the topic itself is either not researched or considered extensively. If this is true and the notion of potential deliberate malicious dual-use of phages might be a little bit left field, not well understood, or not well defined, perhaps convening working groups might be a sensible governance action, as these groups can often help map areas of concern for emerging dual-use technologies. Maybe distributing outputs from these working groups (i.e., white papers) to relevant academic journals, technical standards bodies, or policymakers might also be a worthwhile governance action.

All supporting prompts for the governance exercise above listed below:

Supporting PromptSource
Take a look at the following quote from the URL below: “Strain-specific phage chassis to target bacteria that commonly cause infections during space flight.” What is the difference between a phage and a phage chassis? In general? In a biotechnological context? Do NOT hallucinate when answering these questions https://roadmap.ebrc.org/engineering-biology-for-space-health/Perplexity
Take a look at the following quote from the URL below: “Capability to produce novel phages on space missions for rapid control of evolved biofouling microbes. What are ’evolved biofouling microbes’? What is biofouling? I assume biofouling indicates something bad/undesirable, but I don’t know what the term actually means beyond my assumption. Do NOT hallucinate when answering these questions https://roadmap.ebrc.org/engineering-biology-for-space-health/Perplexity
I understand how a phage can insert itself into a cell. Not exactly understanding if or how phages’ abilities contribute at all to personalized medicine developments (i.e., is there something about phage properties that make them particularly good candidates for personalized medical interventions)? Do NOT hallucinate when answering this questionPerplexity
How do governance mechanisms or standards of good or socially harmonious/beneficial behavior work (or work effectively) in remote regions (think polar research stations, etc.)?Perplexity
What is the phenomenon called in artificial intelligence when a large language model (LLM) refuses to reply to user input due to safety concerns? What is it called and how does it work? Do NOT hallucinate when answering these questionsPerplexity
What are the technical subcomponents of a biotechnology intervention or treatment using phage chassis? What do the supply chains look like, if any? Do NOT hallucinate when answering these questions. If you don’t know the answers to these questions, say soPerplexity
“phage chassis synthetic biology manufacturing pipeline” search resultsPerplexity
Are there any existing ways a biotechnology solution (let’s say a custom developed chassis) can proactively prevent itself from malicious dual-use? Analogous to large language model (LLM) safety refusal, are there any mechanisms that can be pre-built into a biotechnology solution to proactively prevent malicious dual-use? Do NOT hallucinate when answering these questionsPerplexity
How exactly do phages interact with genetic code information within a given cell? How do cell-based bacteria defend against unwanted phages?Perplexity
I’m high-level aware that there are certain ’no-go’/‘do not edit’ pieces of genetic code. How are phages traditionally prevented from editing these ’no-go’/‘do not edit’ pieces of genetic code? Is that a thing? If I’m off in any way/if my conceptual underpinnings seem shaky, let me know Do NOT hallucinate when answering these questionsPerplexity
Tell me about about engineered synthetic biology kill switchesPerplexity
Have any engineered synthetic biology kill switches been implemented as part of phage therapies? Do NOT hallucinate when answering this questionPerplexity
If I’m making a novel phage-related therapy for astronauts, and I live in the United States, the Food and Drug Administration (FDA) would need to approve this therapy, correct? My assumption is yes. How does approval of a drug used outside of Earth’s atmosphere work from a regulatory perspective? Do NOT hallucinate when answering these questionsPerplexity
Are there any space health-related consortia specifically or explicitly aimed at making space medicine advancements as broadly accessible as possible to both spacefaring and terrestrial populations? If so, share information regarding said consortia Do NOT hallucinate. If you don’t know the answer to this question, say soPerplexity
In medicine, what do we usually mean by ‘point of care’? What do we mean when we say that?Perplexity
Do space medicine point of care guides exist? If so, are there any for commercial space tourists, astronauts, or future groups of spacefarers, including workers, etc.?Perplexity
What is applied biomedicine?Perplexity
What does trish stand for in a space health contextGoogle AI Mode
Tell me about the space health point of care guide TRISH is either developing or has developedGoogle AI Mode
What is the TRISH POCUS training referred to in the answer to the last prompt? What does POCUS refer to?Perplexity
How are most git-base repositories run? What is the underlying technical back-end powering them and how is this infrastructure paid for?Perplexity

Week 1 Homework Questions

Professor Jacobson Questions

  • Two widely used polymerases are thermus aquaticus (Taq) and pyrococcus furiosus (Pfu) 1. Taq has error rates ranging between 1 x 10-5 to 2 x 10-4 errors per base pair per doubling while Pfu has error rates of 1.3 x 106 2 3. Compared to the length of the human genome, 3 x 109 base pairs, this comes out to apprxoimately 3.3 x 10-13%, 6.6 x 10-12%, and 3.3 x 10-2% 4. Biology deals with this discrepancy during DNA replication through proofreading when it detects inaccurate nucleotides. When the polymerase detects that an inccorect base has been added, the polmyerase enzyme makes a cut in the chemical bond, releasing the incorrect nucleotide 5. If errors are made after replication, a mismatch repair is initiated. This is where enzymes recognize incorrectly added nucleotides and dispose of them. Nucelotide excision repair is another way nature corrects these errors. This occurs when ezymes remove and replace incorrect bases via cuts at the 3 and 5 prime ends of the incorrect base 6.
  • An average human protein is approximately 375 amino acids long 7. As each codon consists of 3 letters, rough math indicates there are approximately 3375 number of potential coding sequences, an extremely large number of combinations 8. Some of the reasons all these different codons don’t code for the protein of interest are:
    • Codon Bias: Some codons are represented during transcription at a far greater level than others, traditionally due to more abundant transcription RNA (tRNA), ensuring higher levels of expression 9 10.
    • mRNA Structure: Certain mRNA structures can be impacted by certain codon expression (i.e., become less stable), and therefore become more susceptible to degradation 11.
    • Translation Accuracy Issues: Non-optimal codons decrease protein translation efficiency, due to a form of crowding in the ribosome, the area in the cell where protein production takes place 12.

Dr. LeProust Questions

  • Solid-phase phosphoramidite synthesis is the most common currently used oligo synthesis method 13.
  • It’s difficult to make oligos longer than 200nt via direct synthesis because coupling errors/inefficiencies compound to the point where one ends up with lots of short, incomplete fragments 14.
  • A 2000bp gene has 4000 nucleotides 15. Based on the answer to the previous question, creating a 2000bp is not currently feasible due to the accumulation of coupling errors/inefficiencies, even when stitching together smaller oligos or using novel enzymatic methods are taken into account 16 17.

George Church Question

  • Question 3 Response: ARPA-H Biostablization Sytem (BoSS) Grant Response

    All supporting prompts listed below answer:

Innovative Solutions OpeningARPA-H-SOL-26-136
Solution Summary TitlePyrococcus furiosus-Inspired Molecular Staples (PFIMS)
Team Lead OrganizationFederally Funded Research and Development Center (FFDRC)
Type of OrganizationSee above
Technical Point of ContactName: Jason Ross
Administrative Point of ContactName: Jason Ross
Total Basis of Estimate$2,600,000
Places of PerformanceMcLean, VA
Other Team MembersMITRE Biotechnology Department (L271) Interns

Concept Summary

The team behind Pyrococcus furiosus-Inspired Molecular Staples (PFIMS) seeks to develop small organic molecules capable of binding to the ‘grooves’ of DNA and proteins across a variety of temperatures. If successfully developed, PFIMS would allow heat-proofing a biologic across a variety of temperatures without the need for dehydration. By locking protein folds through ionic pull, we can stablize biologics for longer periods of time (TA1). Our work will scale this system to scalable cell processing across an array of temperatures and use cases (TA2).

Innovation and Impact

PFIMS is inspired by extremophile biology. Pyrococcus furiosus can survive at temperatures of 100 degrees Celsius in ocean vents. By mimicking pyrococcus furiosus’ molecular heat shield, we can keep cells alive and functioning for exteneded periods of time at refrigerator or room temperature. Unlike modern cryopreservation methods that employ various forms of freezing that can harm cells during thawing, our stabilization solution stabilizes proteins using byproducts proteins naturally produce. Not only are cold temperatures avoided entirely, but once scaled this solution will slash costs for biologics shipping. Most importantly, PFIMS can work for any cell type, as it builds off fundamental biological features, such as protein folding and membrane strength.

Proposed Work

We plan to develop a novel, functioning bench-top bioprocessing system inspired by pyrococcus furiosus. We will create a polyamine-based stabilization medium that will power this bioprocessing system for a standard biologic (ex. cell therapy or antibodies). PFMIS’ approach is grounded in existing literature on stablization for high temperature DNA/protein stabilization via polyamines, small organic molecules with muliple amino groups (Bae, 2018) (Despotović, 2020) (Oshima, 2007). These polymaines act as a form of ‘molecular staples’ in preliminary modeling efforts (Vieille, C.,2001).

