Projects

Final projects:

  • The original glorious space phage (still with artistic license lol) Individual Final Project Idea: Space Phage Supreme Section 1: Abstract Phage therapy’s potential to treat novel bacterial infections has generated increased attention in recent years, terrestrially and in space health research. Recent research from University of Wisconsin Madison demonstrated the unique impacts of microgravity on Escherichia coli bacteria and T7 bacteriophage interactions, particularly on the distribution of genetic mutations across the T7 bacteriophage genome 1. Understanding unique microgravity-derived insights on bacteriophage mutations and bacteriophage bacterial interactions could yield phage therapeutic insights terrestrially and for future space travelers. Accordingly, this research aims to extend the University of Wisconsin, Madison’s research by validating if/how E. coli strain microgravity bacteriophage Gene 17 mutated Variants demonstrate increased fitness across different E. coli bacteria strains (CFT073, UTI89, MG1655). The working hypothesis of this research is that Variants will exhibit similar increased Plauqe-Forming Units/milliliter (PFU/mL) (i.e., they will exhibit increased fitness and lsying). To implement this research, the plan is to:
  • Bacteriophage Engineering Group Project Inputs_William & Mary Node Group 1 2 Group Project_Protein Design 1 Selected Goal: Increased stability (easiest) Brainstorm Session Questions: Which tools/approaches from recitation you propose using (e.g., “Use Protein Language Models to do in silico mutagenesis, then AlphaFold-Multimer to check complexes.”) We’ll attempt to run multi-environment/conditional modeling and simulation to down-select lysis stability approaches that show the greatest resilience across environments/conditions. The team has selected a project focused on enhancing the stability of the Lysis Protein, a decision influenced by the group’s current experience level. The primary objective is to improve thermodynamic stability while concurrently preserving the native protein fold and maintaining functional integrity. The proposed methodology involves utilizing BLAST for identifying homologous sequences, followed by Clustal Omega to ascertain conserved residues susceptible to mutation intolerance. Subsequently, ESM2 will be employed to score candidate substitutions based on evolutionary plausibility. This will be succeeded by the application of ESM-Fold to predict and refine the integrity of the protein fold, as well as to optimize existing backbones. The results may then be further subjected to EvolvePro for accelerated directed evolution. Tools like Boltz-1 and ProteinMPNN offer a capability for redesigning solvent-exposed residues and optimizing the core packing of the protein. We can cross their performance for comparison. All selected variant candidates are slated for computational stress-testing under a range of environmental conditions that could potentially induce destabilization. Selected variant candidates that pass the stress test are prioritized for downstream experimental validation. Why do you think those tools might help solve your chosen sub-problem? The previous bullet point addresses tool functionality in our workflow, explaining why and how various tools will assist us in accomplishing our goal Name one or two potential pitfalls (e.g., “We lack enough training data on phage–bacteria interactions.”). One potential pitfall is that we may have insufficient in vitro quality and quantity of data to test the environmental constraints of interest. Thus wet-lab work would be needed to back-up the findings, in addition to follow-up There are open questions regarding the validity of the stated research approach (i.e., if the approach makes sense relative to the larger goal of increased stability) Include a schematic of your pipeline See workflow schematic below Group Project_Protein Design 2 3 See results below

Subsections of Projects

Individual Final Project

Gemini_Generated_Image_axxs6waxxs6waxxs-4 Gemini_Generated_Image_axxs6waxxs6waxxs-4

The original glorious space phage (still with artistic license lol)

Individual Final Project

Idea: Space Phage Supreme

Section 1: Abstract

  • Phage therapy’s potential to treat novel bacterial infections has generated increased attention in recent years, terrestrially and in space health research. Recent research from University of Wisconsin Madison demonstrated the unique impacts of microgravity on Escherichia coli bacteria and T7 bacteriophage interactions, particularly on the distribution of genetic mutations across the T7 bacteriophage genome 1. Understanding unique microgravity-derived insights on bacteriophage mutations and bacteriophage bacterial interactions could yield phage therapeutic insights terrestrially and for future space travelers. Accordingly, this research aims to extend the University of Wisconsin, Madison’s research by validating if/how E. coli strain microgravity bacteriophage Gene 17 mutated Variants demonstrate increased fitness across different E. coli bacteria strains (CFT073, UTI89, MG1655). The working hypothesis of this research is that Variants will exhibit similar increased Plauqe-Forming Units/milliliter (PFU/mL) (i.e., they will exhibit increased fitness and lsying).

To implement this research, the plan is to:

  • Perform plaque-forming assay bacteriophage fitness protocol, with both dry and wet lab components
  • Test Variants 1 and 2 from the University of Wissconsin, Madison paper against CFT073, UTI89, and MG1655 E. coli bacteria strains

The methods for achieving the specific aims referenced above include:

  • Dry Lab Gibson Assembly Construct Creaetion
  • Wet Lab PCR
  • Wet Lab DNA Purification and Quantification
  • Wet Lab Gibson Assembly
  • Wet Lab Phage Reboot
  • Wet Lab Plaque Assay
  • Dry Lab PFU/mL Calculation

Section 2: Project Aims:

  • Aim 1 (Experimental Aim): Validate if/how E. coli BL21 strain microgravity bacteriophage Gene 17 mutated Variants demonstrate increased fitness (PFU/mL) across different E. coli strains (CFT073, UTI89, MG1655)

  • Aim 2 (Developmental Aim): Follow-on experiments showcasing comparable mutations across additional E. coli strains, with the aim of discerning which microgravity bacteriophage mutations can instigate positive terrestrial human health outcomes (specifically improved PFU/mL)

  • Aim 3 (Visionary Aim): ‘Plug and play’ (ideally bidirectional [terrestrial and space-based]) catalog of microgravity-derived high-fitness bacteriophages for use against nth forms of bacterial infection

Section 3: Background:

  • Briefly summarize two-peer reviewed research citations relevant to your research
    • In ‘Microgravity reshapes bacteriophage–host coevolution aboard the International Space Station’ University of Wiconsin Madison researchers reported on the dynamics between a T7 bacteriophage and E. Coli after microgravity exposure aboard the International Space Station (ISS) 2. Their results indicated delayed phage activity, but ultimately the emergence of several novel mutations across the bacteriophage, which when replicated terrestrially, improved lysing. In ‘Impact of simulated microgravity in short-term evolution of an RNA bacteriophage’ researchers from the Centro de Astrobiología and Universidad Autónoma de Madrid also discovered similar delayed phage activity when RNA bacteriophage was exposed to a terrestrial simulated microgravity environment 3. Both studies indicate novel phage activity due to microgravity exposure.
  • Explain how your project is novel or innovative
    • My project seeks to extend learnings on bacteriophage microgravity exposure to determine how microgravity-derived phage mutations can proactively apply to improve terrestrial phage fitness (including but not limited to lysing). If successful, this project will help demonstrate the utility of microgravity in terrestrial phage therapy development. If successful, it might also help create a bidirectional virtuous cycle between microgravity-derived insights, terrestrial phage therapy, and non-terrestrial phage therapies for long-duration space missions
  • Explain why your project matters and what impact it could have
    • This project attempts to solve the problem of proactively improving phage fitness. Improving phage fitness matters as it’s crucial to making phage therapies a viable alternative to traditional antibiotics, particularly in remote, resource-constrained environments like a long-term space exploration mission. Creating the bidirectional virtuous cycle referred to in the answer to the previous question could advance public health and wellbeing in several ways. It could combat antimicrobial resistant (AMR) bacteria while giving humanity a means of dealing with space-based infections when nth volumes of antibiotics or standard pharmaceuticals may be in short supply or logistically unfeasible to transport. In helping bidirectional virtuous cycle, this research will advance our knowledge of customizing terrestrial bacteriophage for improved fitness based on microgravity-derived insights
  • Describe the ethical implications associated with your project and identify relevant ethical principles (i.e., non-maleficence, beneficence, justice, or responsibility)
    • Improving phage fitness might have unintended consequences, as significantly fit phage could lyse bacteria that are important to function of human microbiomes. Therefore, this project intends to follow the principle of non-maleficence. In practice this means our research will be conducted in low-biosafety (BSL) environments on M. smegma and will focus on improving phage fitness to combat AMR bacteria. This research will also uphold the principle of beneficence by making the results of our research publicly available. The measures taken to ensure this project aligns with ethical principles are mentioned in passing in the previous paragraph and elaborated upon here. The research will be conducted in low-BSL settings, and its results will be made publicly available. Any/all researchers associated with this project will comport with all appropriate statutes in maintaining lab safety at all times. While there could be unintended consequences of publicly sharing this research, any/all researchers associated with this project will share what is strictly necessary within the scope of this project’s research aims. Any/all discussion of using bacteriophages to deliberately alter human microbiomes for adverse health outcomes will not occur.

Section 4: Experimental Design, Techniques, Tools, and Technology

  • Create a detailed experimental plan for your final project. Include a timeline for each part of your experimental plan (i.e., how long you expect each step in your final project to take)

The following protocol describes the complete experimental workflow as a planned dry and wet lab procedure grounded in the computational designs completed in Benchling. The project is currently dry lab; steps below represent the intended comprehensive execution plan.

This is a planned protocol. Steps 1 and 2 (computational) are completed; Steps 3 onward describe the intended wet-lab execution.


Step 1: (Computational) Mutation Design
FieldDetail
MethodMutations modeled in Benchling by editing the gp17 CDS within pET-28a; codon optimization for BL21 verified in silico
AutomationNot applicable (computational step)
PlateNot applicable
Expected ResultTwo annotated plasmid maps (pET-28a-gp17-V1 and pET-28a-gp17-V2) with confirmed reading frames and no premature stop codons
TimelineCompleted prior to proposal submission

Step 2: (Computational) Gibson Assembly
FieldDetail
MethodUse Benchling Gibson Assembly feature to create primers and constructs for V1 and V2 against an E. coli backbone (Accession: V01146.1)
AutomationNot applicable (computational step)
PlateNot applicable
Expected ResultTwo annotated V1 and V2 Gibson Assembly constructs and primers (includes adequate bp and overhang) for amplification
TimelineCompleted prior to proposal submission

Step 3: Order DNA from Twist
FieldDetail
MethodExport Benchling plasmid sequences as GenBank files; submit “Gibson Assembly_05.02.26 [Variant 1 Fragment]” and “Gibson Assembly_05.02.26 [Variant 2 Fragment]” constructs (these constructs include primers) to Twist Bioscience as whole plasmid synthesis orders; screen all sequences through SecureDNA prior to submission
AutomationNot applicable (vendor synthesis)
PlateDNA delivered in standard Twist 96-well format
Expected ResultSequence-verified plasmid DNA confirmed by Twist Sanger sequencing report; >20 ng/µl
Timeline10–14 business days after order submission

Step 4: Sequence Verification by Sanger Sequencing
FieldDetail
MethodDesign primers flanking gp17 insert (T7 promoter and terminator primers); submit to Azenta/Genewiz; align to Benchling reference via SnapGene or NCBI BLAST
AutomationEcho 525 for primer and template dispensing
Plate96-Armadillo-PCR-AB2396X
Expected Result100% sequence identity to designed constructs at all mutated positions
Timeline2–3 days

Step 5: PCR
FieldDetail
MethodPick 4–8 colonies per construct; PCR (complete denature, annealing, and extension steps) V1 and V2 primers; resolve on 1% agarose gel
AutomationATC Thermal Cycler for PCR
Plate96-Armadillo-PCR-AB2396X
Expected ResultCorrect band size in 3 of 4 colonies per construct
Timeline4–5 hours

Step 6: DpnI Digest
FieldDetail
MethodDpnI cuts DNA when GATC in original template sequence is methylated; reaction should occur at approx. 37 °C
AutomationATC Thermal Cycler
Plate96-Armadillo-PCR-AB2396X
Expected ResultOriginal template digested by DpnI, with amplified V1 and V2 PCR fragments preserved
Timeline30–60 minutes

Step 7: DNA Purification and Quantification

Method:

Per PCR reaction:

  1. Add PCR product and DNA Binding Buffer to microcentrifuge tube. Mix by vortexing.
  2. Transfer 300 mL/mixture into separate spin columns with collection tube. Centrifuge for 1 min.
  3. Discard flow-through liquid and add DNA Wash Buffer to the column. Centrifuge for 1 min. (do this twice).
  4. Transfer column to new tube. Discard flow-through and throw away collection tube.
  5. Add 6 µl of DNase/RNase-free water or Elution Buffer directly to the column.
  6. Sit at room temperature for 2 min. Centrifuge for another min.
FieldDetail
AutomationZymo-Spin Column
Plate96-Armadillo-PCR-AB2396X
Expected ResultPurified solution ready for analysis in Step 9
Timeline4–10 min. per PCR reaction

Step 8: DNA Purification and Quantification Results Analysis
FieldDetail
MethodMeasure DNA concentrations from Step 8 using spectrophotometer (e.g., Nanodrop). Clean stage, add elution buffer, dry stage, add 2 µl per DNA sample and record concentration accordingly
AutomationNot applicable
PlateNot applicable
Expected Result~70 µg/mL concentrations; 0.5–1.0 pmoles of DNA for next step
Timeline10–15 min.