Key Milestones and Deliverables

Phase 1: Synthesize the branched polyamine formulation. Deliverable: Optimized medium prototype based on a standard biologic.

Phase 2: Integrate the stabilization medium into bioprocessing hardware, likely a singlee-use bioreactor to for initial prototype followed by a larger testing and deplouyment within a media/buffer prep mixer. Deliverable: Protoyped biostabilization device.

Phase 3: Validate stability metrics for a model biologic using PFIMS at room temperature over time. Deliverable: Validation report and delivery of biostabilization system capable of scaled biostablization across nth biologics

Technical Risks and Mitigations

Risk: Polyamines may exhibit toxicity at necessary concentratioons. Mitigation: Screening polyamines for reduced toxicity levels; introducing wash and resuspension steps into bioprocessing.

Risk: Stabilization mechanism may exhibit difficulty transferring from archaic single-celled microbes like pyrococcus furiosus to eukaryotic cells (cells containing nuclei and organelles). Mitigation: Tests across multiple cell types

Use Case

PFIMS enables rapid delivery of life-saving biologics and therapeutics in low-resourced or contested conditions. This allows for dramatically cheaper shipment of biologics to locations such as rural communities without robust public health infrastructure, remote or relatively isolated geographies, or active conflict zones.

Sources

  • Bae DH, Lane DJR, Jansson PJ, Richardson DR. The old and new biochemistry of polyamines. Biochim Biophys Acta Gen Subj. 2018 Sep;1862(9):2053-2068. doi: 10.1016/j.bbagen.2018.06.004. Epub 2018 Jun 8. PMID: 29890242.
  • Despotović Dragana, Longo Liam, et. al. Polyamines mediate folding of primordial hyperacidic helical peptides into stable amyloid-like fibrils. Biochemistry, 60(4), 257–267.
  • Oshima T. Unique polyamines produced by an extreme thermophile, Thermus thermophilus. Amino Acids. 2007 Aug;33(2):367-72. doi: 10.1007/s00726-007-0526-z. Epub 2007 Apr 12. PMID: 17429571.
  • Vieille C, Zeikus GJ. Hyperthermophilic enzymes: sources, uses, and molecular mechanisms for thermostability. Microbiol Mol Biol Rev. 2001 Mar;65(1):1-43. doi: 10.1128/MMBR.65.1.1-43.2001. PMID: 11238984; PMCID: PMC99017.

All supporting prompts listed below:

Supporting PromptSource
Tell me about how very temperature resilient trees or plants achieve homeostasis despite large temperature fluctuations. If the Dsup protein in tardigrades could hypothetically be used to confer radiation resistance to humans traveling in space, how could an analogous protein or feature found in trees or plants be used to store biologics across a wider array of temperatures? Essentially I’m asking for analogous applicability if that makes senseGoogle AI Mode
As a potential next step, do NOT look into synthetic biology startups that are already attempting to synthesize LEA proteins for “cold-chain-free” vaccine storage. Give me other, non-plant or tree examples across the kingdom of life where homeostasis is achieve despite large temperature fluctuations. I want to look where synthetic biology startups are NOT lookingGoogle AI Mode
Give me academic sources for each of the 3 non-plant examples and any biotechnology research in academia around these properties. Then tell me the basics of how the properties of each organism would transfer to a medium capable of biological stabilization for an array of biologicsGoogle AI Mode
What is Pyrococcus furiosus? Can you show me a picture?Google AI Mode
“The Transfer Logic To create a stabilization medium, you would synthesize branched-chain polyamines (like thermo-spermine). Binding: These molecules are positively charged and naturally “wrap” around negatively charged biologics (like DNA/RNA or specific protein folds). The Medium: The medium would be a liquid concentrate of these polyamines. Instead of refrigeration, the “staples” provide enough ionic pull to prevent the biologic from “unzipping” when the temperature rises.” Based on the ‘Proposed Work’ section in the attached document, create 2 simple examples of final deliverables, and create some broad brushstrokes/bullet points I can use to create a ‘Proposed Work’ section based on the specifications provided in the attached document.Google AI Mode
Based on the previous information provided, estimates of how long these processes would take, and the salary rates for an average employee at the MITRE Corporation, give me some Total Basis of Estimate numbers (i.e., ranges for how much this would cost)?Google AI Mode
Looking to develop a Pyrococcus furiosus -inspired stabilization medium for cell preservation. Based on existing Pyrococcus furiosus literature, give me 5 bullet points describing why this approach would be novel and game-changing. Don;’t use a lot of jargon. One of the bullets should explain how this stabilization medium would differ from the current state of the artPerplexity
What is a polyamine?Perplexity
If I wanted to integrate a Pyrococcus furiosus -inspired stabilization medium into bioprocessing hardware, what type of hardware would we be talking about? What’s commonly used?Perplexity
What does the term ‘cytotoxic’ mean? I assume it’s a form of toxicity, but I don’t know what it specifically refers toPerplexity
What are archaea and how are they different from eukaryotic cells?Perplexity

Week 2 HW: DNA Read, Write, and Edit

Astronaut Genomics Picture Astronaut Genomics Picture

Part 0: Basics of Gel Electrophoresis

  • Per instructions for this part, I attended the 02/10 lecture and 02/11. Additionally I attended all 3 Bootcamp sessions.

Part 1: Benchling & In-silico Gel Art

  • Make a free account at benchling.com

Benchling Account Confirmation Benchling Account Confirmation Benchling Account Creation Confirmation

  • Import the Lambda DNA

Benchling Phage Lambda DNA Import Confirmation_02.12.26 Benchling Phage Lambda DNA Import Confirmation_02.12.26 Benchling Phage Lambda DNA Import Confirmation_02.12.26

  • Simulate Restriction Enzyme Digestion with the following Enzymes:

    • EcoRI EcoRI Enzyme Digest Confirmation EcoRI Enzyme Digest Confirmation EcoRI Enzyme Digest Confirmation_Virtual Digest EcoRI Enzyme Digest Confirmation_Virtual Digest

    Benchling EcoRI Enzyme Digest Confirmation

    • HindIII HindIII Enzyme Digest Confirmation HindIII Enzyme Digest Confirmation HindIII Enzyme Digest Confirmation_Virtual Digest HindIII Enzyme Digest Confirmation_Virtual Digest

    Benchling HindIII Enzyme Digest Confirmation

    • BamHI BamHI Enzyme Digest Confirmation BamHI Enzyme Digest Confirmation BamHI Enzyme Digest Confirmation_Virtual Digest BamHI Enzyme Digest Confirmation_Virtual Digest

    Benchling BamHI Enzyme Digest Confirmation

    • KpnI KpnI Enzyme Digest Confirmation KpnI Enzyme Digest Confirmation KpnI Enzyme Digest Confirmation_Virtual Digest KpnI Enzyme Digest Confirmation_Virtual Digest

    Benchling KpnI Enzyme Digest Confirmation

    • EcoRV EcoRV Enzyme Digest Confirmation EcoRV Enzyme Digest Confirmation EcoRV Enzyme Digest Confirmation_Virtual Digest EcoRV Enzyme Digest Confirmation_Virtual Digest

    Benchling EcoRV Enzyme Digest Confirmation

    • SacI SacI Enzyme Digest Confirmation SacI Enzyme Digest Confirmation SacI Enzyme Digest Confirmation_Virtual Digest SacI Enzyme Digest Confirmation_Virtual Digest

    Benchling SacI Enzyme Digest Confirmation

    • SalI SalI Enzyme Digest Confirmation SalI Enzyme Digest Confirmation SalI Enzyme Digest Confirmation SalI Enzyme Digest Confirmation

    Benchling SalI Enzyme Digest Confirmation

  • Create a pattern/image in the style of Paul Vanouse’s Latent Figure Protocol artowrks