Step 9: (Wet Lab) Gibson Assembly
FieldDetail
MethodStart Gibson Assembly reaction at appropriate concentrations4 on ice. Incubate reaction at 50 °C on heat block. Post-incubation, add nuclease-free water for dilution
AutomationLiquid-handling robot (optional)
Plate96-Armadillo-PCR-AB2396X
Expected ResultConstructed V1 and V2 mutations introduced into standard expression backbone; 0.5–1.0 pmoles
Timeline15 min. setup, 30–60 min. incubation

Step 10: Cell-Free Phage Reboot
FieldDetail
MethodUse transcription-translation (TX/TL) cell-free mix (e.g., Arbor Biosciences myTXTL) to induce reaction at appropriate concentrations in 1.5–2 mL tube5. Incubate resulting mixture overnight at 29 °C
AutomationLiquid-handling robot (optional)
PlateStandard agar plates
Expected ResultPhage lysates with V1 and V2 variants
Timeline1 day total

Step 11: Plaque Assay Setup
FieldDetail
MethodGrow 3 batches of each tested E. coli strain (CFT073, UTI89, MG1655) to log phase in lysogeny broth (LB). Take portion of V1 and V2 phage lysates, along with wild-type T7 bacteriophage, and distribute onto each E. coli strain. There should be 3 V1 and V2 phage lysates and 3 wild-type T7 bacteriophage lysates distributed upon completion of this step. Make ten-fold serial dilutions of resulting phage stock
AutomationEcho 525 for serial dilution dispense
PlateStandard agar plates
Expected ResultPlaques formed on CFT073, UTI89, MG1655 E. coli strains; ~10⁷ PFU
Timeline18–24 hours

Step 12: Data Analysis — Calculate PFU/mL and Graph Results
FieldDetail
MethodChoose plates with countable number of plaques. Count plaques present on each plate6. Photograph plates to document plaque morphology. Run Analysis of Variance (ANOVA)7 to determine statistical significance between variant and wild-type results
AutomationSoftware like OnePetri or ViralPlaque can be used (optional)
PlateStandard agar plates
Expected ResultPFU/mL readouts per tested strain showing lysing across V1, V2, and wild-type T7 bacteriophage. This readout will be a bar graph with three groups on the X-axis (one per E. coli strain), each group containing three bars (WT, V1, V2), with PFU/mL on the Y-axis and error bars showing variability across replicates; 10⁻⁴ to 10⁻⁸ serial dilutions
Timeline1–2 days (includes all later steps)

Step 13: Plaque Assay Control Cross-Check
ControlWhat It TestsExpected Result
WT gp17 + MG1655Positive control — confirms functional assayPlaques present
No phage (any tested E. coli strain)Negative control — confirms no false positivesNo plaques
Empty vector (no gp17) + any strainConfirms gp17 specifically drives infectivityNo plaques

Step 14: Validation Against Benchmark
FieldDetail
MethodMeasure PFU/mL for MG1655 strain
AutomationSoftware like OnePetri or ViralPlaque can be used (optional)
PlateStandard agar plates
Expected ResultIdeally, we will see V1 and V2 values similar to MG1655, with gains for CFT073 and UTI89 strains
TimelineSee Step 13

  • We discussed and practiced various techniques related to synthetic biology throughout the semester. Place a check next to the techniques relevant to your project.

    • Pipetting
      • Pipetting
      • Lab Safety
      • Bioethical Considerations
    • DNA Gel Art
      • DNA Sequencing
      • DNA Editing
      • DNA Construct Design
      • Databases (e.g., Genbank, NCBI, Enzembl, and UCSC Genome Browser
    • Lab Automation
      • Using Liquid Handling Robots (e.g., Opentrons) [Optional]
      • Designing a Twist Order
      • Creating a plan to use the Autonomous lab at Ginkgo Bioworks [Discussed–Tentative]
    • Protein Design
      • Use of Benchling
      • Models and Notebooks
      • Databases
    • Bioproduction
      • Plasmid Preparation
      • Bacterial Culturing
      • Quality Control/Analysis
      • Bacterial Processing (e.g., Centrifugation, Lysis, DNA Purification)
    • Cell-Free Systems
      • Cell Free Reactions
    • Gibson Assembly
      • Primer Design or Selection
      • PCR Reactions
      • Gibson Assembly
  • Expand upon two techniques you checked in the previous question by describing how you would utilize those techniques in your final project.

    • I utilized DNA Construct Design when designing two Gibson Assembly Constructs in Benchling. I re-created the Gene 17 mutations for the respective Variants 1 and 2 from the University of Wisconsin, Madison paper and then placed them within a T7 E. coli backbone (Accession: V01146.1) in Benchling using the Gibson Assembly feature. This informs the later Primer Design or Selection technique listed above, because the dry lab Variant 1 and 2 primers designed as part of this dry lab Gibson Assembly Construct inform the the wet lab Gibson Assembly step of the previously listed protocol above. They do this by defining how the Gene 17 coding sequence (CDS) should ideally express itself against the T7 backbone. This in turn helps set the stage for the rebooting the E. coli bacteriophages and helping us measure lysing (PFU/mL), at the end of the protocol (this ties into the Bacterial Processing (e.g., Centrifugation, Lysis, DNA Purification) technique listed above).
  • Identify any How to Grow (Almost) Anything Industry Council companies which are associated with your final project

    • Cultivarium (conceptual alignment), Ginkgo Bioworks (tentative), Opentrons (optional), Twist Biosciences

Section 5: Results & Quantitative Expectations

  • You are required to validate at least one aspect of your final project aims. This is to ensure that you are able to successfully apply a relevant synthetic biology technique to your project. Include figures if you have them – accuracy is critical in figures, tables, and graphs

    • What aspect of your final project did you choose to validate?

      • I chose to validate PFU/mL results
    • Write down a detailed protocol of how you validated this aspect of your final project

      • See detailed protocol steps below (copied from protocol above):
        • Step 12: Data Analysis — Calculate PFU/mL and Graph Results
          FieldDetail
          MethodChoose plates with countable number of plaques. Count plaques present on each plate6. Photograph plates to document plaque morphology. Run Analysis of Variance (ANOVA)7 to determine statistical significance between variant and wild-type results
          AutomationSoftware like OnePetri or ViralPlaque can be used (optional)
          PlateStandard agar plates
          Expected ResultPFU/mL readouts per tested strain showing lysing across V1, V2, and wild-type T7 bacteriophage. This readout will be a bar graph with three groups on the X-axis (one per E. coli strain), each group containing three bars (WT, V1, V2), with PFU/mL on the Y-axis and error bars showing variability across replicates; 10⁻⁴ to 10⁻⁸ serial dilutions
          Timeline1–2 days (includes all later steps)
        • Step 13: Plaque Assay Control Cross-Check
          ControlWhat It TestsExpected Result
          WT gp17 + MG1655Positive control — confirms functional assayPlaques present
          No phage (any tested E. coli strain)Negative control — confirms no false positivesNo plaques
          Empty vector (no gp17) + any strainConfirms gp17 specifically drives infectivityNo plaques
        • Step 14: Validation Against Benchmark
          FieldDetail
          MethodMeasure PFU/mL for MG1655 strain
          AutomationSoftware like OnePetri or ViralPlaque can be used (optional)
          PlateStandard agar plates
          Expected ResultIdeally, we will see V1 and V2 values similar to MG1655, with gains for CFT073 and UTI89 strains
          TimelineSee Step 13
    • What synthetic biology techniques did you utilize in validating this aspect of your final project?

      • This validation step is predicated upon Bacterial Processing (e.g., Centrifugation, Lysis, DNA Purification), followed by Quality Control/Analysis. Bacterial processing is necessary for experimental validation because without appropriate rebooting the phage and performing a plaque assay against the E coli. bacterial strains, we cannot measure PFU/mL. From there, we are perfoming a form of quality control/analysis inasmuch as we are cross-checking our experimental PFU/mL results against our stated hypothesis. In the case of this project and its protocol, we are cross-checking our experimental PFU/mL results by choosing plates with countable number of plaques, counting plaques present on each plate, photographing plates to document plaque morphology, and running Analysis of Variance (ANOVA) to determine statistical significance between variant and wild-type results, with the hope and/or expectation our Variants will outperform the wild-type against the uropathogenic strains (i.e., demonstrate increased PFU/mL relative to the wild-type against strains CFT073 and UTI89 respectively).
    • You must present data as part of your final project and include some analysis of that data. The data may be collected experimentally in the lab or generated as simulated simulated (e.g., using Asimov Kernal or another simulation method)

      • pfu_ml_chart pfu_ml_chart
      • The chart above shows desired hypothetical PFU/mL results. The wild-type T7 (the control) is expected to perform well against the MG1655 (K-12), relative to the microgravity-derived Variants, due to native adaptation. However its performance (i.e., its PFU/mL) plummets relative to the CFT073 and UTI89 uropathogenic strains, while the Variants exhibit higher comparative fitness (PFU/mL) due to greater hydrophobica optimization and greater ability to pierce the bacterial O-antigen shield via multiple microgravity-derived amino acid mutations.
  • Did you encounter any unexpected challenge(s) when performing your validation? If so, describe the challenge(s) and strategies to overcome it. If not, discuss potential problems, difficulties, limitations, and/or alternative strategies to overcome challenges in your final project

    • As the project is currently in dry lab form, I have not encountered any challenges when performing validation. However potential difficulties that could occur in validating the comprehensive version of the project (including wet lab components) could include, but may not be necessarily limited to having uncountable plaques. This would be a problem because I need a countable number of plaques to succesfully calculate PFU/mL readouts as a result of the plaque assay. There are a couple of strategies I’d employ to deal with this potential challenge. I would first cross-check to see if enough serial dilutions were performed. Then I would ensure that no plating errors took place either before or during the plaque assay portion of the wet lab protocol

Section 6: Additional Information


All Final Project supporting prompts listed below:

Supporting PromptModel
Please follow the skill instructions below and begin Phase 1:Claude
Q: What biological problem are you most interested in solving? A: I’m interested in bacteriophage engineering, specifically taking microgravity-derived phage fitness insights from an International Space Station (ISS) experiment and proactively applying these insights to a non-Escherichia coli terrestrial bacteriophage Q: What system or organism would you prefer to work in? A: Thinking a Mycobacterium smegmatis (M. smegma) , but I’m not sure Q: Which synthetic biology approaches interest you most? (Select all that apply) A: ORACLE (Optimized Recombination, Accumulation, and Library Expression), In-cell recombination, and Combinatorial Library Synthesis (although I’m not sure and am open other synthetic biology approaches for this research)Claude
Q: The ISS microgravity experiments you’re referencing — do you have a specific phage or dataset in mind? A: Yes — a specific phage/study (I’ll describe below) Q: For your M. smegmatis host system, which mycobacteriophage are you thinking of engineering? A: Open to suggestions based on what’s best for the project. Please note that I’m working in a low-biosafety level (BSL) lab, so that’s the only major consideration that comes to mind here Q: What is the core hypothesis — what ‘fitness’ trait from microgravity are you trying to engineer in? A: The desired fitness traits would most likely be ‘Broader host range’ and ‘Enhanced infectivity / adsorption rate’ in that order of priorityClaude
Q: What type of phage genes do you expect carry the microgravity fitness signal? (This shapes your DNA construct design) A: Tail fiber / receptor binding protein (RBP) mutations Q: For measuring success, which primary assay makes most sense to you? A: Combination of the above Q: You mentioned ORACLE / in-cell recombination / combinatorial library synthesis — are you set on using all three, or open to a focused recommendation? A: I’d like your recommendation given the BSL constraint and M. smeg systemClaude
Microgravity reshapes bacteriophage–host coevolution aboard the International Space Station (title); Phil Huss, Chutikarn Chitboonthavisuk, Anthony Meger, Kyle Nishikawa, R. P. Oates, Heath Mills4 Olivia Holzhaus, Srivatsan Raman (authors); 2026 (year)Claude
Q: Does D29 with focus on the gp80 tail spike RBP sound right for your project? A: I don’t know enough to know enough so will defer to these findings Q: What host range panel would you like to test your engineered D29 variants against? A: Multiple M. smeg strains only (keep it BSL-1) Q: The paper used cell-free approaches for DMS. Do you want a cell-free component in your project? A: Do whatever will likely be logistically easier given the timeframes to complete the research (essentially 4 to maybe 6 weeks max.)Claude
“generate proposal”Claude
Take a look at the following quote from the URL below: “Strain-specific phage chassis to target bacteria that commonly cause infections during space flight.” What is the difference between a phage and a phage chassis? In general? In a biotechnological context? Do NOT hallucinate when answering these questions https://roadmap.ebrc.org/engineering-biology-for-space-health/Perplexity
Take a look at the following quote from the URL below: “Capability to produce novel phages on space missions for rapid control of evolved biofouling microbes. What are ’evolved biofouling microbes’? What is biofouling? I assume biofouling indicates something bad/undesirable, but I don’t know what the term actually means beyond my assumption Do NOT hallucinate when answering these questions https://roadmap.ebrc.org/engineering-biology-for-space-health/Perplexity
I understand how a phage can insert itself into a cell. Not exactly understanding if or how phages’ abilities contribute at all to personalized medicine developments (i.e., is there something about phage properties that make them particularly good candidates for personalized medical interventions)? Do NOT hallucinate when answering this questionPerplexity
What are the technical subcomponents of a biotechnology intervention or treatment using phage chassis? What do the supply chains look like, if any? Do NOT hallucinate when answering these questions. If you don’t know the answers to these questions, say soPerplexity
“phage chassis synthetic biology manufacturing pipeline” search resultsPerplexity
Are there any existing ways a biotechnology solution (let’s say a custom developed chassis) can proactively prevent itself from malicious dual-use? Analogous to large language model (LLM) safety refusal, are there any mechanisms that can be pre-built into a biotechnology solution to proactively prevent malicious dual-use? Do NOT hallucinate when answering these questionsPerplexity
How exactly do phages interact with genetic code information within a given cell? How do cell-based bacteria defend against unwanted phages?Perplexity
I’m high-level aware that there are certain ’no-go’/‘do not edit’ pieces of genetic code. How are phages traditionally prevented from editing these ’no-go’/‘do not edit’ pieces of genetic code? Is that a thing? If I’m off in any way/if my conceptual underpinnings seem shaky, let me know Do NOT hallucinate when answering these questionsPerplexity
Tell me about about engineered synthetic biology kill switchesPerplexity
Have any engineered synthetic biology kill switches been implemented as part of phage therapies? Do NOT hallucinate when answering this questionPerplexity
If I’m making a novel phage-related therapy for astronauts, and I live in the United States, the Food and Drug Administration (FDA) would need to approve this therapy, correct? My assumption is yes. How does approval of a drug used outside of Earth’s atmosphere work from a regulatory perspective? Do NOT hallucinate when answering these questionsPerplexity
Are there any space health-related consortia specifically or explicitly aimed at making space medicine advancements as broadly accessible as possible to both spacefaring and terrestrial populations? If so, share information regarding said consortia Do NOT hallucinate. If you don’t know the answer to this question, say soPerplexity
In medicine, what do we usually mean by ‘point of care’? What do we mean when we say that?Perplexity
Do space medicine point of care guides exist? If so, are there any for commercial space tourists, astronauts, or future groups of spacefarers, including workers, etc.?Perplexity
What is applied biomedicine?Perplexity
What is the TRISH POCUS training referred to in the answer to the last prompt? What does POCUS refer to?Perplexity
Tell me how to add a Promoter to a sequence in BenchlingPerplexity
Found this information from the Registry of Standard Biological Parts: BBa_J23106 Can you break down what this naming convention means and how I can find the relevant Promoter information in a sequence based on this naming convention? Do NOT hallucinate. If you don’t know the answer, say soPerplexity
What is an alignment in Benchling? In Benchling, how do I put a codon optimized sequence under or next to a sequence I originally imported? Do NOT hallucinate when answering this questionPerplexity
How do I replace a sequence in Benchling with a codon-optimized sequence?Perplexity
Bit confused regarding how to find a Promoter in a sequence in Benchling. I tried Auto-Annotate and it doesn’t seem to be working. Where should I go from here?Perplexity
What is an RBS in Benchling?Perplexity
What is a 7x His Tag? What is a Terminator? How do I find these in Benchling? Where are these traditionally inserted into a sequence in Benchling?Perplexity
How do I paste sequences into a Benchling file?Perplexity
How do I know where to insert a Promoter into a given sequence in Benchling?Perplexity
Not totally understanding. If the start codon (the ATG) represents the start of the sequence, how do I insert something before that in Benchling?Perplexity
What is an RBS? Where are they traditionally inserted into a sequence?Perplexity
What do spacers look like in Benchling? Is it literally just empty space with no letters/codons? Something tells?Perplexity
Where is a coding sequence traditionally inserted in a codon optimized sequence in Benchling? If there’s something off in what I’m saying, let me knowPerplexity
Where is a C-terminus in a protein in Benchling?Perplexity
How do I find an amino acid view for a sequence in Benchling?Perplexity
In Benchling, if I’m inserting a 7x His Tag and a Terminator, and I have a stop codon in my sequence, what is the traditional sequence? Is it 7x His Tag, stop codon, Terminator? Something else?Perplexity
Any way I can add a Schema to a sequence after the fact in Benchling?Perplexity
What is horizontal gene transfer? A separate question (perhaps): What is the technical term in biotechnology for transferring the abilities of one organism to another (ex. if I wanted to actually give a lizard the ability to fly like a bird by importing genetic properties that allow for the creation of wings for example)?Perplexity
If I want to perform transgenesis in a biotechnological context (i.e., introduce a foreign gene into a new organism to confer a desired trait), and I want to start this process by sequencing the original foreign gene, what is considered the best practice in modern biotechnology for sequencing this original foreign gene? Is this sequencing method first, second, or third generation in the history of biotechnology? From some other period? What essential steps does it involve and how does it decode the bases of the original foreign gene? What is its output? Do NOT hallucinate when answering these questions. If you don’t know the answer to any of these questions, say soPerplexity
How is Next-Generation Sequencing (NGS) considered second generation? Do NOT hallucinate when answering this questionPerplexity
If I want to perform transgenesis in a biotechnological context (i.e., introduce a foreign gene into a new organism to confer a desired trait), and I want to start this process by sequencing the original foreign gene via Next-Generation Sequencing (NGS), what is my input at the very beginning of the sequencing process? How is that input prepared for sequencing? Do NOT hallucinate when answering these questions. If you don’t know the answer to any of these questions, say soPerplexity
What do phage isolation experiments usually entail? Are any elements of phage isolation experiments dangerous to human health and safety, and if so, why?Perplexity
Take the steps in the “What phage isolation usually involves” section of the last prompt and break down the tools traditionally used for each step Do NOT hallucinate when answering this questionPerplexity
What is supernatant?Perplexity
What are plaques in a phage isolation experiment context?Perplexity
What does it mean to ‘pellet’ bacteria?Perplexity
Do phages contain or have DNA?Perplexity
Within the context of Gibson Assembly (biotechnology DNA assembly method), why exactly are molar ratios (apparently they need to be 2:1, insert:vector) important? What are molar ratios? Do NOT hallucinate when replying to this promptPerplexity
What exactly is the insert and what exactly is the vector within the context of the Gibson Assembly DNA Assembly method? Do NOT hallucinate when replying to this promptPerplexity
In the context of biotechnology and synthetic biology, what exactly is a plasmid backbone? Explain this to me as if I were a reasonably educated 16-year old Do NOT hallucinate when addressing this promptPerplexity
Tell me about the Phusion High-Fidelity (HF) Polymerase Chain Reaction (PCR) Master Mix. What is it? What are its subcomponents and what do they do? Do NOT hallucinate when addressing this promptPerplexity
Within the context of a Polymerase Chain Reaction (PCR), I believe primers are the pieces of DNA that get copied nth number of times, correct? If I’m mistaken, indicate as such, and the error in the initial reasoning. Do NOT hallucinate when addressing this promptPerplexity
So based on the answer to the last prompt: –Primers essentially define the space in the DNA sequence that will be copied? –What is a free 3′‑OH end? Explain this to me as if I were a relatively educated 16-year old Do NOT hallucinate when answering this promptPerplexity
Do primer pairs always need to have a temperature difference of 5°C from each other? If so, why? Do primer pairs always need to at a temperature of between 52–58°C before annealing? If so, why? What factors determine ideal primer annealing temperatures, and why? Do NOT hallucinate when addressing these promptsPerplexity
What does phage therapy look like clinically?Perplexity
In the answer to the last prompt, what exactly does the creation of the phage cocktail entail? Do NOT hallucinate when replying to this promptPerplexity
Take the attached .pdf file and explain to me the components to the plasmid and why they were chosen/why they make sense given the Aims and Experimental Goals of the research project outlined in the attached .md file Do NOT hallucinate/make things up when replying to this prompt. If things don’t make sense to you, or you don’t have additional context regarding the respective .pdf and .md file content, say soPerplexity
I already went in and changed the amino acids myself in each of the Variants, so I’m actually not tremendously concerned about being able to pinpoint which amino acid residues changed across Variants. I care more about the 4th Caveat mentioned (DE3 lysogen status of CFT073, UTI89, MG1655). How would I verify this? Also, my Varian 1 and 2 plasmids are 2,429 kb respectively, and they’re pET-28a constructs (believe they might be meant to be expression cassettes). If there are any issues you see with this, let me know Do NOT hallucinate/make things up when replying to this promptPerplexity
Want to understand the utility of Gibson Assembly in genomics. If I have a mutated fragment of E. coli bacteriophage, and I want to see how that mutated fragment interacts with (specifically how it lyses) multiple strains of E. coli. (ex. CFT073, UTI89), how can Gibson Assembly help me accomplish this goal? Do NOT hallucinate/make things up when replying to this promptPerplexity
Precision. It allows me to insert the precise mutated bacteriophage gene fragment into nth novel backbones to see their results, as opposed to passing phage on to new hostsPerplexity
I’ve actually re-created the original Gene 17 Variant 1 and Variant 2, with corresponding amino acid mutations. Wondering how to appropriately create the primers for Gibson Assembly. How do I make sure they have the appropriate 5’ –> 3’ orientation? Also wondering if this is something I should go to Perplexity Computer mode to assist with Do NOT hallucinate/make things up when replying to this promptPerplexity
Ok, so help me understand this. To test the gp17 Variants against CFT073, UTI89, and MG1655 E. coli. strains, I know I need an expression vector. I know I need primers for my Variants to allow the mutated gp17 to express itself. Taking pET-28a off the table, not understanding the connective tissue between the Variant primers and testing the primers for lysing (Pfu/mL) against CFT073, UTI89, and MG1655 E. coli. strains. In terms of an experimental protocol, am I supposed to make backbones for each of the strains, the essentially create ‘cuts’ in the backbones so the primers can be inserted? Also not understanding how all this dovetails into the idea of ‘rebooting a phage’ to test phage fitness Do NOT hallucinate/make things up when replying to this promptPerplexity