    Mind the Gap Mind the Gap

    Mind the Gap (Or a Most Wondrous Cave) ➕

Part 2: Gel Art - Restriction Digests and Gel Electrophoresis

Part 3: DNA Design Challenge

3.1 Choose your protein
  • I chose the Mantis Fibroin 1 protein because for some reason when I received this assignment, my mind flipped to an insect protein, and then from there, a praying mantis. Upon further research, I was pleased with where my intuition lead me. The Mantis Fibroin 1 protein helps comprise the mantis’ ootheca, otherwise known as its egg casing. What’s fascinating about these proteins is that they create this coiled yet flexible foam-like structure around the mantis’ eggs. This protein piqued my interest, as it might have biomimetic potential. The Mantis Fibroin 1 protein is listed below 12:

tr|I3PM87|I3PM87_9NEOP Mantis fibroin 1 OS=Pseudomantis albofimbriata OX=627833 GN=MF1 PE=2 SV=1 MDSKMLCVSLLLAVFCLWYTEASPLEEKYGEKYGDMEEYQRGTEDSRAVINDHTAKVASQ SARGMVNKAKTTEAAARSNEQLSKDRQYYYREYLKKADYHKKKALEYEQLSAAENAKIAY HESKQKDWETKARESDVQCRDAEAKYEQSYTRSRELKRESIIAYVQAAMHHAEASGDHMK ADRAKDIARDMMRKAESLRGDASNHYQRSEEDKNKARSEKVKAHQNADNSQRHHTACRAY DQEGLKTRLSSKANMMRQIHSSLLAERSHSLAREDGLAADLSHKLAEELARMSEESGAIS KINSGEERGYSNKVRQDEVKAHELAVSKRMMGAEVADNSEMISLAQAKDGSLDEGENYKL STFYADDSTKNMLPDSRGQMSYGDE

3.2 Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.
  • A translated Mantis Fibroin 1 protein nucleotide sequence of most likely codons is below, as well as evidence showing how I inserted the Mantis Fibroin 1 protein UniProt information into the reverse translation tool

atggatagcaaaatgctgtgcgtgagcctgctgctggcggtgttttgcctgtggtatacc gaagcgagcccgctggaagaaaaatatggcgaaaaatatggcgatatggaagaatatcag cgcggcaccgaagatagccgcgcggtgattaacgatcataccgcgaaagtggcgagccag agcgcgcgcggcatggtgaacaaagcgaaaaccaccgaagcggcggcgcgcagcaacgaa cagctgagcaaagatcgccagtattattatcgcgaatatctgaaaaaagcggattatcat aaaaaaaaagcgctggaatatgaacagctgagcgcggcggaaaacgcgaaaattgcgtat catgaaagcaaacagaaagattgggaaaccaaagcgcgcgaaagcgatgtgcagtgccgc gatgcggaagcgaaatatgaacagagctatacccgcagccgcgaactgaaacgcgaaagc attattgcgtatgtgcaggcggcgatgcatcatgcggaagcgagcggcgatcatatgaaa gcggatcgcgcgaaagatattgcgcgcgatatgatgcgcaaagcggaaagcctgcgcggc gatgcgagcaaccattatcagcgcagcgaagaagataaaaacaaagcgcgcagcgaaaaa gtgaaagcgcatcagaacgcggataacagccagcgccatcataccgcgtgccgcgcgtat gatcaggaaggcctgaaaacccgcctgagcagcaaagcgaacatgatgcgccagattcat agcagcctgctggcggaacgcagccatagcctggcgcgcgaagatggcctggcggcggat ctgagccataaactggcggaagaactggcgcgcatgagcgaagaaagcggcgcgattagc aaaattaacagcggcgaagaacgcggctatagcaacaaagtgcgccaggatgaagtgaaa gcgcatgaactggcggtgagcaaacgcatgatgggcgcggaagtggcggataacagcgaa atgattagcctggcgcaggcgaaagatggcagcctggatgaaggcgaaaactataaactg agcaccttttatgcggatgatagcaccaaaaacatgctgccggatagccgcggccagatg agctatggcgatgaa

MantisFibroinInsert MantisFibroinInsert Mantis Fibroin 1 UniProt Information Inserted into Reverse Translation Tool

3.3 Codon Optimization
  • We need to optimize codon usage so a particular sequence can be expressed with greater fidelity, reliability, and efficiency in a host organism. I’ve chosen to optimze the codon sequence for Saccharomyces cerevisiae (baker’s yeast), because it:
  • is commonly used as a host in biotechnology applications
  • folds in a manner closer to insect protein folding
  • is apparently easier to work with than mammalian cells

A codon optimized Mantis Fibroin 1 nucleotide sequence is shown below, as well as evidence showing how I showing how I inserted the Mantis Fibroin 1 protein nucleotide sequence information into the codon optimization tool

ATGGACAGTAAGATGTTATGTGTCTCCTTATTGTTGGCTGTTTTTTGTTTATGGTATACTGAAGCTTCCCCATTAGAAGAAAAGTATGGTGAAAAGTACGGTGACATGGAAGAGTACCAAAGAGGTACTGAAGATTCAAGAGCAGTTATTAACGATCATACTGCTAAAGTTGCTTCCCAATCCGCCAGAGGTATGGTTAATAAGGCTAAGACTACAGAAGCTGCTGCTAGAAGTAATGAACAATTATCTAAAGATAGACAATACTATTACAGAGAATATTTGAAAAAGGCTGATTATCATAAGAAGAAAGCTTTGGAATATGAACAGCTTTCAGCTGCTGAAAATGCAAAAATTGCTTATCATGAATCTAAACAAAAAGACTGGGAAACGAAAGCCAGAGAATCCGATGTTCAATGTCGTGATGCTGAAGCAAAATATGAACAATCTTACACAAGGTCCAGAGAACTGAAAAGGGAATCTATTATTGCTTATGTTCAAGCTGCTATGCATCATGCTGAAGCTAGCGGTGATCACATGAAAGCTGATAGAGCTAAAGATATCGCTAGAGATATGATGAGAAAGGCAGAATCCTTAAGGGGTGACGCTAGCAACCATTATCAGAGATCCGAAGAAGATAAGAATAAGGCCAGATCTGAAAAGGTTAAAGCTCATCAAAACGCTGATAATTCTCAAAGACATCATACTGCATGCAGAGCGTATGACCAAGAAGGTTTAAAGACGAGATTGAGCTCAAAAGCCAACATGATGAGACAAATTCACTCCTCACTACTGGCTGAAAGATCTCATTCATTAGCAAGAGAAGACGGTCTTGCGGCCGATTTATCACATAAGTTGGCTGAAGAATTAGCTAGAATGTCCGAAGAATCAGGTGCTATATCTAAAATAAACTCAGGTGAAGAAAGAGGCTATTCGAATAAAGTGAGACAAGATGAGGTTAAAGCACATGAATTGGCTGTTAGCAAAAGAATGATGGGTGCTGAAGTTGCTGATAATTCGGAGATGATTAGTTTGGCACAAGCTAAAGACGGTTCTTTAGATGAAGGTGAGAACTATAAATTATCCACTTTTTATGCAGACGATTCTACAAAAAATATGCTACCAGATTCTAGGGGTCAAATGTCTTACGGTGATGAA

Mantis Codon Optimization Mantis Codon Optimization Mantis Fibroin 1 nucleotide sequence codon optimized for Saccharomyces cerevisiae (baker’s yeast)

3.4: You have a sequence! Now what?
  • Several cell-dependent technologies could be used for producing the codon-optimized Mantis Fibroin 1 protein. One such technology, a yeast system, has already been pursued in the previous steps of this section, as Saccharomyces cerevisiae (baker’s yeast) is a form of yeast. Bacterial systems, such as E. coli could also be used for producing the protein in host cell culture, although this would require different codon optimization. Other cell-dependent technologies could have included insect or mammalian-based systems, although I’m not sure of the value of expressing an insect-associated protein in another insect-based host (although this may be a failure of imagination on my part). As mentioned previously, mammalian systems could also be used, but apparently mammalian cells are more difficult to work with than bacterial or yeast-based hosts. Cell-free methods for producing the codon-optimized Mantis Fibroin 1 protein would involve breaking open a cell, extracting relevant ribosomes, enzymes, tRNAs, etc., and then taking these contents and combinining them with a DNA template (in this case our Mantis Fibroin 1 protein nucleotide sequence), energy sourcesm relevant amino acids, and a reaction buffer. There’s a time advantage of cell-free methods over cell-dependent methods of protein expression.
3.5 Optional: How does it work in nature/biological systems?
  • From my research in answering this question, I think the answer is that post-transcriptional process called alternative splicing occurs, where non-coding mRNA (introns) are cut and removed, while coding regions (exons) remain 3. It’s pretty fascinating because this splicing can create several different types of mRNA molecules, and therefore different proteins. This increases the efficiency with which different proteins can be expressed within a particular organism.
  • See below

Attempted Mantis Fibroin 1 Alignment Attempted Mantis Fibroin 1 Alignment Attempted Mantis Fibroin 1 Alignment