Path BPerplexity
So based on the results in the last couple prompts, it would be fair to say that my fragments are the mutated gp17 Variants and the phage backbone is a ’normal’ T7 phage genome (like BL21) correct? Do NOT hallucinate/make things up when replying to this promptPerplexity
Apologies if this is a dumb question. In the context of bacteriophage lab protocol workflows, when someone says they are going to ‘reboot the phage’, what exactly does that mean? Is it the same as Gibson Assembly? If it’s not, what comes first (pretty sure it goes Gibson Assembly –> phage reboot but not sure)? What does this look like in terms of a lab protocol, in simple terms? Do NOT hallucinate/make things up when replying to this promptPerplexity
It seems like 2A is the equivalent of a transformation step from a lab protocol perspective yes? If not, or if it’s different somehow, why? Do NOT hallucinate/make things up when replying to this promptPerplexity
What do Gibson Assembly protocols typically entail? What is needed to get the reaction properly set-up? What types of wet lab lab plates (if any) and what type of automation is used as part of standard Gibson Assembly protocols? Do NOT hallucinate/make things up when replying to this promptPerplexity
Want to understand if or how wet lab automation equipment is ever used in the context of phage rebooting. Also, what types of wet lab plates, if any, are used? Including incubation, how long does it usually take to execute a cell-free phage reboot? Do NOT hallucinate/make things up when replying to this promptPerplexity
How long does it traditionally take to see plaque assays in a bacteriophage wet lab experiment? Do NOT hallucinate/make things up when replying to this promptPerplexity
How is PFU/mL traditionally counted in standard bacteriophage wet lab protocols? Is this done manually in the wet lab or by some form of automated lab equipment? A bit of both? Also, what is an ANOVA statistical test? Do NOT hallucinate/make things up when replying to this promptPerplexity
If I want to say a bacteriophage demonstrated greater fitness/lysing, what’s the appropriate terminology/acronym to use? Is it Multiplicity of Infection (MOI), Efficiency of Plating (EOP), or some other term? Do NOT hallucinate/make things up when replying to this promptPerplexity
Taking a look at this Draft Protocol, I want to understand the following: –Beginning with the end in mind, how much Variant 1 and Variant 2 (V1 and V2) DNA do I need to have by the time I reach Step 9 in order to successfully complete Steps 12 and 13? What should my quantities look like (wet lab measurements across Steps 4 - 12? –Should Step 5 be cut? I think the answer’s yes –Is a cell-free approach traditionally used for Phage Reboot (see Step 11)? Reference the attached document and the open literature on bacteriophage plaque assay/lysing to address this prompt. Do NOT hallucinate/make things up when replying to this promptPerplexity
Ok, looking over the first part of the answer to the last prompt, just confirming the ‘Wet Lab Measurement Targets’ table indicate measurements to implement at each relevant Wet Lab protocol step so there’s enough V1 and V2 DNA concentrations to get appropriate PFU/mL readouts at the Plaque Assay/final read-out portion of the protocol, correct? Do NOT hallucinate/make things up when replying to this promptPerplexity
Apologies if this is a dumb question. Given the open academic literature on bacteriophage plaque assay/lysing, does the Step 9 concentration amount (~30 µg/mL) give us enough to work with or is it optimal relative to the expected PFU/mL output later in the protocol? Does it set things up well? Is it optimal, suboptimal, or nominal? Do NOT hallucinate/make things up when replying to this promptPerplexity
Wonderful – would you mind please re-doing the table that was outputted 2 prompts ago accordingly? I want all the Wet Lab Measurements in the protocol in adequate/sensible ranges based on the variance identified in the last prompt. In short, I want wet lab measurements corrected if needed across all wet lab steps in the protocol If you don’t know the prompt that’s being referenced from 2 prompts earlier in this thread, say so. Otherwise, please redo the table accordingly Do NOT hallucinate/make things up when replying to this prompt. If you don’t know something, say soPerplexity
Based on this protocol, create a hypothetical PFU/mL graph showing results for Variant 1, Variant 2, and wild-type T7 bacteriophage against the intended tested E. coli. strains (CFT073, UTI89, MG1655) Explain the hypothetical results, why they are what they are, and do NOT hallucinate/make things up that aren’t sensible based on what exists in the literature on bacteriophage lysing researchPerplexity
Based on this protocol, create a hypothetical PFU/mL graph showing results for Variant 1, Variant 2, and wild-type T7 bacteriophage against the intended tested E. coli. strains (CFT073, UTI89, MG1655) Explain the hypothetical results, why they are what they are, and do NOT hallucinate/make things up that aren’t sensible based on what exists in the literature on bacteriophage lysing researchPerplexity
I made the following Variant Gibson Assembly Constructs in a standard E. coli. T7 bacteriophage backbone (NCBI Accession: V01146) based on the Variants created in the attached PDF. Want to understand the essential components of each Gibson Assembly Construct in 2nd/3rd-level detail (i.e., I want to explain the important pieces of each construct and why they’re there), but do not know how exactly where to begin. I know I have things in the Construct like primers, a Coding Design Sequence (CDS) for the mutant variant genetic fragment of interest (Gene 17), as well as T7 promoters and terminators, but not exactly sure how to piece all of this together into a cohesive narrative regarding what I constructed (the important pieces), their intended functions, and why they’re there How can we go about getting to this goal? Do NOT hallucinate/make things up when replying to this promptPerplexity
Let me answer your questions to the best of my ability in order: Question 1 Attempted Answer: If you look at the attached PDF, you’ll see a variety (I believe approx. 5) of amino acid substitutions for each Variant. When you look at Variant 1 and Variant 2 constructs, what you don’t see purely based on the screenshots is the fact that the respective CDS inserts per each Variant were crafted by manually changing the relevant Gene 17 amino acids per instructions in the attached PDF (i.e., reading what amino acid mutations took place and then copying them in Benchling). Then those Gene 17 fragments with the amino acid mutations were turned into their own respective fragments separate from their larger original sequence for testing within Gibson a-la the attached pdf (I think – I my memory’s a bit fuzzy on the last part). Hopefully that helps answer the question Question 2 Attempted Answer: Gibson Assembly helps express or amplify a specific genetic mutation within a novel construct. We insert primers into an expression backbone and then genetic circuit components like promoters and terminators help express said mutation. That’s my high-level understanding Feel free to ask further questions or elaborate in response to any answers. DO NOT hallucinate/make things up when replying to this promptPerplexity
Here are the answers to your questions: –Yes, the rephrasing matches how I see my constructs –Variant 1 Fragment gp 17 CDS Amino Acid List/Sequence: MANVIKTVLTYQLDGSNRDFNIPFEYLARKFVVVTLIGVDRKVLTINTDYRFATRTTISLTKAWGPADGYTTIELRRVTSTTDRLVDFTDGSILRAYDLNVAQIQTMHVAEEARDLTTDTIGVNNDGHLDARGRRIVNLANAVDDRDAVPFGQLKTMNQNSWQARNEALQFRNEAETFRNQAEGFKNESSTNATNTKQWRDETKGFRDEAKRFKNTAGQYATSAGNSASAAHQSEVNAENSATASANSAHLAEQQADRAEREADKLENYNGLAGAIDKVDGTNVYWKGNIHANGRLYMTTNGFDCGQYQQFFGGVTNRYSVMEWGDENGWLMYVQRREWTTAIGGNIQLVVNGQIITQGGAMTGQLKLQNGHVLQLESASDKAHYILSKDGNRNNWYIGRGSDNNNDCTFHSYVHGTTLTLKQDYAVVNKHFHVGQAVVATDGNIQGTKWGGKWLDAYLRDSFVAKSKAWTQVWSGSAGGGVSVTVSQDIRFRNIWIKCANESWNFVRTGPDGIYFIASDGGWLRFQIHSNGKGFKNIMDSRSVPNAIMVENE* –Variant 2 Fragment gp 17 CDS Amino Acid List/Sequence: MANVIKTVLTYQLDGSNRDFNIPFEYLARKFVVVTLIGVDRKVLTINTDYRFATRTTISLTKAWGPADGYTTIELRRVTSTTDRLVDFTDGSILRAYDLNVAQIQTMHVAEEARDLTTDTIGVNNDGHLDARGRRIVNLANAVDDRDAVPFGQLKTMNQNSWQARNEALQFRNEAETFRNQAEGFKNESSTNATNTKQWRDETKGFRDEAKRFKNTAGQYATSAGNSASAAHQSEVNAENSATASANSAHLAEQQADRAEREADKLENYNGLAGAIDKVDGTNVYWKGNIHANGRLYMTTNGFDCGQYQQFFGGVTNRYSVMEWGDENGWLMYVQRREWTTAIGGNIQLVVNGQIITQGGAMTGQLKLQNGHVLQLESASDKAHYILSKDGNRNNWYIGRGSDNNNDCTFHSYVHGTTLTLKQDYAVVNKHFHVGQAVVATDGNIQGTKWGGKWLDAYLRDSFVAKSKAWTQVWSGSAGGGVSVTVSQDIRFRNIWIKCANESWNFFRTGMDGIYFIASDGGWLRFQIHSNGKGFKNIMDSRSVPIAIMVENE* –To the best of knowledge, I didn’t alter any promoter/terminator regions near gene 17 when building the fragments Do NOT hallucinate/make things up when replying to this promptPerplexity
Let’s go with option a) for now Do NOT hallucinate/make things up when replying to this promptPerplexity
I think this is enough for me to work with post-export, so there’s no need to pause and tweak Variant 1 wording (that will be done by me off-line after the fact). Let’s now create the same 1–2 paragraph write‑up for Variant 2 now Do NOT hallucinate/make things up when replying to this promptPerplexity
The key conceptual difference is seeing which tail-fiber tip substitutions lead to greater Plaque-Forming Units/milliliter (PFU/mL) (i.e., greater bacteriophage fitness against multiple strains of E. coli. bacteria) If this seems off or incorrect in any way, say soPerplexity
Let’s do something similar to what we did in the Construct Thread (see .docx file), and do something similar for the PFU/mL chart. Want to be able to clearly explain why the bacterial E. coli. strains were chosen, what expected results we expected to see across the Variants and the wild-type control, and the implications for the larger experimental aims of this research (i.e., we want to see if the bacteriophage gp17 mutations in the attached PDF unlock PFU/mL improvements against other strains of E. coli bacteria beyond the strain tested in the paper) Do NOT hallucinate/make things up when replying to this promptPerplexity
MG165 is the baseline, CFT073 for V1, and UTI189 for V2Perplexity
We would lean more towards ’narrow but strong’ it would seem like based on the fact that only one variant improve PFU/mLPerplexity
We’d say it has broader host rangePerplexity
Find me a standard/well-cited bacteriophage lysing paper containing a Plaque-Forming Unit/milliliter (PFU/mL) read out. Want to understand how PFU/mL findings are traditionally graphically represented in the relevant academic literature Do NOT hallucinate/make things up when replying to this prompt. Let’s keep the focus on cited academic literaturePerplexity
Take a look at Step 8 of the attached protocol, specifically where it describes the ~70 ug/mL DNA concentrations that could be confirmed via a spectrophotometer like a Nandrop. Want to create the equivalent of the graphs displayed in Nandrop that show the intended ~70 ug/mL DNA concentration Do NOT hallucinate/make things up when replying to this prompt. Use available information on Nanodrop (or equivalent spectrophotometer) read outs to address this promptPerplexity
Take this protocol and convert it to Markdown Hugo Relearn Theme style Do NOT hallucinate/make things up when doing this. If you cannot do this, say soPerplexity
So the constructs in the screenshots at the beginning of this thread are showing a bacterial expression system for a DNA construct, correct? Even if the protocol later uses a cell-free phage reboot, the Dry Lab Gibson Assembly step (the constructs) are showing a bacterial expression system for a DNA construct (the respective Variants), correct? Do NOT hallucinate/make things up when replying to this promptPerplexity
Taking a look at this attached protocol, what expression system am I using for the DNA construct in question (the expression of the Variants in the experiment)? Is it cell-free? Bacterial? Yeast? Pretty sure it’s cell-free based on the ‘Phage Reboot’ protocol step, but want to confirm Do NOT hallucinate/make things up when replying to this promptPerplexity
Quick question: The E. coli UTI189 bacteria strain is different from the UT1 and UTI2 E. coli UTI189 bacteria strains correct? Seems like a bit of a dumb question, but am not sure Do NOT hallucinate/make things up when replying to this promptPerplexity
Looking at the attached protocol, what are some common things that can/might go wrong traditionally when performing one of these (by these I mean bacteriophage PFU/mL) protocols? Give me 3-5 contingencies and mitigations and keep everything to max. 3 bullet points (specifically have a headline per contingency with maximum 3 mitigation bullet points underneath it) Do NOT hallucinate/make things up when replying to this promptPerplexity
Thank you. What does the log₁₀ scale mean in simple terms? What does the ±0.3 log₁₀ SD stand for? Do NOT hallucinate/make things up when replying to this promptPerplexity
Another question about the graphs created in response to the previous prompt. For MG1655, why does Wild-Type outperform Variants 1 and 2? Does that make sense? If so, why? Do NOT hallucinate/make things up when replying to this promptPerplexity
Can you tell me how Gibson Assembly works and why it’s useful within the context of the Draft Protocol in 3-4 sentences? Do NOT hallucinate/make things up when replying to this promptPerplexity
And to be clear, based on what we know about Gibson Assembly and how it works, the exonuclease chews back, the polymerase multiplies the desired DNA fragment, and the ligase seals the multiplied fragment back into the backbone right? Correct any of my misperceptions about Gibson and do NOT hallucinate/make things up when replying to this promptPerplexity
Take the protocol at the beginning of this thread and give me a supply list of all relevant items and dollar amounts (USD). Have the final bullet list ‘Total Supply Cost:’. Have all this be in Markdown Hugo Relearn theme format Do NOT hallucinate/make things up when replying to this promptPerplexity
Here’s what I’m working on for my final project: The first aim of this project is to demonstrate if/how microgravity-induced BL21 E. coli strain bacteriophage mutations manifest in multiple different strains of E. coli. This will help discern how to increase terrestrial E. coli. bacteriophage fitness and lysingHTGAA Claude AI Tutor
It has already acquired mutations. I want to apply these mutations to other E. coli bacteriophage strains to see if/how they increase fitness and lysingHTGAA Claude AI Tutor
It’s the T7 bacteriophage (ATCC BAA-1025-B2). The downselected variants exhibiting the best performance against Urinary Tract Infection (UTI) bacteria showed mutations in gene 17, which seems to code for portions of the tail fiber protein. Additional mutations were found in gene 7.3, which might code for a scaffolding protein, as well as gene 11, which codes for an adaptor protein in the T7 tail. These were not discussed/referred to as the primary source of the Variants, which seemed to be gene 17HTGAA Claude AI Tutor
Believe the plasmid-based system is the intention, because I want to test the gene 17 mutation against other E. coli strainsHTGAA Claude AI Tutor