All Section 3 Prompts Listed Below

Supporting PromptSource
I want to make DNA gel art in the style of Paul Venouse’s gel electrophoresis works. I want to use the website below to help me:https://rcdonovan.com/gel-art How should I go about making this art virtually? I have a Benchling account, an Internet connection, and no access to a wet labPerplexity
Help me design a specific lane‑by‑lane “band plan” for your first virtual gel artwork. My knowledge of Benchling is very minimal and my desired art is a right-facing arrowPerplexity
Not understanding the 3rd Step under Step 3. How do I run any digest that gives me 2 fragments? How do I know my target size for each copy of the Arrow_Base sequence?Perplexity
I see a scissors icon. Write out a literal “click this, then this” sequence for one lane so I can duplicate it for the othersPerplexity
Ok I’ve found and made 5 digests of the requested bp sizes. When I’m seeing the combined virtual digest I’m not seeing an arrow. What are next steps I should take?Perplexity
Ok – let’s take a step back. I’ve tried what you’ve said and am not seeing a right facing arrow. Think I need to learn how to do this from the ground up with some more tweaking. I know how to select the Digests option in Benching, I know how to save a Digest, and I know how to click on ‘Virtual Digest’ and select different kinds of ladders. What type of ‘Cut sites visible on maps’ should I select to begin compiling the right facing arrow? Under ‘Show enzymes that cut’ is there anything in particular I should select? Should I select ‘Highlight enzymes with compatible sticky ends’? How do I actually learn how to make the right facing arrow?Perplexity
This seems like a good workflow. How do I create a new DNA with a 5000bp length? I assume I have to import a sequence of that length from an NCBI accession correct?Perplexity
When I type in HindIII I see 0 cuts. I can’t make a ~4000bp band based on that, right?Perplexity
Everything is coming up a 0 when I try to put in an enzyme. I think there’s hallucinating going on or there is something wrong when you started having me make the 5kb sequencePerplexity
When I select an enzyme for a digest, do I then need to select a cut site to make the bio art or no?Perplexity
Dumb question: How do I see the length of a digest for a given enzyme in a sequence?Perplexity
Tell me how to search NCBI for an accessionPerplexity
When I look inside the Digest feature in Benchling, how do I find an enzyme that can give me a cut of a certain length? I see Name in one column, followed by Cuts, but am not exactly understanding what I’m seeing herePerplexity
wondering if there are any special proteins found in the praying mantis insect and what exactly about these proteins make them specialGoogle AI Mode
Are there any proteins in nature that have unbelievable economy of space that would make them particularly useful for data storage?Google AI Mode
Are there any proteins in nature that have unbelievable economy of space that would make them particularly useful for data storage?Google AI Mode
i want to make a box where I can put some text in in markdown hugo relearn theme. I don’t want to create a table. What should i create?Google AI Mode
When one does codon optimization and the sequence in question comes from a protein traditionally associated with a given species (let’s say an insect), does one traditionally optimize the codon sequence for that same species or its genus/family of species? How does this work given standard codon optimization practices?Perplexity
So in essence, we perform codon optimization so our sequence in question can be expressed with greater fidelity or reliability in the host? Or so the host can receive or incorporate the sequence as efficiently as possible? Let me know if my thinking or terminology is off herePerplexity
I have a nucleotide sequence for the Mantis Fibroin 1 protein. Have learned about some of the Mantis Fibroin 1 protein’s interesting properties, namely how it helps create a coiled yet flexible casing around Praying Mantis eggs. At this point, I think this protein might have some biomimetic potential, but am not sure what organism I should optimize the sequence for. Traditionally I know E. coli and Baker’s yeast are used a lot in synthetic biology applications, and I know mammalian cells are apparently more challenging to work with. For a use case like this one, where I have an insect-associated protein that may have biomimetic properties, let me know some traditional host organisms in biotechnology that are used for codon optimization in cases like this one. Do NOT hallucinate. Use existing sources. If you cannot provide anything whatsoever, say soPerplexity
When we have a protein we find in the wild, and then we codon optimize its nucleotide sequence for expression in a host organism, what do cell-dependent or cell-free methods to produce this codon optimized protein from the sequence mean in a biotechnological context? What exactly are we talking about?Perplexity
Based on the answer to the previous prompt, what is a promoter? What is a lysate mix? Do NOT hallucinate when answering these questionsPerplexity
What are some cell-dependent methods of producing proteins from DNA in biotechnology? Are there multiple types of cell-dependent methods? Do NOT hallucinate when answering these questionsPerplexity
Are cell-dependent methods for producing proteins from DNA in biotechnology distinct from cell-dependent technologies for producing proteins from DNA or are the terms ‘methods’ and ’technologies’ essentially interchangeable in a biotechnology context? If they’re not, describe some cell-dependent technologies for producing proteins from DNA. Do NOT hallucinate when addressing this query. If you cannot answer this question, say soPerplexity
explain to me how cell-free expression of a protein worksGoogle AI Mode
Does the histone code have anything to do with the ability for a single gene in nature to code for multiple proteins at the transcriptional level? How does the histone code relate to the transcriptome? Are they one and the same?. Do NOT hallucinate when answering these questions. If you don’t know the answers to these questions, say soPerplexity
Based on the answer to the last prompt, then what does allow for a single gene in nature to code for multiple proteins at the transcriptional level? In plain terms, what does “…different exon combinations produce distinct mRNA isoforms from one gene, which then translate into varied proteins” mean? What are exons again, and how do they produce different combinations? What is an mRNA isoform? Do NOT hallucinate when answering this queryPerplexity
Thank you for the answer to the last query. What exactly is being sliced (the gene itself or something else), and why is it being spliced? Why would nature/evolution create this ability? Do NOT hallucinate when answering this query. Go off existing literaturePerplexity
Does alternative splicing operate at the transcriptional level? From what I can see in the link below, it operates on the translational level. https://www.yourgenome.org/theme/what-is-rna-splicing/. If there was hallucination, or an error in answering the previous prompts, say so. Or, if I’m misreading or misunderstanding things, say so. Just wondering what at the transcriptional level allows for a single gene to code for multiple proteinsPerplexity
how does a single gene in nature code for multiple proteins at the transcriptional level?Google AI Mode
I want to align a DNA sequence, its transcribed RNA, and a resulting translated protein. I believe I can capture the separate pieces (the DNA sequence, the transcribed RNA, and the resulting translated protein) in Benchling. If this is true, how can I go about doing this?Perplexity
I have a codon optimized sequence for the Mantis Fibroin 1 protein in a Saccharomyces cerevisiae (baker’s yeast) host. I want to produce the RNA sequence and the final translated protein. What services online can I use to do this?Perplexity
What does forward and reverse translation of a DNA sequence in Benchling mean?Perplexity
I have a codon optimized nucleotide sequence (DNA). How can I find what the RNA sequence and translated protein look like for this sequence? What services can I use to see these items?Google AI Mode

Part 4: Prepare a Twist DNA Synthesis Order

4.1: Create a Twist account, and Benchling account

Twist Account Creation Twist Account Creation Twist Account Creation

Benchling Account Confirmation Benchling Account Confirmation Benchling Account Creation Confirmation

4.2: Build Your DNA Insert Sequence

Original Sequence Import Original Sequence Import Original Sequence Insertion NOTE: Think I may’ve started off inserting the wrong sequence. This may have been potentially fixed when I inserted a sfGFP sequence from NCBI*

Codon Optimization Codon Optimization Codon Optimization NOTE: Think I may’ve started off inserting the wrong sequence. This may have been potentially fixed when I inserted a sfGFP sequence from NCBI*

Corrected Sequence Input Corrected Sequence Input Corrected NCBI Sequence Insertion

Corrected Sequence Codon Optimization Corrected Sequence Codon Optimization Corrected NCBI Sequence Codon Optimization

Start Codon Annotation Start Codon Annotation Start Codon Annotation

Stop Codon Annotation Stop Codon Annotation Stop Codon Annotation

Promoter BBa_J23106 Insertion Promoter BBa_J23106 Insertion Promoter BBa_J23106 Insertion

RBS Insertion RBS Insertion RBS Insertion

4.2CodingSequenceInsertion 4.2CodingSequenceInsertion Coding Sequence Insertion

4.27xHisTagInsertion 4.27xHisTagInsertion 7x His Tag Insertion

4.2TerminatorBBa_B0015Insertion 4.2TerminatorBBa_B0015Insertion Terminator BBa_B0015 Insertion

Sequence Linear View Sequence Linear View Sequence Linear View

  • Downloaded Sequence FASTA file (via Mac OS TextEdit). See below:

    HQ873313 (codon optimized) TTTACGGCTAGCTCAGTCCTAGGTATAGTGCTAGCCATTAAAGAGGAGAAAGGTACCatgAGCAAAGGAGAAGAACTTT TCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCCGTGGAGAGGGTGA AGGTGATGCTACAAACGGAAAACTCACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCGTGGCCAACACTT GTCACTACTCTGACCTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTTTTTCAAGAGTG CCATGCCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGACCTACAAGACGCGTGCTGAAGTCAA GTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAGGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACAC AAACTCGAGTACAACTTTAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAACTTCA AAATTCGCCACAACGTTGAAGATGGTTCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCC TGTCCTTTTACCAGACAACCATTACCTGTCGACACAATCTGTCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATG GTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAAcgtaaaggcgaggagctgt tcactggtgtcgtccctattctggtggaactggatggtgatgtcaacggtcataagttttccgtgcgtggcgagggtga aggtgacgcaactaatggtaaactgacgctgaagttcatctgtactactggtaaactgccggtaccttggccgactctg gtaacgacgctgacttatggtgttcagtgctttgctcgttatccggaccatatgaagcagcatgacttcttcaagtccg ccatgccggaaggctatgtgcaggaacgcacgatttcctttaaggatgacggcacgtacaaaacgcgtgcggaagtgaa atttgaaggcgataccctggtaaaccgcattgagctgaaaggcattgactttaaagaagacggcaatatcctgggccat aagctggaatacaattttaacagccacaatgtttacatcaccgccgataaacaaaaaaatggcattaaagcgaatttta aaattcgccacaacgtggaggatggcagcgtgcagctggctgatcactaccagcaaaacactccaatcggtgatggtcc tgttctgctgccagacaatcactatctgagcacgcaaagcgttctgtctaaagatccgaacgagaaacgcgatcatatg gttctgctggagttcgtaaccgcagcgggcatcacgcatggtatggatgaactgtacaaatgaCATCACCATCACCATC ATCACtaaCCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTG AACGCTCTCTACTAGAGTCACACTGGCTCACCTTCGGGTGGGCCTTTCTGCGTTTATA

4.3: On Twist, Select the Genes Option

4.3SelectGenes 4.3SelectGenes Selected Genes

4.4: Select the ‘Clonal Genes’ Option

Clonal Genes Selected see results in subsections 4.5 and 4.6 below

4.5: Import your sequence

4.5ImportedSequence_1 4.5ImportedSequence_1 Imported Sequence (Step 1)

4.5ImportedSequence_2 4.5ImportedSequence_2 Imported Sequence (Step 2)

4.6: Choose Your Vector

4.6ChoosingVector 4.6ChoosingVector Chose Vector

4.6DownloadingConstruct 4.6DownloadingConstruct Downloaded Construct

4.6ImportedPlasmid 4.6ImportedPlasmid Imported sequence into Benchling and viewed resulting plasmid

All Section 4 Prompts Listed Below

Supporting PromptSource
Tell me how to add a Promoter to a sequence in BenchlingPerplexity
Found this information from the Registry of Standard Biological Parts: BBa_J23106 Can you break down what this naming convention means and how I can find the relevant Promoter information in a sequence based on this naming convention? Do NOT hallucinate. If you don’t know the answer, say soPerplexity
What is an alignment in Benchling? In Benchling, how do I put a codon optimized sequence under or next to a sequence I originally imported? Do NOT hallucinate when answering this questionPerplexity
How do I replace a sequence in Benchling with a codon-optimized sequence?Perplexity
Bit confused regarding how to find a Promoter in a sequence in Benchling. I tried Auto-Annotate and it doesn’t seem to be working. Where should I go from here?Perplexity
What is an RBS in Benchling?Perplexity
What is a 7x His Tag? What is a Terminator? How do I find these in Benchling? Where are these traditionally inserted into a sequence in Benchling?Perplexity
How do I paste sequences into a Benchling file?Perplexity
How do I know where to insert a Promoter into a given sequence in Benchling?Perplexity
Not totally understanding. If the start codon (the ATG) represents the start of the sequence, how do I insert something before that in Benchling?Perplexity
What is an RBS? Where are they traditionally inserted into a sequence?Perplexity
What do spacers look like in Benchling? Is it literally just empty space with no letters/codons? Something tells?Perplexity
Where is a coding sequence traditionally inserted in a codon optimized sequence in Benchling? If there’s something off in what I’m saying, let me knowPerplexity
Where is a C-terminus in a protein in Benchling?Perplexity
How do I find an amino acid view for a sequence in Benchling?Perplexity
In Benchling, if I’m inserting a 7x His Tag and a Terminator, and I have a stop codon in my sequence, what is the traditional sequence? Is it 7x His Tag, stop codon, Terminator? Something else?Perplexity
Any way I can add a Schema to a sequence after the fact in Benchling?Perplexity

Part 5: DNA Read/Write/Edit

5.1 DNA Read

  • (i) What DNA would you want to sequence (e.g., read) and why?

  • I want to sequence the DNA of the bdelloid rotifer Adineta genus, a microscopic-sized invertebrate that kind of looks like a worm. I’m fascinated by its ability to sustain cryptobiosis for thousands (in the case of a bdelloid rotifer thawed out in Russia in 2015, more than 24,000!!) of years. Transgenesis of the bdelloid rotifer’s cryptobiotic abilities in mammalian organisms could have profound impacts on the future of the species, specifically the ability for groups of homo sapiens or other future sapiens forms to engage in interstellar travel over large durations of time and space. More information on the bdelloid rotifer Adineta genus and its cryptobiotic abilities can be found in the footnote at the end of this sentence 4.

  • (ii) In lecture, a variety of sequencing technologies were mentioned. What technology or technologies would you use to perform sequencing on your DNA and why?

    • I’d use Next-Generation Sequencing (NGS) on my DNA because it’s well-suited for transgenesis. It’s fast, high-resolution, and allows for massively parallel sequencing (if desired). More importantly, it’s highly precise, meaning it can pinpoint transgene locations within a host genome.
  • Is your method first-, second- or third-generation or other? How so?

    • It’s a second-generation sequencing method, as it emerged in the 2000’s after the advent of Sanger sequencing in the 1970’s and before the advent of single-molecule sequencing in the 2010’s.
  • What is your input? How do you prepare your input (e.g. fragmentation, adapter ligation, PCR)? List the essential steps.

    • If the gene exists in an organism, the initial input is extracted genomic DNA from that particular organism. Otherwise, the initial input can be a plasmid (if the DNA’s already cloned) or complementary DNA (cDNA) if only mRNA is available. Essential preparation steps listed below (assuming gene exists in an organism):
      • Isolate or extract the gene; lyse cells or tissues from donor, remove proteins and contaminants
      • Fragment the isolated or extracted gene into fragments of apprxo. ~200-600bp
      • Convert ragged ends into blunt or sticky ends
      • Attach adapter sequences to ends of each fragment
      • Enrich fragments of the intended size (i.e., the size you want), removing any remaining small artifacts and excess adapters
      • Review fragement size distribution
      • Convert double-stranded library into single strands if necessary
      • Load into sequencing instrument
  • What are the essential steps of your chosen sequencing technology, how does it decode the bases of your DNA sample (base calling)?

    • The essential NGS steps are listed below:
      • Preparation (see above)
      • Amplification: Many copies of each DNA fragment are created on flow cells. One end of each fragment sticks to a primer, gets copied to a complementary strand, and bends over to stick to a primer. This bridging repeats nth times, forming amplified (hence the name) clusters of these identical grouped fragments
      • Sequencing: A polymerase enzymes adds 1 colored flourescent nucleotide to each strand in each cluster of grouped fragments. A camera takes a picture of recording the color for the given nucleotide (revealing its A, T, G, or C base) then chemicals are used to wash away any free-floating nucleotides that aren’t part of a given cluster.
      • Base Decoding/Base Calling: A computer analyzes these colored image clusters, assigning each cluster a sequence of bases based on its colors. This analysis then becomes a text string of DNA code, with confidence ratings per base sequence based on the resolution of the read 5
  • What is the output of your chosen sequencing technology?

    • See above. NGS outputs a text string of DNA code, with confidence ratings per base sequence

5.2 DNA Write

  • (i) What DNA would you want to synthesize (e.g., write) and why?)

    • See answer to 5.1 (i). I’m fascinated by the potential of transgenesis of the bdelloid rotifer Adineta’s cryptobiotic abilities for interstellar travel, and therefore, am very interested in reading and editing its sequence.

    NOTE: I found a bdelloid rotifer Adineta sequence in the link in the footnote. However, the raw FASTA information is so long that upon insertion into this webpage, it seemingly broke the webpage, or caused it to freeze up (pardon the unintentional cryptobiosis pun) 6

  • (ii) What technology or technologies would you use to perform this DNA synthesis and why?

    • I’d use PCR amplification, chemical synthesis, and restriction enzymes and ligation to perform this DNA synthesis. I’d use PCR so I can make many copies of the original DNA, I’d use chemical synthesis so I can clone the DNA into a given plasmid, encapsulating the DNA for desired level expression in an appropiate vehicle, and I’d use restriction enzymes and ligation for precise synthesis.
    • What are the essential steps of your chosen sequencing methods?
      • PCR amplification:
        • Denaturation: Heat DNA so it breaks into stingle strands
        • Annealing: Cool the DNA, allowing primers to bind to sites in target gene
        • Extension: DNA polymerase adds nucleotides from the primer starting point, allowing each strand to fully copy
      • Chemical synthesis:
        • Deprotection: Remove protecting DMT group
        • Base Coupling: Add protected phosphoramidite nucleotide for phosphate linkage
        • Capping: Cap the chain to prevent errors
        • Oxidation: Stabilize phosphate triester bonds
      • Restriction enzymes and ligation:
        • Stitch oligos from prior chemical synthesis step into a complete gene for insertion into plasmid
        • Add flanking restriction enzymes at ends of oligos as needed
        • Clean the isolated DNA via gel extract
        • Use matching restriction enzymes to incubate the gene insert and its plasmid vector. This incubation process recognizes specific sequences in the gene insert and cut, creating blunt and sticky ends
        • Use DNA ligase enzyme to mix compatible ends
    • What are the limitations of your sequencing method (if any) in terms of speed, accuracy, scalability?
      • A scalability challenge is that it’s difficult to synthesize a sequence of more than 200nt via direct synthesis methods because at a certain point, too many errors accumulate in the synthesized sequence

5.2 DNA Edit

  • (i) What DNA would you want to edit and why?
    • See answer to 5.1 (i). I’m fascinated by the potential of transgenesis of the bdelloid rotifer Adineta’s cryptobiotic abilities for interstellar travel, and therefore, am very interested in reading and editing its sequence.
  • (ii) What technology or technologies would you use to perform these DNA edits and why?
    • I’d use CRISPR-Cas9 to perform these DNA edits because when performing transgenesis from an invertebrate to a mammalian vertebrate, it allows for non-random, precise insertion of large amounts of genetic data with reduced risk of unintended or off-target effects.
    • How does your technology of choice edit DNA? What are the essential steps?
      • CRISPR-Cas9 edits DNA through a multi-stage mechanism. This mechanism is broken down below:
        • Recognition: A single guide RNA (sgRNA) pairs with a Cas9 protein
        • This pair scans the genome for a 20bp DNA sequence if the sequence is next to a protospacer adjacent motif (PAM)
        • If there is a PAM next to the desired 20bp DNA sequence, the Cas9 makes a dobule-stranded break (DSB)
        • The DSB then triggers repair mechanisms (either non-homolgous end joining [NHEJ] or homology-directed repair [HDR]). These repair mechanisms allow the desired edited DNA to be incorporated into the sequence
    • What preparation do you need to do (e.g. design steps) and what is the input (e.g. DNA template, enzymes, plasmids, primers, guides, cells) for the editing?
      • Preparation:
        • Select target site(s)
        • Design and synthesize gRNA
        • Build DNA donor templates
        • Create mixture of recombinant Cas9 protein and purified gRNA
        • Preapre cells/embryos
      • Inputs to this process are gRNDA,Cas9 protein, donor DNA (usually linear templates), and a delivery vehicle (usually an injection buffer)
    • What are the limitations of your editing methods (if any) in terms of efficiency or precision?
      • HDR can have low efficiency in a transgenesis context
      • Off-target or unintended consequences can still occur
      • Need PAMs near target sequences for precise DSBs

All Section 5 Prompts Listed Below

Supporting PromptSource
Remind me what a digest is in a biotechnological context. I know it has something to do with subdividing DNA sequences into fragments based on enzymes, but there’s some additional information I know I’m missing. Do NOT hallucinate when answering this questionPerplexity
What is horizontal gene transfer? A separate question (perhaps): What is the technical term in biotechnology for transferring the abilities of one organism to another (ex. if I wanted to actually give a lizard the ability to fly like a bird by importing genetic properties that allow for the creation of wings for example)?Perplexity
What is it called in biotechnology when traits from one organism are transferred or conferred to another via an engineered process or processes?Google AI Mode
If I want to perform transgenesis in a biotechnological context (i.e., introduce a foreign gene into a new organism to confer a desired trait), and I want to start this process by sequencing the original foreign gene, what is considered the best practice in modern biotechnology for sequencing this original foreign gene? Is this sequencing method first, second, or third generation in the history of biotechnology? From some other period? What essential steps does it involve and how does it decode the bases of the original foreign gene? What is its output? Do NOT hallucinate when answering these questions. If you don’t know the answer to any of these questions, say soPerplexity
How is Next-Generation Sequencing (NGS) considered second generation? Do NOT hallucinate when answering this questionPerplexity
If I want to perform transgenesis in a biotechnological context (i.e., introduce a foreign gene into a new organism to confer a desired trait), and I want to start this process by sequencing the original foreign gene via Next-Generation Sequencing (NGS), what is my input at the very beginning of the sequencing process? How is that input prepared for sequencing? Do NOT hallucinate when answering these questions. If you don’t know the answer to any of these questions, say soPerplexity
What is cDNA?Perplexity
I have the following information describing and Illumina Next-Generation Sequencing (NGS workflow: –Library Prep: Extract/isolate the gene (PCR amplify if needed), fragment to ~200-500 bp, add adapters/barcodes.–Amplification: Bridge amplification on flow cell creates clusters of identical fragments.–Sequencing: DNA polymerase incorporates fluorescent reversible terminator nucleotides (A/T/G/C); camera captures color/emission per base, cleaving terminator for next cycle.–Imaging/Analysis: Base calling from images, alignment to reference or de novo assembly. Explain the amplification through imaging/analysis steps to me as if I was a reasonably educated 16 year old without an advanced biotechnology background. Tell me what the terms in the amplification through imaging/analysis steps mean. Do NOT hallucinate when addressing this queryPerplexity
What is a polymerase enzyme? Explain this to me as if I was a reasonably educated 16 year old without an advanced biotechnology backgroundPerplexity
Found the following on NCBI: “Uncultured bdelloid rotifer isolate Undet.AN.1.3 cytochrome oxidase subunit I gene, partial cds; mitochondrial"Is that the same as the full bdelloid rotifer genome? Bit confused and am unsure whether or not it isDo NOT hallucinate. If you don’t know the answer to this question, say soGoogle AI Mode
Yes, I’m looking for a complete nuclear genome of a bdelloid rotifer, although I’m not sure which species of bdelloid rotifer I’m looking for. I thought bdelloid rotifer was its own species. Open to having any misconceptions cleared up. If you can provide me links where I can find a complete bdelloid rotifer nuclear genome, that would be greatly appreciatedGoogle AI Mode
Am aware that there was a bdelloid rotifer that came out of long-term cryptobiosis in Russia back in 2015. Any chance we know/you can find the specific species of this rotifer that had this cryptobiotic ability? If so, I’d like the complete nuclear genome for that rotifer speciesGoogle AI Mode
In the answer two prompts ago, there was a mention of “chemicals wash away extras” in the ‘Sequencing by synthesis’ step. What are ’extras’ in this context? Do NOT hallucinate when answering this questionPerplexity
Is the workflow sequence described in the answer to the prompt 2 prompts ago Polymerase Chain Reaction (PCR)? Believe so, but am not surePerplexity
If I want to perform transgenesis and I start by Next-Generation Sequencing (NGS) to read the DNA, what comes after (i.e., what technologies are traditionally used for writing and then editing the DNA or the original organism that has the abilities I want to confer in a host)? Do NOT hallucinate when answering this questionPerplexity
In the answer to the last prompt, can you give me the ‘So What?’ or ‘So What’? behind the ‘Writing the DNA (Gene Preparation & Cloning)’ section from a transgenesis perspective? What do gene synthesis steps like “clone it into a plasmid vector with promoter, terminator, and selection marker.” allow one to do in a transgenesis context? What does restriction enzyme digestion and ligation allow one to do? Do NOT hallucinate. If you don’t know the answers to these questions, say soPerplexity
I have a DNA writing workflow consisting of the following steps:–PCR amplification: Use the sequenced gene info to design primers and amplify the gene from the original source DNA.–Gene synthesis: Chemically synthesize the DNA sequence (especially if optimized for the host), then clone it into a plasmid vector with promoter, terminator, and selection marker.–Restriction enzyme digestion & ligation: Cut the vector and gene insert with enzymes, then join (ligate) them using DNA ligase to create a recombinant plasmidCan you give me the ‘So What?’ or ‘So What’? behind this workflow from the perspective of someone who wants to perform transgenesis from one organism to another? What do gene synthesis steps like “clone it into a plasmid vector with promoter, terminator, and selection marker.” allow one to do in a transgenesis context? What does restriction enzyme digestion and ligation allow one to do?Do NOT hallucinate. If you don’t know the answers to these questions, say soGoogle AI Mode
How does PCR amplification and gene synthesis actually work? What are the essential steps?Perplexity
How does the content in the last prompt related to the Phosphoramidite DNA Synthesis Cycle? Do NOT hallucinate when answering this questionPerplexity
What is a dNTP in genomics?Perplexity
What is a ‘phosphate triester’? Explain this to me in simple terms. Do NOT hallucinatePerplexity
Understanding the phosphoramidite DNA synthesis cycle. How does this transition to the essential steps of restriction enzyme digestion and ligation? Do NOT hallucinate when answering this questionPerplexity
If I want to perform transgenesis from one organism to another in a biotechnological context, particularly if I want to confer a trait from an invertebrate organism to a vertebrate, mammalian organism, what is/are the recommended DNA technology or technologies for accomplishing this task? What are the benefits and drawbacks, and respective workflows of each ot these technologies? Where does CRISPR fit into the mix?Perplexity
Can you elaborate on the CRISPR-Cas9 workflow from the answer to the last prompt, specifically describing how it edits DNA? Can you make a workflow just focused on that? Explain this workflow to me as if I was a reasonably educated person with some (not extensive) biology and biotechnology knowledge. Do NOT hallucinate when answering this queryPerplexity