I’m frankly not sure. I’m doing the project in dry lab and I’m certainly not a bio SME–my experience is rather limited. Which would be easier to do or make more sense for a beginner to do, given the intention of the project?HTGAA Claude AI Tutor
Plaque assay, although I don’t know how I’d do that in dry lab (except perhaps refer to it in analogous/similar diagrams with TBD wet lab validation in my final presentation). Also not entirely sure/not seeing the connective tie between using a T7 promoter with a BL21(DE3) host and how I would then test this in non-BL21 strains of E. coli? What fundamentals am I missing/not understanding here in terms of how to go from A to B given my project intention?HTGAA Claude AI Tutor
Not really sure. UPEC sounds good, but I’d also be down for testing against other strains that make sense. My NCBI Reference Sequence is NC_001604.1 for Gene 17 referred to in the original University Wisconsin Madison paper on which this research is based (https://journals.plos.org/plosbiology/article?id=10.1371/journal.pbio.3003568#sec009). Been told by my Node leaders to think about multiple strains. Think maybe testing against 3-5 strains sounds good. Just not sure what makes sense in terms of relevance and/or high BLAST with the Gene in question.HTGAA Claude AI Tutor
I’ve done BLAST of NC_001604.1 gene 17 sequence sans comparison with published UTI phage therapy studies. Not sure about if/how I would confirm whether my dry lab setup gives me access to any published lysis efficiency data for T7 against UPEC strains Down for a suggested 3-5 strain panel now, along with justification/indications of non-hallucination/source validation for why said strains experimentally make senseHTGAA Claude AI Tutor
This seems good for now/to startHTGAA Claude AI Tutor
96-well plate formatHTGAA Claude AI Tutor
Embarrassingly, I don’t know enough to know enough. What reporters or selection markers are conventionally used for projects like this? Why and how are reporters or selection markers conventionally used for projects like this? Open to your feedback on thisHTGAA Claude AI Tutor
It makes sense. Just not exactly sure if I’ll be ordering from Twist, as I’m a Committed Listener who attends a node ad hoc in-person and has rather limited wet lab exposure experience. Down for constituting a hypothetical Twist order (i.e., as part of my final presentation, saying ‘If I was going to do wet lab extensions of this work, I’d…’), but what I really want/need help with is designing plasmid Benchling mock-ups and any all genetic circuit diagrams in a program like Asimov in a way that makes sense for final project review/the final project presentation and is also explainable/understandable by yours truly. Any help with that would be greatly appreciated (again, not to say I don’t want assistance with a hypothetical Twist order…it just may not be 1st priority)HTGAA Claude AI Tutor
Yes to both. I have a Benchling account and access to the gene 17 NCBI FASTAHTGAA Claude AI Tutor
It’s asking for a species name for pET-28a in Benchling. What is appropriate here?HTGAA Claude AI Tutor
Ok – I can now answer the question asked 2 prompts ago (i.e., whether the Gene 17 file [which in this case is a GenBank file] contains annotations). It does contain annotations. I also have downloaded a fully annotated pET-28a fully annotated sequence and see the T7 terminator and promoter tags. Not sure exactly how to proceed. Do I literally just go next to the T7 terminator and paste the all of Gene 17’s content between it and the T7 promoter?HTGAA Claude AI Tutor
When I go to the colored block on the linear I see only the following lines with the following colors: –T7p52 (light blue color) –source (light blue color) –T7p52 (yellow color) There’s no circular mapHTGAA Claude AI Tutor
In the Benchling Linear map, it says the Gene 17 fragment’s 1662 bp long. It extends from 34624 to 36285 in the larger NC_001604 BL21 E. coli. bacteriophage genomeHTGAA Claude AI Tutor
Little bit confused. When I go to the Linear Map view, I just see 3 bars spanning the entire sequence fragment left to right. Their respective colors and labels are listed below: –T7p52 (light blue color) –source (light blue color) –T7p52 (yellow color) Based on what I’m seeing, I’m not sure where to add the annotation. When I go into Sequence Map view, I see a stop codon at the very end of the sequence fragment (TAA). I also see that the sequence fragment begins with ATG and after this light blue box that reads ‘T7p52’ (which I think might mean a promoter) there’s an AAC sequence of letters. The ‘T7p52’ light blue box contains the following letters listed above it: ATGGCT Not sure if any of this is helpful for helping me isolate what part of the sequence fragment I should annotate. Trying to share what I see so I can receive appropriate guidance/feedbackHTGAA Claude AI Tutor
Yes. It’s the entire sequence fragment. It begins at nucleotide position 1 (the beginning of the ATG start codon) and ends at position 1662 (the end of the TAA stop codon). So from here just annotate the entire fragment as the gene 17 CDS. Also could you please confirm that CDS stands for Coding Design Sequence?HTGAA Claude AI Tutor
When I create the Annotation, I don’t have the option to select for a Feature type. I have the following options: –Annotation Type: Select ‘gene’ or ‘source’ –Strand: Select ‘Forward’, ‘Reverse’ or ‘None’ –Custom fields: Select ‘db_xref’, ‘organism’, ‘moi_type’, or ‘host’ To accurately label this annotation as a CDS how should I proceed? How do I accurately label this annotation period/in general?HTGAA Claude AI Tutor
Yes, I see a colored block labeled ‘Gene 17 CDS’ appearing on my linear mapHTGAA Claude AI Tutor
Yes I doHTGAA Claude AI Tutor
In Sequence Map view, I see the following between the T7 terminator and promoter: –6xHis –A light blue MCS –T7 tag –thrombin site –6xHis –A maroon ATG mark –A grey RBS mark –A lac operator that’s shaded a light-ish green Not sure where I paste the sequence based on this information. I don’t see the cluster of restriction site annotations referred to in the answer to the previous promptHTGAA Claude AI Tutor
The beginning of the marker or the end of the marker?HTGAA Claude AI Tutor
It starts at position 298HTGAA Claude AI Tutor
The position number to the immediate left of the T7 terminator is position 25. It (and the rest of the T7 terminator) shows up before the ATG marker in the sequence. Does that make sense? Is anything out of the ordinary? How should we proceed?HTGAA Claude AI Tutor
Before I answer the last question, at this point, I still have not inserted gene 17. Do I need to do that before answering your last question?HTGAA Claude AI Tutor
The last position number shown in my pET-28a sequence is position number 5369HTGAA Claude AI Tutor
The gene 17 sequence is 1662 bp long. The bp notation is synonymous with the number of nucleotides, correct?HTGAA Claude AI Tutor
Ok I have both sequences open and selected the region from position 298 to position 5369 in my pET-28a file. How should we proceed? What should I click on or do next?HTGAA Claude AI Tutor
When I try to paste I get a reading that say ‘You’re about to paste a sequence that includes 0 annotations, 0 translations, 0 primers, 0 parts’. That’s not correct based on what I see in the Gene 17 fragment file. How should I or what type of pasting should I do from the Gene 17 fragment file?HTGAA Claude AI Tutor
The paste succeeded. The new total length of the plasmid is now 1960 bp. How should we proceed? Pretty sure we’re going to need to re-annotate the new plasmid sequence at some point in this workflowHTGAA Claude AI Tutor
There is something that has a ‘T7 tag’ label located before the ATG marker and before the T7 terminator. Unlike the T7 terminator, it is not a shade of light green (it’s grey). I don’t see anything explicitly labeled ‘T7 promoter’ anywhere in the sequence (this includes near the beginning of the sequence)HTGAA Claude AI Tutor
No it does notHTGAA Claude AI Tutor
Ok – I just restored everything in the original 5369 bp pET-28a back to its original version. Issue seems to be that the ATG marker in this sequence sits before the T7 promoter so when the Gene 17 sequence was added, it removed the T7 promoter. How should we proceed with the Gene 17 sequence re-insertion based on this information?HTGAA Claude AI Tutor
In my pET-28a, the T7 promoter sequence ends at position 387. Proceed with the copy and paste job by selecting everything in the pET-28a from position 387 to the end, deleting it, then re-inserting the Gene 17 CDS fragment, correct?HTGAA Claude AI Tutor
After selecting from position 388 to 5369, deleting that region, and then pasting in my Gene 17 CDS, the new total plasmid length is 2049 bpHTGAA Claude AI Tutor
Yes I visually see the T7 promoter, then double checked via Ctl + F search and the ‘TAATACGACTCACTATA’ T7 promoter nucleotide sequence appears this timeHTGAA Claude AI Tutor
If I look at the sequence in Sequence Map view here’s what I see going from the beginning of the sequence downwards (i.e. from the 1st nucleotide position downward): 1. T7 terminator 2. T7 promoter 3. Gene 17 CDS If there’s anything wrong or incorrect here, say soHTGAA Claude AI Tutor
Yes I can confirm the Gene 17 CDS annotation starts immediately after the T7 promoter in the sequence (i.e., the CDS begins right at or just after position 387). It begins at bp position 388 in the sequenceHTGAA Claude AI Tutor
My annotation panel shows the T7 promoter, Gene 17 CDS, and the T7 terminator, but it also contains legacy pET-28a annotations from the original sequence. Is that a major issue or can we move on/proceed?HTGAA Claude AI Tutor
Do I need to clean up the existing annotations before we move on?HTGAA Claude AI Tutor
So if I look to Turns 7 and 8 earlier in our exchange, we were discussing panel of multiple strains to test the T7 bacteriophage Gene 17 against. Right now we’ve inserted the T7 bacteriophage Gene 17 into a pET-28a plasmid. Not sure where to go from here based on that previously stated intention (which I still want to carry out). Believe we might need to create multiple plasmids before the final project proposal can be craftedHTGAA Claude AI Tutor
Reference the content in response to Turns 7 and 8 earlier in this thread. The strains to test against were the following: – BL21(DE3) | Your baseline/control — the original host background for the microgravity phage experiment –CFT073 (UPEC) | Well-characterized uropathogenic E. coli strain; genome fully sequenced (Welch et al., 2002, PNAS); directly relevant to UTI therapeutic motivation –UTI89 (UPEC) | Second UPEC clinical isolate; used extensively in phage-host range studies (Dhakal & Mulvey, 2012); LPS structure differs from lab strains –MG1655 (K-12) | Standard lab K-12 strain; T7 infects it but with different efficiency than B-strains — good for seeing how LPS variation affects your mutant tail fiber Based on this information above, the fact that we’ve inserted the T7 bacteriophage Gene 17 into a pET-28a plasmid, and the fact we need plasmid tested across multiple strains, how should we proceed? How do we go from here based on the existing plasmid?HTGAA Claude AI Tutor
What is IPTG? Can I do that purely dry lab in Benchling? If not, tell me how we test the strains against the existing T7 bacteriophage Gene 17 pET-28a plasmid Do not currently know the answer regarding whether BL21(DE3), CFT073, UTI89, and MG1655 are all DE3 lysogensHTGAA Claude AI Tutor
Before we proceed, can I ask if you can ingest/extract insights from the University of Wisconsin, Madison paper on which this research is based (see URL below)? https://journals.plos.org/plosbiology/article?id=10.1371/journal.pbio.3003568#sec009 If you can functionally do this, let me knowHTGAA Claude AI Tutor
Ok. Let me paste content from the paper into this chat for ingestion. My desire for doing this is the following: in most of this chat so far, we’ve focused on Gene 17, as this is the gene responsible for creating the microgravity-based Variants that were tested for and demonstrated stronger than normal fitness/lysing potential against terrestrial UTI bacteria. I want to make sure that as we craft Aim 1, we don’t miss any other Genes/relevant mutations that should also be tested against. If this means the pET-28a + Gene 17 plasmid needs to be changed somehow, or in some way, or if another plasmid needs to be created, that’s OK. I want to make sure we’re thorough in Aim 1 based on the intention stated at the beginning of this chat (if/how microgravity-induced BL21 E. coli strain bacteriophage mutations manifest in multiple different strains of E. coli. This will help discern how to increase terrestrial E. coli. bacteriophage fitness and lysing). The items in the ** ** in the parentheses seem to be of importance. So with that, here are the relevant excerpts: Section (Enriched mutations are distributed broadly in T7 phage): Next, we sought to identify mutations in the phage or bacterial genome that influenced phage-host interactions under microgravity. We performed whole-genome sequencing (WGS) of T7 and E. coli BL21 before and after incubation, using pre-incubation genomes as references to identify de novo mutations in the 23-day samples from each condition to ensure both phage and bacterial populations had ample time to propagate. To determine whether de novo non-synonymous substitutions or frameshifts in T7 were significantly enriched, we compared the pooled frequencies of abundant non-synonymous mutations to the distribution of synonymous de novo substitutions in each condition (Mann–Whitney U test, FDR-adjusted p < 0.05; Fig 3A). To assess whether specific genes had significantly more non-synonymous substitutions than other genes, we calculated this mutation density for each gene and compared it to the average mutation density per condition (one-tailed t test, FDR-adjusted p < 0.05, one-sided 95% CI; Figs 3B and S1). Finally, we compared the gene-level distribution of non-synonymous mutations between microgravity and terrestrial conditions (Mann–Whitney U test, FDR-adjusted p < 0.05) to identify genes with condition-specific enrichment of these mutations (Figs 3C and S2A). Significantly enriched (p < 0.05) phage substitutions were found across both structural and non-structural proteins under terrestrial and microgravity conditions (Fig 3B). In microgravity, gene product (gp) 7.3 and gp11 exhibited significantly more de novo non-synonymous substitutions than other genes (Figs 3B and S1A). Mutation density was overall higher terrestrially and no gene showed significant enrichment compared to others terrestrially (S1B Fig). Although gp7.3 is not fully characterized, it is considered essential for T7 infectivity in E. coli BL21 under terrestrial conditions [38]. This small 99-amino-acid protein may function as a scaffolding protein or contribute to host adsorption, though its role in the mature virion remains uncertain [39–41]. gp7.3 harbored seven significantly enriched substitutions in microgravity, the highest number observed in any gene under that condition. These substitutions were distributed throughout the protein (Figs 3D and S3), with four notable changes (E48K, E61K, D68Y, D68A) involving substantial shifts away from negatively charged residues. The only significantly enriched mutation in gp7.3 terrestrially was a six-amino-acid deletion spanning G42 to V47. The region from G39 to Q50 contained a dense cluster of substitutions and in-frame deletions, including a 3-amino-acid deletion (G39-T41) terrestrially and a deletion from M46 to Q55 in microgravity, all occurring in a region of the protein predicted to be unstructured (S3 Fig). The high number of enriched substitutions and recurring in-frame deletions in this small protein suggest that gp7.3 is both structurally flexible and critical for phage activity in both environments. gp11 is an adaptor protein within the T7 tail that connects the portal protein gp8, the nozzle protein gp12, and the six subunits of the tail fiber protein gp17 (Fig 3E) [38,40,42]. Enriched substitutions were distributed throughout gp11, spanning both exposed and buried residues (Figs 3F, S4A, and S4B). One significantly enriched substitution, R2C, arose independently twice in microgravity and is located in a flexible region capable of directly interacting with gp17 tail fibers (S4C and S4D Fig). These findings suggest that the substitutions may influence phage fitness by altering gp11’s structure or stability rather than through direct interaction with the bacterial host. Comparison of mutation abundance revealed that de novo non-synonymous substitutions were significantly more prevalent in the nozzle protein gp12 after incubation in microgravity than under terrestrial conditions, suggesting a more prominent role for this protein in microgravity (Fig 3C). Of the six individually enriched non-synonymous substitutions identified across both conditions, five involved changes toward positively charged residues (Q184R, R205H, Q242R, K404R, and W707R). These substitutions were distributed throughout the protein, with three more likely contributing to host interactions (S5 Fig). Specifically, R205 is surface-exposed and positioned near the host, Q242 lies close to the terminus of the DNA delivery channel, and Q184 faces directly toward the host. The charge shifts and spatial distribution of these substitutions highlight the functional importance of gp12 in enhancing phage fitness under both terrestrial and microgravity conditions. Several other significantly enriched substitutions were particularly notable. In microgravity, the V26I substitution in gp0.5 was the only mutation to sweep the entire phage population—and did so independently in two replicates—indicating a strong fitness advantage. gp0.5 is an uncharacterized class I gene, potentially associated with the host membrane due to the presence of a putative transmembrane helix [22]. Under terrestrial conditions, the T115A substitution in gp4.7 was significantly enriched and highly abundant across all three replicates. No mutations were detected in this gene under microgravity, suggesting selection pressure may be unique to terrestrial conditions. Although the function of gp4.7 remains unknown, BLASTP analysis identified homologs with ~40% similarity to putative HNH endonucleases in Klebsiella and Pectobacterium phages [43]. Lastly, numerous significantly enriched substitutions were found in the tail fiber gp17, particularly under terrestrial conditions (Fig 3B). In both environments, substitutions were concentrated in the C-terminal tip domain, with repeated mutations at D540 and neighboring residues. This region is a known determinant of host range and infectivity in terrestrial E. coli strains [26], and these results suggests continued importance during prolonged incubation in both gravity conditions. Section: Deep mutational scanning profiles beneficial substitutions in microgravity Bacteria often resist phage predation by mutating or downregulating surface receptors essential for phage adsorption [26,63–65]. Microgravity-induced stress may amplify this response, altering the bacterial proteome, including phage receptor profiles [15,25,66]. Such changes can drive adaptive mutations in the phage RBP. To investigate these interactions, we examined how individual substitutions in the tip domain of the T7 RBP affect phage viability in microgravity. The T7 RBP consists of six short non-contractile tails that form a homotrimer composed of a rigid shaft ending with a β-sandwich tip domain [67]. This domain is a key determinant of host recognition and interacts with host receptor LPS to position the phage for successful, irreversible binding [27–32,68]. We conducted comprehensive single-site saturation mutagenesis of the RBP tip domain, generating a library of 1,660 variants spanning residues 472–554 (based on PDB 4A0T). We then sequenced and compared mutational enrichment profiles following the 23-day selection under terrestrial and microgravity conditions. We recovered phage DNA from each sample and scored each variant based on its relative abundance before and after selection (functional score, F) normalized to wildtype (normalized functional score, FN). Scores were averaged across replicates, and only variants present in at least two replicates were retained for analysis. Although significant dropout of low-performing variants was expected due to the extended incubation, we successfully determined scores for 51.2% (880) of variants in microgravity and 39% (648) in terrestrial conditions (Figs 5A, 5B, and S7A). Variant scores correlated well across replicates despite differences in phage titer and reflected multiple rounds of replication over the 23-day incubation period, suggesting that lower-titer samples underwent selection but subsequently lost viability (S7B–S7D Fig). On average phage variants were significantly more enriched after terrestrial incubation compared to microgravity (two-sample t test, Mann–Whitney U, p < 0.001) (S8A Fig). The wild-type phage was significantly depleted terrestrially compared to microgravity (terrestrial F = 0.58, microgravity F = 3.5, p < 0.01). While variants that performed worse than wildtype (FN < 0) tended to perform similarly between microgravity and terrestrial conditions (S8B Fig), enriched variants (FN > 0) were highly divergent with no correlation between conditions (S8C Fig). Variants enriched in microgravity frequently contained methionine and isoleucine substitutions at interior positions facing the phage (Figs 5A and S8D), in contrast to our previous terrestrial results on this host [26]. Substitutions in these areas could influence the tip domain structure to facilitate adsorption with the host receptor in microgravity. Under terrestrial conditions, top-scoring variants included positively charged substitutions facing the host, consistent with our previous findings on E. coli BL21 [26]. Additional enriched variants featured negatively charged substitutions (e.g., Q488E, G521D) and glycine substitutions (e.g., G480W, G522P) that may induce structural changes in the tip domain (Figs 5B and S8B). These variants were enriched only after prolonged incubation with E. coli BL21, suggesting that such substitutions may contribute to long-term infectivity on stationary-phase hosts—an effect not observed in shorter, nutrient-rich conditions. Because variants enriched in microgravity were highly distinct from those identified under terrestrial conditions—both in this study and in our previous work—we next evaluated whether these substitutions could enhance phage activity terrestrially. If successful, these substitution patterns could be used to improve phage performance without exhaustively sampling the full combinatorial space of the gene. We constructed two combinatorial libraries, each comprising all possible combinations of 13 top-performing substitutions identified in microgravity (L490I, N502E, F506M, F506Y, F507V, F507Y, P511M, I514M, N531Q, L533K, L533M, A539M, N546I) or under terrestrial conditions (G521H, Q488A, Q488E, G521K, G522P, A547S, G521D, G521E, N502S, I495L, R542H, L533T, F506S). This strategy reduced a potential search space of over 10²¹ variants to fewer than 5,000 per library. Variants were synthesized in an oligo pool, assembled into an unbiased phage library using ORACLE, and passaged terrestrially on two clinically isolated E. coli strains (UTI1 and UTI2) that are resistant to wild-type T7 and are associated with urinary tract infections [69]. We evaluated these pools in efficiency of plating (EOP) experiments and compared their plaquing capability versus wildtype. The combinatorial pool from microgravity showed significant improvement in plaquing efficiency compared to wildtype and had substantially larger plaques, indicating the pool contained variants capable of significantly improving activity on these hosts (S9A and S9B Fig). The terrestrial library performed significantly worse or no better than wildtype. To confirm these results, we isolated individual plaques from the microgravity pool. From UTI1, we recovered a five-substitution variant (L490I, N502E, F507V, L533K, A539M; Variant 1), and from UTI2, a six-substitution variant (L490I, N502E, P511M, L533M, A539M, N546I; Variant 2). These variants demonstrated significantly higher EOP and produced significantly larger plaques on both UTI strains (Fig 5C and 5D). These findings support our hypothesis that microgravity-enriched substitutions can improve phage performance on terrestrial hosts. The extended incubation in microgravity revealed new mutational hotspots, enabling efficient navigation of sequence space to identify complex variant combinations with enhanced infectivity. Open to thoughts/feedback on how to proceed based on all of thisHTGAA Claude AI Tutor
Yes I want to express Variant 1 and Variant 2 of the gp17 tip domain (the microgravity-enriched multi-substitution variants) and test them against your four-strain panel, using wildtype Gene 17 as the control. Before we do that, want to get clear on if any changes will need to be made to the pET-28a + Gene 17 plasmid we just made. If yes, what changes will likely need to be made or shown? If not, can we get clear on what the function of the pET-28a + Gene 17 plasmid is? What is it showing in its current form and what should I be able to speak to about it in a final project presentation?HTGAA Claude AI Tutor
Yes that makes sense. Not sure where in the process this goes (now or sometime later) but definitely want assistance making the pET-28a + gp17-Variant1 and pET-28a + gp17-Variant2 plasmids in Benchling before the full project markdown writeup is created. Not exactly sure how to do that (specifically how to verify and determine the specific Variant amino acid substitutions engineered into the Gene 17 coding sequence for re-creation in Benchling). Based on all this information and the last paragraph in your response to the last prompt, let me know how we should proceedHTGAA Claude AI Tutor
Ok, so I have the original Gene 17 CDS fragment, as well as the pET-28a + Gene 17 plasmid open in Benchling. Believe I also understand how to make exact copies of things in Benchling. Bit unsure how we will do about editing codons for encoding the appropriate amino acids for each of the Variants. Tell me how we should proceed based on this informationHTGAA Claude AI Tutor
Not seeing an ‘Edit Sequence’ tool in my version of Benchling (could be wrong, just not seeing it). Also, shouldn’t I make a clone/exact copy of the pET-28a + Gene 17 plasmid just so the original is maintained/no unnecessary changes are made (i.e., shouldn’t a clone/exact copy be made as a sort of ‘sandbox’ for future work, so progress to date isn’t compromised)? To answer your question, yes when I look at the original Gene 17 CDS fragment, I see a string of multiple colored letters beneath the DNA sequence, which appears to be the protein sequenceHTGAA Claude AI Tutor
Is amino acid position the same as nucleotide/bp position? Let’s clarify that before we proceedHTGAA Claude AI Tutor
I see it! I see the 490th colored letter! It’s sitting between bp 1460- and 1480 in the Linear Sequence Map (corresponding roughly to the nucleotide 1468–1470 range described in the answer to the previous prompt). It’s a green L (believe this stands for the Leucine protein). Tell me if the L stands for Leucine, and more importantly, tell me how we should proceedHTGAA Claude AI Tutor
Think I’m seeing a CTC nucleotide sequence. If that doesn’t align with the standard Leucine nucleotide sequence, say so. Want to make sure this is correct before editing beginsHTGAA Claude AI Tutor
Before we move onto the editing, I’m pausing and realizing I still have the original Gene 17 fragment. I should make a copy and work off the copy before we move on to editing, correct?HTGAA Claude AI Tutor
Think we might be talking past each other/things might be getting lost in translation. For the past couple Turns/exchanges, I’ve been looking at the original Gene 17 fragment in Benching, NOT the pET-28a_gp17_Variant1, which I created based on previous instructions. Should I be working off the pET-28a_gp17_Variant1 sequence instead?HTGAA Claude AI Tutor
Ok, gotcha – in the right place. The only issue now is that there’s no amino acid translation overlay within the Gene 17 CDS annotation portion of the plasmid sequence (or the plasmid sequence as a whole). What can we do about this? How can we change this, if possible?HTGAA Claude AI Tutor
When I right click there’s a translation-related option that reads ‘Analyze as translation’. Is that good to work with?HTGAA Claude AI Tutor
When I click on ‘Analyze as translation I see the following options: –Strand: Select ‘Forward’ or ‘Reverse’ options (its default is Forward) –Genetic Code: There’s a ‘Standard’ option plus many more options based on organism type (they are numbered 1. up to 33. but there are sometimes jumps in the numbering) –A ‘Translate start codon as methionine’ check box Not sure what I should do here or if I’m in the right place. If none of this makes sense and you recommend I just click out of this option, say soHTGAA Claude AI Tutor
Yes, I have done that. I see the green L in position 490 in the Gene 17 CDS fragment. I have now completed the first substitution changing CTC to ATC (Isoleucine). Tell me how we should proceed with the next Variant 1 substitutionHTGAA Claude AI Tutor
I see a GAT 3-nucleotide codon with a D under itHTGAA Claude AI Tutor
Double checking, and yes, seeing a GAT 3-nucleotide codon with a D under itHTGAA Claude AI Tutor
Used accession number NC_001604.1 as the Gene 17 source sequence. The paper said they used ATCC:BAA-1025 as their E. coli. sequence. Believe these are the same, but am not sureHTGAA Claude AI Tutor
Here’s the paper link: https://journals.plos.org/plosbiology/article?id=10.1371/journal.pbio.3003568#pbio.3003568.ref026HTGAA Claude AI Tutor