  1. https://www.uniprot.org/uniprotkb/I3PM87/entry#sequences ↩︎

  2. https://rest.uniprot.org/uniprotkb/I3PM87.fasta ↩︎

  3. https://www.yourgenome.org/theme/what-is-rna-splicing/ ↩︎

  4. Excerpt from “The Great Siberian Thaw” (New Yorker Magazine; 2022-01-17): “Permafrost thaw has brought to the surface all sorts of mysteries from millennia past. In 2015, scientists from a Russian biology institute in Pushchino, a Soviet-era research cluster outside Moscow, extracted a sample of yedoma from a borehole in Yakutia. Back at their lab, they placed the piece of frozen sediment in a sterilized culture box. A month later, a microscopic, wormlike invertebrate known as a bdelloid rotifer was crawling around inside. Radiocarbon dating revealed the rotifer to be twenty-four thousand years old. In August, I drove out to Pushchino, where I was met by Stas Malavin, a researcher at the laboratory. “It’s one thing for a simple bacterium to come back to life after being buried in the permafrost,” he said. “But this creature has intestines, a brain, nervous cells, reproductive organs. We’re clearly dealing with a higher order.” The rotifer had survived the intervening years in a state of “cryptobiosis,” Malavin explained, “a kind of hidden life, where metabolism effectively slows down to zero.” The animal emerged from this geological “time machine,” as he put it, not just alive but able to reproduce. A rotifer lives for only a few weeks, but replicates itself multiple times through parthenogenesis, a type of asexual reproduction. Malavin removed from the lab fridge a direct descendant of the rotifer that had crawled out of the permafrost and placed it under a microscope. An oval-shaped plankton squirmed around; I imagined this blob, two-tenths of a millimetre in size, as a nervous explorer who awoke to find itself in a strange and unexpected future. “Why be modest?” Malavin asked. Unlocking the secret of how an animal with a complex anatomy was able to shut down for tens of thousands of years and then turn itself back on might, for example, offer hints for using cryogenic conditions to store organs for donation. Neuroscientists at M.I.T. have been in touch. “I’m obviously not saying our findings will lead to people being put into long-term cryogenic slumber tomorrow,” Malavin said. “But it’s a step in that direction.”” ↩︎

  5. I think this might mean the resolution of the image of the cluster ↩︎

  6. https://www.ncbi.nlm.nih.gov/datasets/genome/GCA_021613535.1/ ↩︎

Week 3 HW: Lab Automation

PowerofLabAutomation PowerofLabAutomation

The Power of Lab Automation

Assignment: Python Script for Opentrons Artwork

  • 0: Attended this week’s recitation and reviewed the lab information on programming Opentrons
  • 1: Generated an artistic design using Ronan’s Opentrons GUI 1
  • 2: Artistic Design Python Script: See script in URL below:
  • 3: Listing my sfgfp point coordinates from Ronan’s Opentrons GUI below (the shape is a rightward-facing green arrow):
    • [(6.6,11), (8.8,11), (11,11), (8.8,8.8), (11,8.8), (13.2,8.8), (11,6.6), (13.2,6.6), (15.4,6.6), (13.2,4.4), (15.4,4.4), (17.6,4.4), (15.4,2.2), (17.6,2.2), (19.8,2.2), (17.6,0), (19.8,0), (22,0), (-22,-2.2), (-19.8,-2.2), (-17.6,-2.2), (-15.4,-2.2), (-13.2,-2.2), (-11,-2.2), (-8.8,-2.2), (-6.6,-2.2), (-4.4,-2.2), (-2.2,-2.2), (0,-2.2), (2.2,-2.2), (4.4,-2.2), (6.6,-2.2), (8.8,-2.2), (11,-2.2), (13.2,-2.2), (15.4,-2.2), (17.6,-2.2), (19.8,-2.2), (22,-2.2), (24.2,-2.2), (-22,-4.4), (-19.8,-4.4), (-17.6,-4.4), (-15.4,-4.4), (-13.2,-4.4), (-11,-4.4), (-8.8,-4.4), (-6.6,-4.4), (-4.4,-4.4), (-2.2,-4.4), (0,-4.4), (2.2,-4.4), (4.4,-4.4), (6.6,-4.4), (8.8,-4.4), (11,-4.4), (13.2,-4.4), (15.4,-4.4), (17.6,-4.4), (19.8,-4.4), (22,-4.4), (24.2,-4.4), (26.4,-4.4), (-22,-6.6), (-19.8,-6.6), (-17.6,-6.6), (-15.4,-6.6), (-13.2,-6.6), (-11,-6.6), (-8.8,-6.6), (-6.6,-6.6), (-4.4,-6.6), (-2.2,-6.6), (0,-6.6), (2.2,-6.6), (4.4,-6.6), (6.6,-6.6), (8.8,-6.6), (11,-6.6), (13.2,-6.6), (15.4,-6.6), (17.6,-6.6), (19.8,-6.6), (22,-6.6), (24.2,-6.6), (17.6,-8.8), (19.8,-8.8), (22,-8.8), (15.4,-11), (17.6,-11), (19.8,-11), (13.2,-13.2), (15.4,-13.2), (17.6,-13.2), (11,-15.4), (13.2,-15.4), (15.4,-15.4), (8.8,-17.6), (11,-17.6), (13.2,-17.6), (6.6,-19.8), (8.8,-19.8), (11,-19.8)]

  • 4: Used Gemini 2.5 Flash (built into Google Colab) to assist with completing the coding portion of the homework. I have some rough Python knowledge via a Codecademy course, which helped get things started (i.e., I did do some of the coding for this assignment).

All Gemini 2.5 Flash prompts are listed below:

Supporting PromptModel
I want to create some code similar to the code in Examples 1-7. What are the core elements of the code I need to create?Gemini 2.5 Flash
Been working on some code in the ‘Your Code’ module. Have made a single green dot so far. Looking to create a rightward-facing green arrow based on these coordinates in the attached .py file Tell me how the code in the ‘Your Code’ module under the #Aspirate subsection needs to be edited to output the rightward facing green arrow in the attached .py fileGemini 2.5 Flash
Wondering if you could help explain something. Not seeing an actual visualization of a green arrow below. Where is it? Can you give me a picture output of the code similar to the picture output located in the examples in this URL below? https://colab.research.google.com/drive/1VoouRH0nqlk09g50rHxOElaLD-SVknYY#scrollTo=PsOgJ2DndZztGemini 2.5 Flash
Ensure the ‘run’ function executes all arrow_pointsGemini 2.5 Flash
Still getting a single green dot when I run the simulator. Have inputted the coordinates for the rightward-facing green arrow based on the attached file and am aware this will need to likely need a for loop to aspirate the colors.Gemini 2.5 Flash
Still getting a single green dot when I run the simulator. Have inputted the coordinates for the rightward-facing green arrow based on the attached file and am aware this will need to likely need a for loop to aspirate the colors. Recommendations on how to proceed?Gemini 2.5 Flash
Explain why only 1uL was dispensed instead of 20uLGemini 2.5 Flash
Looking at the code and see that I inputted the points for the rightward-facing arrow under arrow_points. Not understanding what parts of the code need to be changed (if any) so that when the simulation runs, a rightward-facing green arrow is outputtedGemini 2.5 Flash
Thank you. Can you please tell me where cell “pczDLwsq64mk” is located, so I can have an idea of the code used to create the rightward-facing arrow in the simulation?Gemini 2.5 Flash
  • 5: Coordinating robot time slot with William & Mary node
  • 6: Submitted Python file via assignment form (see screenshot below):

PythonFormSubmissionScreenshot PythonFormSubmissionScreenshot Python Form Submission Confirmation Screenshot

Post-Lab Questions

  • Find and describe a published paper that utilizes the Opentrons or an automation tool to achieve novel biological applications.