Here’s the paper’s complete Methods section: Methods Phage and bacterial strains T7 bacteriophage was obtained from ATCC (ATCC BAA-1025-B2). The T7 DMS library used in this study was the same library stock generated in our previous work [26]. T7 acceptor phages used for ORACLE-based construction of the combinatorial libraries were also created as previously described [26]. Escherichia coli BL21 was sourced from laboratory stocks. Uropathogenic E. coli strains UTI1 and UTI2 were provided by Dr. R. Welch (University of Wisconsin, Madison) and originate from a urinary tract infection isolate collection [69]. T7 phage was initially propagated on E. coli BL21 following receipt from ATCC and subsequently on appropriate hosts as described in specific experimental sections. All phage experiments were performed using Luria-Bertani (LB) media and the same culture conditions used for bacterial hosts. Phages were stored in LB at 4 °C for short-term use. For long-term storage, microbial samples were frozen at −80 °C in 100% LB media. Media and culture conditions All bacterial strains were cultured in LB media consisting of 1% tryptone, 0.5% yeast extract, and 1% NaCl in deionized water. LB plates were supplemented with 1.5% agar, while top agar used for phage plating contained 0.5% agar. LB media was used for all experiments, including bacterial recovery and phage propagation. All incubations were carried out at 37 °C without shaking, in either terrestrial or microgravity environments as appropriate. These samples were incubated directly in cryovials and not transported to another container for incubation. Sample preparation and handling Phage and bacterial stock titer were confirmed and samples were prepared by mixing 4 mL of E. coli BL21 in exponential phase (~1 × 108 CFU/mL) with the appropriate amount of T7 phages in Rhodium Cryotubes. Samples were immediately frozen at −80 °C and shipped to NASA as described. Asynchronous microgravity and terrestrial experiments are the norm for ISS experiments due to the uncertainty of scheduling. The initial planned time points for incubation were 1, 2, and 3 hours, and 25 days; however, actual time points were adjusted on the ISS to accommodate astronaut scheduling. Final incubation time points were 1, 2, and 4 hours, and 23 days. The duration of incubation aboard the ISS was recorded precisely, and terrestrial control samples were incubated for matching durations, based on the actual timepoints rather than the proposed schedule. This approach was necessary because real-time tracking of the samples was not possible, so microgravity and terrestrial samples could not be incubated in parallel accurately. Terrestrial samples are thus frozen for a longer duration than microgravity samples. After incubation samples were refrozen, shipped to our laboratory, and then thawed at 37 °C and immediately split for genomic DNA extraction, PCR for DMS, and titering of both phage and bacteria. Titering phage For samples returned for processing, 1 mL of each sample was centrifuged at 16g for 1 min, and the supernatant was filtered through a 0.22 μm filter. To determine phage titer, titer was first estimated by spot plates and then confirmed by whole plate EOP assays. Samples were serially diluted (1:10 or 1:100) in LB to a final dilution of up to 10−8 in 1.5 mL microcentrifuge tubes. Spot assays were performed by mixing 250 μL of stationary-phase bacterial host with 3.5 mL of 0.5% top agar. The mixture was briefly vortexed and plated onto LB agar plates pre-warmed to 37 °C. Once the top agar solidified (~5 min), 1.5 μL of each phage dilution was spotted onto the plate in series. Plates were incubated at 37 °C and checked after 20–30 hours to estimate titer. Titers were then confirmed via full-plate plaque assays. For whole-plate EOP assays, 400 μL of exponentially growing bacterial culture was mixed with 5–50 μL of diluted phage, aiming to achieve ~50 plaque-forming units (PFUs) per plate after overnight incubation. For phage susceptibility on the pre-incubation and 4-hour samples, bacteria was incubated after being directly sampled from the frozen stock for that sample. The phage–host mixture was briefly vortexed and centrifuged, then combined with 3.5 mL of 0.5% top agar. After a brief vortex, the mixture was immediately poured onto LB plates pre-warmed to 37 °C. Plates were allowed to solidify (~5 min), inverted, and incubated overnight. PFUs were counted after 20–30 hours, and final phage titers were calculated from these counts. Titering bacteria Bacterial concentrations were determined via serial dilution (1:10 or 1:100 in LB) and plating. From each dilution, 100 μL was plated and spread using sterile beads to target ~50 colony-forming units (CFUs) per plate. Plates were incubated overnight at 37 °C and counted the following day. For E. coli BL21, three independent dilution series were performed to correlate OD600 values with CFU/mL and ensure accurate bacterial concentrations during phage mixing for experimental sample preparation. PCR and sequencing All PCR reactions were performed using KAPA HiFi DNA Polymerase (Roche KK2101). The combinatorial library was generated using the ORACLE method, as previously described [26]. Cloning procedures followed manufacturer instructions unless otherwise specified. For WGS, phage genomes were extracted using the Norgen Biotek Phage DNA Isolation Kit (Cat. 46800), and bacterial genomic DNA was extracted using the Norgen Biotek Bacterial Genomic DNA Isolation Kit (Cat. 17900). Genomic DNA libraries were prepared using the Illumina DNA Prep kit (Cat. 20060060) and sequenced on an Illumina NextSeq 1000 platform. PCR reactions for amplification of the DMS and combinatorial libraries used 1 μL of undiluted phage lysate directly as template (DNA isolation is not required), with an extended denaturation step of 5 min at 95 °C. For low phage titers in DMS samples, PCR and next-generation sequencing failed using this approach, presumably because of reduced template in these samples. To overcome this, we concentrated all of the remaining volume of each sample (~2 mL) approximately 100-fold using Pierce Protein Concentrators PES, 10K MWCO (Cat. 88513) and used 3 μL of the concentrated sample per PCR reaction to enabling successful amplification and analysis. For plaque analysis on UTI strains, small plaque samples were picked directly and used as PCR template. Detailed cloning protocols are available upon request. General data analysis Multiplicity of infection (MOI) was calculated by dividing the phage titer by the corresponding bacterial concentration. Initial MOI is calculated based on the bacteria and phage titer before being frozen for transit to the ISS. The MOI for the T7 DMS library was estimated using a helper plasmid, as described previously [26]. EOP values were calculated using E. coli BL21 as a reference host. EOP was defined as the phage titer on the test host divided by the titer on the reference host, followed by log₁₀ transformation. Values are reported as mean ± standard deviation (SD). Deep sequencing was performed to evaluate phage populations as described previously [26]. Phage sequencing achieved an average depth of ~49,000× per base across the genome, enabling detection of low-abundance mutations. Bacterial sequencing depth averaged ~250× per base in phage-mixed samples and ~1,300× in phage-free samples, limiting mutation analysis in the former to more abundant variants. WGS mutations were identified using Breseq [73]. For Fig 3, genes were grouped based on GO classifications [44,45]: Membrane-associated genes: GO:0016020 (Membrane), GO:0009103 (LPS biosynthesis), GO:0030288 (Outer membrane bound periplasmic space), GO:0042597 (Periplasmic space). Metabolism-associated genes: GO:0008152 (Metabolic process), GO:0019222 (Regulation of metabolic process). Statistical analysis To evaluate whether non-synonymous de novo substitutions and frameshift mutations were significantly enriched compared to synonymous substitutions, we compared the frequency of each non-synonymous substitutions and frameshift (phage: >1% abundance; bacteria: >25% abundance) to the distribution of synonymous mutations using a one-sided Mann–Whitney U test with Benjamini–Hochberg false discovery rate (FDR) correction (scipy.stats.mannwhitneyu, statsmodels.stats.multitest.multipletests, method = ‘fdr_bh’,scipy V1.10.1, statsmodel v 0.14.0) [74]. Adjusted p-values < 0.05 were considered significant. This approach assumes that after 23 days of selection the distribution of synonymous substitutions approximates either a neutral baseline or reflects minimal selective pressure, with the benefit that if there is positive selection for synonymous substitutions there would be no increase in false positives using this method. To determine whether non-synonymous de novo substitutions and frameshift mutations were more abundant in bacterial samples exposed to phage, we applied the Mann–Whitney U test (scipy.stats.mannwhitneyu, scipy V1.10.1) to compare mutation frequencies across groups [74,75]. Due to high detection limits in phage-mixed samples, we also performed left-censored data analysis using Kaplan–Meier survival curves (lifelines.KaplanMeierFitter, lifelines V0.27.8) and applied a log-rank test (lifelines.statistics.log-rank_test, lifelines V0.27.8) to assess significant differences in mutation distributions between groups [76–78]. To assess if the 4-hour bacterial population of mutations was significantly different from the pre-incubation condition, we performed Jenson–Shannon divergence (scipy.spatial.distance, jensenshannon, V1.10.1) and correlated results using Pearson R (scipy.stats, pearsonr, v1.10.1). To determine if the titer of wild-type T7 phage was significantly different between the pre-incubation and 4-hour bacterial population, we used a Welch’s t test (scipy.stats, ttest_ind_from_stats, v1.10.1). Mutation density in phage genes was calculated by dividing the number of non-synonymous de novo substitutions and frameshift mutations by the length (in amino acids) of each protein product. To assess whether any gene had significantly higher mutation density, we compared individual gene densities to the condition-specific average using a one-tailed t test with Benjamini-Hochberg FDR correction (scipy.stats.ttest_1samp, statsmodels.stats.multitest.multipletests, method = ‘fdr_bh’, alternative = ‘greater’, scipy V1.10.1, statsmodel v 0.14.0). Additionally, one-tailed 95% confidence intervals were calculated using scipy.stats.t.ppf (scipy V1.10.1) and visualized in volcano plots in python [74]. Structural visualization Structural model images were generated using the PyMOL Molecular Graphics System, Version 3.0 (Schrödinger, LLC). Gp7.3 structure was predicted using AlphaFold2 and ColabFold with MMseqs2, using the predicted structure with the highest confidence [79–81]. Electron Microscopy images were based on PDB 7BOX (gp11) and PDB 7BOY (gp12) [41]. A composite structure of the T7 portal–tail complex is shown from PDB 9JYZ [82]. Numbering for DMS and combinatorial library positions are based on PDB 4A0T [67].HTGAA Claude AI Tutor
The paper is about T7 phage evolution under microgravity. The Variants were then tested terrestrially. Those Variants were based off Gene 17 modifications. I want to make similar mutations to other E. coli. bacteriophage strains to see if we can improve their fitness/lysing. I thought I had the correct source sequence from NCBI (NC_001604.1), but am not sure.HTGAA Claude AI Tutor
Apologies, think there might be some hallucinating going on. NC_001498.1is a measles virus genome, not a T7 genomeHTGAA Claude AI Tutor
The accession number of the top result I see is NC_001604.1, which is the sequence I chose, which does have 39,937 bpHTGAA Claude AI Tutor
I counted from the start of the gp17 CDS, not the full genomeHTGAA Claude AI Tutor
I see a T nucleotide at position 490. I see a G nucleotide at position 488. There’s still a D (Aspartate/GAT) below it. Interestingly enough, positions 484-486 have a 3-codon nucleotide sequence (ACT) and a T below it. Not sure if that’s relevant whatsoeverHTGAA Claude AI Tutor
May I ask why I’m being asked to divide by 3 if the result is not a whole number (the result is 161.333333 indefinitely–not sure if that’s useful).HTGAA Claude AI Tutor
Position 388HTGAA Claude AI Tutor
Seeing a GAT 3-nucleotide sequence coding for D (Aspartate/GAT) at nucleotide position 1852-1854HTGAA Claude AI Tutor
Seeing a GAT 3-nucleotide sequence coding for D (Aspartate/GAT) at nucleotide position 1852-1854HTGAA Claude AI Tutor
Know they used E. coli. BL21. The closest things I think I could find that relates to gp17 and its mutations are the DOI links below. Not sure if these are helpful in response to answering your question https://doi.org/10.1371/journal.pbio.3003568.s005 https://doi.org/10.1371/journal.pbio.3003568.s009HTGAA Claude AI Tutor
Here you go: Mutation,Variant(s),WT Amino Acid,WT Codon,Mutant Amino Acid,Mutant Codon L490I,V1 & V2,Leucine (L),CTT,Isoleucine (I),ATT N502E,V1 & V2,Asparagine (N),AAC,Glutamic Acid (E),GAA F507V,V1 only,Phenylalanine (F),TTC,Valine (V),GTT P511M,V2 only,Proline (P),CCG,Methionine (M),ATG L533K,V1 & V2,Leucine (L),CTC,Lysine (K),AAA A539M,V1 & V2,Alanine (A),GCT,Methionine (M),ATG N546I,V2 only,Asparagine (N),AAC,Isoleucine (I),ATCHTGAA Claude AI Tutor
No ideaHTGAA Claude AI Tutor
Well, we previously changed the Leucine to Isoleucine. So that’s already been done. Should we proceed with something else.HTGAA Claude AI Tutor
I think I need to continue inducing all the mutations for both the Variants based on the table listed above and then create a project design to show how these variants would test against other strains of E. coli mentioned previously in this conversation (Turn 44, and the strains were CFT073 (UPEC), UTI89 (UPEC), and MG1655 (K-12)). How should we go from here. Think I actually might be able to re-create the mutations in separate plasmids, but am unsure about the rest of the project designHTGAA Claude AI Tutor
Do you remember the entire context of this conversation? I created a pET-28a + Gene 17 plasmid with your assistance, and the entire project will be dry lab. Not sure a Twist Bioscience order will be done, or if it’s first priority. Introducing the mutations into an existing plasmid backbone. Let me know how to proceed with the project design (moving past the Variant plasmids to testing the separate strains in dry lab/writing out how I would do this in wet lab) Let’s get clear on what I’d measure, how I’d be measuring, etc.HTGAA Claude AI Tutor
Measure the plaque assay I believe.HTGAA Claude AI Tutor
I think the original wild-type strain, right? If I’m mistaken, and there would be another more optimal control(s), let me knowHTGAA Claude AI Tutor
So I’ve created plasmids in Benchling where I re-created the original Gene 17 CDS amino acid mutations across Variants 1 and 2. I now want to make sure the proposal shows how I would test their activity against the other E. coli. strains mentioned above (CFT073 (UPEC), UTI89 (UPEC), and MG1655 (K-12)). Can we just summarize how this would occur or be written out in the project proposal, and how we’d take into account that the project in its current form is dry lab?HTGAA Claude AI Tutor
Apologies if this is a dumb question. We already expressed gp17 in a pET-28a plasmid multiple times (first as the basic plasmid with no mutations, and then as two separate plasmids showcasing respective Variant 1 and 2 mutations). So what is the nature of the question you just asked? Is there hallucinating going on, or is there something unaccounted for that you think we should delineate in the proposal?HTGAA Claude AI Tutor
Ok, thanks for the clarification. Yes, let’s add the extra level of detail and specify IPTG induction details. If you could also let me know what the IPTG acronym stands for in this context, that would be greatly appreciated alsoHTGAA Claude AI Tutor
Generate proposalHTGAA Claude AI Tutor
Apologies, but saw reference to T4 in the proposal. Believe we meant to say T7. Mind editing the proposal accordingly? If this notion is incorrect, say soHTGAA Claude AI Tutor