    • The paper An Automated Versatile Diagnostic Workflow for Infectious Disease Detection in Low-Resource Settings was published in the journal Micromachines in 2024 and describes using simple Commercial Off-the-Shelf (COTS) reagents and lab equipment, along with an Opentrons robot, to create an automated workflow for detecting diseases in low-resource settings 2. What’s interesting about the paper is that the workflow the researchers designed reduced the time for detecting a pathogen (in this case meningitis) by approx. 18% (total timne of 118 min.) with an almost 5.8x reduction in cost for sample processing 3. The total cost of to run 8 samples for meningitis detection was approx. $126 USD, a cost savings that matters in a low-resourced environments. The findings and extension of this paper’s workflow shows promise for decentralized disease detection in low-resource settings during future health security incidents. Except for opening and closing of tube lids, the following four steps of the autonated workflow were completed by the Opentrons robot:
      • DNA isolation with Dynabeads
        • Sample incubation
        • Washing step
        • DNA resuspension
      • DNA amplification
        • Recombinase Polymerase Amplification (RPA) mix preparatoon
        • RPA amplification
      • DNA digestion
        • Exonuclease digestion
      • DNA dtection
        • Preparation of Vertical Flow Microarray (VFM) solutions
        • Addition of samples to VFM
        • Signal enhancement

    Associated AI prompts to address this question included below:

Supporting PromptModel
Can you find me biotechnology related papers from the past 5 years (ideally from Western sources) that incorporate Opentrons or another lab automation tool to create or research a novel biosecurity applicationGoogle Scholar Labs
Give me a rundown of what primers are in genomics in simple terms (don’t get overly technical, if possible). Explain this to me as if I was a reasonably educated 15 year-old. Tell me if primers are found in nature or if they’re an artificial construct. Tell me how primers are used in biotechnology Do NOT hallucinate when answering this queryPerplexity
In a gene amplification context, what does vortexing mean?Perplexity
What are amplicons?Perplexity
What is a ctrA gene?Perplexity
What is a reagent in a diagnostic or biotechnology context?Perplexity
  • Write a description about what you intend to do with automation tools for your final project.
    • Phage isolation experiments generally require enriching bacterial strains, filtering out bacterial particles, pouring the phage-containing mixture in with fresh bacteria on agar, plating and re-plating phage plaques (areas of phage propagation and bacetrial destruction on agar), and characterizing the resulting phage plaques on the agar. My working thoughts are that I might actually be able to create a somewhat automated workflow a-la the paper referenced in the previous question to help with the filteration through characterization steps of a phage isolation experiment. This might involve using an Opentrons robot and COTS equipment to:
      • Handle bacterial liquids
      • (Maybe) use an Opentrons module to shake bacterial liquids and reagents
      • Operate centrifuge for spinning bacteria
      • Pour agar with phage plaques
      • Operate micropipettes for phage testing
      • Operate Thermocycler module for amplifying specific lysed areas
      • Rapidly run software to characterize novel phage DNA

Note: The maeterial above is not set in stone. It’s an outline of potential automation options for a potential final project (Space (LEO and beyond) or Suborbital Phage Isolation)

Associated AI prompts to address this question included below:

Supporting PromptModel
What do phage isolation experiments usually entail? Are any elements of phage isolation experiments dangerous to human health and safety, and if so, why?Perplexity
Take the steps in the “What phage isolation usually involves” section of the last prompt and break down the tools traditionally used for each step. Do NOT hallucinate when answering this questionPerplexity
What is supernatant?Perplexity
What are plaques in a phage isolation experiment context?Perplexity
What does it mean to ‘pellet’ bacteria?Perplexity

Final Project Ideas

  • Submitted 3 Final Project ideas in my node’s section of the slide deck (see screenshot below):
FinalProjectIdeaSubmissionConfirmation FinalProjectIdeaSubmissionConfirmation

All supporting prompts for Final Project Ideas Slide listed below

Supporting PromptModel
What is the microbiome? It’s the gut right? If I’m oversimplifying with the second question, let me know Do NOT hallucinate when answering these questionsPerplexity
Does a biotechnological equivalent of ‘Build Your Own Phage’ a-la Build a Bear or Lego exist in the real world? If so, does this capability exist in a personalized medicine context, or is it operable in remote environments? Do NOT hallucinate when answering this questionPerplexity
Tell me about the adenita vaga bdelloid rotifer that was able to maintain cryptobiosis for 24,000 yearsGoogle AI Mode
Tell me about the adenita vaga bdelloid rotifer that went into cryptobiosis for 24,000 yearsGoogle AI Mode
Thinking about creating some sort of  real-time personalized medicine biological monitoring capability allowing phages to be identified, created, and disseminated for nascent infections. Create some type of logo image for this concept (the kind you might find on a sticker) that combines the elements of a phage and a time-keeping watch. Let’s not have it be too cartoony or effused with excessive colorGemini
Nice. Change the writing on the top to PhageWatch as opposed to PhageGuardGemini

  1. https://opentrons-art.rcdonovan.com ↩︎

  2. https://www.mdpi.com/2072-666X/15/6/708#Introduction ↩︎

  3. This is for running samples through the workflow not for equipment like the Opentrons OT-One-Hood ↩︎

Week 4 HW: Protein Design Part 1

Part A: Conceptual Questions

  1. Where did amino acids come from before enzymes that make them, and before life started?
    • Amino acids come from metabolic molecules within the cell. These metabolic molecules consist of carbon atom chemical backbone, inorganic nitrogen, and enzyme-facilitated chemical reactions. Before life as we know it started, amino acids originated from abiotic (not from living organisms) chemical reactions on Earth before the emergence of life as we know it. The chemical reactions occurred in the atmosphere, hydrothermal and oceanic vents, and via meteorite and comet (i.e., extraterrestrial) delivery

Supporting prompts for this section listed below:

Supporting PromptModel
Amino acids are produced by enzymes, correct? DO NOT hallucinate when answering this questionPerplexity
So based on the answer to the last prompt, where exactly do amino acids come from? Where exactly do they originate? DO NOT hallucinate when answering this questionPerplexity
When we say ’enzyme‑catalyzed pathway’ we mean a chemical reaction that an enzyme speeds up, correct? Do NOT hallucinate when answering this questionPerplexity
What is an enzyme pathway in the context converting a precursor into an amino acid? Is it simply a chemical reaction? Something else? Do NOT hallucinate when answering this questionPerplexity
In the answer 3 prompts ago, there was mention of “Carbon Skeleton” and “Intermediates of glycolysis, the citric acid (TCA) cycle, and the pentose phosphate pathway” when describing them. What does this mean in simple terms? Are we saying these provide the chemical structure of an amino acid to keep it fundamentally sound? Do NOT hallucinate when answering these questionsPerplexity
Ok. Based on available literature and if relevant/necessary, the information shared in response to the previous prompts, how did amino acids originate before the emergence of life as we know it on this planet? Was it via chemical process in cyanobacteria or another form of bacteria or archaea? Do NOT hallucinate when answering these questionsPerplexity

Part B: Protein Analysis and Visualization

  • I selected the beta-keratin 2 protein found in geckos, mainly because geckos seem really cool and I’m interested in the biomemetic properties of this protein for space-tolerant adhesives (gecko glues). The raw protein sequence is below:

    ABU98593.1 beta-keratin 2 [Gekko gecko] MAYCGPSFAIPSCASAPAIGFGSAGLGYGGYGGLHSGSIIGSGSPSFAIPSVASSPAVGFGSASFGHNSG VSSTSLGVLSGVNPSCINQIPPAEVLIQPPPSVVTLPGPILSATGEPVSVGGNTPCAVSYGGPGRVISGG SFGSLGGRLGSFGSGRRGSLILGRRGSFSNCYSPCN

  • LOREM IPSUM *

Part C: Using ML-Based Protein Design Tools

Part D: Group Brainstorm on Bacteriophage Engineering