In the source paper on which this project is based, the researchers say “Here, we report the dynamics between T7 bacteriophage and Escherichia coli in microgravity aboard the International Space Station (ISS)”. So think the intention is that we’re working with T7. There’s no mention of bacteriophage T4 anywhere in the original paper (see link below): https://journals.plos.org/plosbiology/article?id=10.1371/journal.pbio.3003568#sec009HTGAA Claude AI Tutor
Yes, regenerate the full corrected proposal now with T7 substituted throughoutHTGAA Claude AI Tutor
Apologies, but the fully corrected proposal with the T7 substitutions appears as one continuous scroll/blob of Markdown. Do you mind re-formatting the content so it looks like the format of the Turn 86 response, with similar spacing and item verification? The content itself does not and should not change – just how it’s formatted/presentedHTGAA Claude AI Tutor
Ok. Thank you for creating this. I’ve read through the project proposal and have some questions. If you can’t address them or respond to them, all good. –Can you remind me what the pET-28a plasmid vector stands for? Why is it useful or necessary? Is it right to call it a plasmid vector or is another term more technically appropriate? –Would you mind explaining each step of the Experimental Design in relatively simple terms, as if I was a reasonably educated 17 year old with some bio knowledge, but who is still a bio n0ob in the grand scheme of things. Explain the following as part of this ask: -the why(s) behind each step -the logical flow/progression of one step to the next -what we’re measuring as part of this Experimental Design, how we’re measuring it, and what types of graphs or images we’d traditionally use to do said measuring -how we’re ultimately testing the fitness of the microgravity-based Variants against the CFT073, UTI89, and MG1655 E. coli. strainsHTGAA Claude AI Tutor
It looks like the answer to the first question got cut off a bitHTGAA Claude AI Tutor
Ok. Thank you for describing this. Before we move on, can we describe why we specifically chose a pET-28a expression vector for this specific Experimental Design? What is the logic behind it? If we want to test microgravity-based Variants against the CFT073, UTI89, and MG1655 E. coli. strains, why must we put the T7 Gene 17 CDS into a plasmid first? Do NOT hallucinate/make things up when replying to this promptHTGAA Claude AI Tutor
Thanks – helpful. Let’s move on to the second question (as a reminder, this second question is to explain each step of the Experimental Design in relatively simple terms, as if I was a reasonably educated 17 year old with some bio knowledge, but who is still a bio n0ob in the grand scheme of things). As part of this ask, explain the following: -the why(s) behind each step -the logical flow/progression of one step to the next -what we’re measuring as part of this Experimental Design, how we’re measuring it, and what types of graphs or images we’d traditionally use to do said measuring -how we’re ultimately testing the fitness of the microgravity-based Variants against the CFT073, UTI89, and MG1655 E. coli. strainsHTGAA Claude AI Tutor
Taking a look at Turn 90. It says that it outputted 15 Experimental Steps, but it only outputted 12. Complete the rest of the Experimental Steps by listing out the remaining 3 steps. Reference previous content in this chat to construct the Experimental Setup with all 15 steps Do NOT hallucinate/make things up when replying to this promptHTGAA Claude AI Tutor
Looking at Steps 14 and 15 in the last prompt, approximately how long do we think it should take to complete these Steps? Do NOT hallucinate/make things up when replying to this promptHTGAA Claude AI Tutor
There are multiple types of T7 bacteriophage right? In this paper, the researchers only used a specific type of T7 bacteriophage that infects E. Coli, correct? Indicate any areas where my reasoning/thinking is off and do NOT hallucinate/make anything up when replying to this promptGemini
Just so we’re clear, the type of E. Coli. T7 bacteriophage studied in this paper is NOT the only type of E. Coli. T7 bacteriophage out there, correct? Do NOT hallucinate/make things up when replying to this threadGemini
Liking these results, but would like to find another E. Coli. T7 bacteriophage, potentially one that’s a bit unorthodox/out of the box to BLAST, that would likely still have a 95% match. Any thoughts about what these might be/how to proceed? Do NOT hallucinate/make things up when replying to this promptGemini
Going off the last prompt, how would I run a comparative BLAST against this specific gene and analogous examples listed above? Do NOT hallucinate/make things up when replying to this promptGemini
After running the BLAST (including Blastn) the results are less than < 95%. The highest % was 89% for T3 (NC_003298.1) via Megablast. Any other thoughts about where/how to find somewhat unorthodox E. Coli. T7 bacteriophage candidates in the 95%+ range? Do NOT hallucinate/make things up when replying to this promptGemini
Looking over the paper again, confirming that the gene associated with the respective 5 and 6 substitution variants referenced in the paragraph before the ‘Discussion’ section is Gene 17, correct? Slightly confused about how that works or relates to the following phrase in the ‘Discussion’ section: “In microgravity, structural genes gp7.3, gp11, and gp12 emerged as particularly important,”. Do NOT hallucinate/make things up when replying to this promptGemini
Help me understand what I’m seeing. What does the ‘L’ in matches with an ‘L’ at the end (ex. ‘Mutant Escherichia phage T7 clone T7_90L’) mean? What does the ‘S’ in matches with an ’s’ at the end (ex. ‘Mutant Escherichia phage T7 clone T7_50S’) mean? Do NOT hallucinate/make things up when replying to this promptGemini
Want to understand which of these results derive from a different strain of E. Coli. than the one referenced in the paper (ATCC BAA-1025-B2). Is it all of them? None of them? A bit confused. Tell me what I should be looking for or if my thinking is off here. Do NOT hallucinate/make things up when replying to this threadGemini
For the result for Sequence ID: MZ375271.1, it says Range: 32650 to 34311. How do I find this in the raw FASTA file for this sequence? Do NOT hallucinate/make things up when replying to this promptGemini
How far back in this chat can you go? Want to re-surface the results of the prompt that asked about the specific gp17 mutations that took place in each of the Variants. Want to understand which nucleotides and amino acids to change to re-create the mutations found in Variants 1 and 2. Do NOT hallucinate/make things up when replying to this threadGemini
Based on the paper in the shared tab, can you tell me what strain of E. Coli. the University of Wisconsin, Madison researchers tested their bacteriophage against? Believe it was BL21 but want to confirm. Do NOT hallucinate/make things up when replying to this promptGemini
Thank you. While I understand some combinatorial work was used to create Variants 1 and 2 in the paper in the tab, can you explain how I would simply explain how the Variants were created in a phrase approximately the length of a Tweet? Would something like, ‘Variants 1 and 2 were created via a combinatorial approach deriving from nth mutations, with down selection for the highest PFU/mL’ technically make sense? Do NOT hallucinate/make things up when replying to this promptGemini
Why did the Variant 1 and Variant 2 bacteriophage Gene 17 T7 tail fiber substitutions seem to have higher infection rates against terrestrial UTI? What exactly about Gene 17 and the tail fiber substitutions specifically seemed to be so special/useful in achieving this higher infectivity rate? What other microgravity-derived mutations outside of Gene 17 might also help improve E. Coli. bacteriophage infectivity rate going forward (i.e., if I was going to test different microgravity derived genetic mutations/amino acid substitutions, what would make sense)? Do NOT hallucinate/make things up when replying to this promptGemini
In the E. Coli. bacteriophage genome, what genes are gp7.3, 11, and 12 associated with? Do NOT hallucinate/make things up when replying to this promptGemini
Tell me how the researchers for this paper created the Variants in 2-3 sentences. Do NOT hallucinate/make things up when replying to this promptGemini
When we say microgravity unlocks synergistic mutations in the E. Coli bacteriophage, what exactly do we mean by this? Explain in 3-4 sentences. Do NOT hallucinate/make things up when replying to this promptGemini
If i want to locate the position of gene 17 in e coli t7 bacteriophage, how do I do that?Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
Can you point me to or create an image showing the ’tree of life’ of the phage kingdom of life? Want to visually see the common genetic ancestor(s) or T7 bacteriophage and D29 mycobacteriophage. Want to see a pictorial overview of the breakdown of life in the phage kingdom. If this does not exist/if this is not grounded in scientific fact, say soDo NOT hallucinate/make things up when replying to this promptGoogle AI Mode
Give me a visual for the last bullet point to drive home the point in basic terms. Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
Not seeing the transduction visualGoogle AI Mode
Working on some research to show similar Gene 17 mutations (the ones that created Variants 1 and 2 in the attached paper) in a different yet similar bacteriophage based off the bacteriophage in this paper (ATCC BAA-1025-B2). Been told to look for a T7 look-alike phage lysate for Gene 17 of the following E. coli strain which I believe I’ve done via BLAST. Found GenBank: MZ375271.1 as a potential candidate. I’ve also been told to go look for phages for DNA extraction, to use AlphaFold for validation of the relevant structural mutations, and I ultimately need to design primers for polymerase chain reaction (PCR) for rebooting the phage.Where does cphages fit into all this? What does it mean to extract DNA based from cphages? How does all this (cphages, AlphaFold) inform the designing of primers for PCR?Do NOT hallucinate/make things up when replying to this prompt. If my thinking is unclear, wrong, or doesn’t make sense in any part of the prompt, say soGoogle AI Mode
phage dna databaseGoogle AI Mode
If I have a fragment of a sequence in NCBI (i.e., a specific gene that’s part of a larger NCBI sequence), how do I import that specific fragment into Benchling in such a way that I preserve any and all existing annotations? Do NOT hallucinate/make anything up when replying to this threadGoogle AI Mode
Can the Cocktail program referred to in the second category (Simulation of Lysing Rates and Kinetics), work on a Mac? If the answer’s no, all good. Just let me know. Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
Is a bacteriophage a virus or an actual living organism? If it is one of these two things, why is this the case? Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
Are there any websites out there for verifying a plasmid relative to a designated function (ex. if I want a plasmid to do X function, can I upload a file and have the web service determine whether I have the right number of base pairs or parts for that function)? Do NOT hallucinate/make things up when replying to this threadGoogle AI Mode
If I want to test a fragment of mutated Gene 17 T7 bacteriophage phage DNA against several different strains of E. coli bacteria, what are the core pieces I need in my plasmid? Right now I have the following:–T7 Terminator–T7 Promoter–Ribosome Binding Site (RBS)–Multiple Cloning Site (MCS)–ATG start codon annotation–Lac operator–Thrombin site–2 6xHis tags–Gene 17 Coding Sequence (CDS)–Gene 17 Amino Acid TranslationIs there anything I’m glaringly missing? Anything(s) that seem off relative to my goal? Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
Helpful. The aim here is to test for a phage complementation/infection/lysing assay against CFT073, UTI89, and MG1655 E. coli strain. sDo NOT hallucinate/make things up when replying to this promptGoogle AI Mode
See 1st prompt.The aim here is to test for a phage complementation/infection/lysing assay against CFT073, UTI89, and MG1655 E. coli strains. Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
So when I’m replacing these components, do I essentially look up their FASTA files, insert them into the plasmid sequence as needed, and annotate them accordingly? Is there any location-specific information I should know about where to place some of the items included in the list in the response to the last prompt? Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
Explain how I se the strict 5’ –> 3’ order in a Benchling sequence. Also explain to me how I can discern the orientation of my Backbone in a Benchling sequence. Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
Tell me what the ‘Run Primer3’ option in Benchling does. Do NOT hallucinate/make things up when replying to this threadGoogle AI Mode
Show me publicly accessible examples of E. coli. bacteriophage genome fragment primers assembled in Benchling for Gibson Assembly. Want to understand how these are constructed.Do NOT hallucinate and/or make things up when replying to this promptGoogle AI Mode
What is a wordlist in Benchling? What does it do/what’s its function?Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
When creating a Gibson Assembly Construct in Benchling both the Backbone and Insert should have the same orientation, correct? Believe this is the case (or usually the case), but just want to verify. Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
if i’m growing bacteria on agar (example e. coli strains) how do I know when they’ve reached log phase?Google AI Mode
pfu/ml graphGoogle AI Mode
It’s true that if I just write out a string out letters representing an amino acid sequence, I cannot determine the exact amino acid sequence based on those letters because a single letter can stand for multiple amino acids, correct? Isn’t additional context needed?. Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode
The Nanodrop tool for measuring DNA quantities in biology is a type of spectrophotometer, correct? Do NOT hallucinate/make things up when replying to this prompt. Reply to this prompt based on the knowledge at hand about the Nanodrop toolGoogle AI Mode
ug/mLGoogle AI Mode
In the context of E. coli. bacterial strains, what does the acronym UPEC stand for? Believe it stands for Uropathogenic E. coli., but want to confirm. Moreover, when testing bacteriophage fitness/lsying (PFU/mL), why does testing against UPEC E. coli. bacteria strains matter?Do NOT hallucinate/make things up then replying to this promptGoogle AI Mode
if i’m growing bacteria on agar (example e. coli strains) how do I know when they’ve reached log phase?Google AI Mode
Remind me again what log phase means within the context of growing bacteria on agar (example E. coli strains). Do NOT hallucinate/make things up when replying to this promptGoogle AI Mode

  1. https://journals.plos.org/plosbiology/article?id=10.1371/journal.pbio.3003568#sec002 ↩︎

  2. Ibid. ↩︎

  3. https://www.frontiersin.org/journals/microbiology/articles/10.3389/fmicb.2025.1680651/full ↩︎

  4. 10 µl Gibson Assembly Master Mix (2X), 0.2–1.0 pmoles of V1 and V2 DNA fragment, and 10 µl deionized water (see NEB Gibson Assembly Protocol↩︎

  5. 0.3 mM of additional dNTPs, 0.5–4% PEG 8000, V1 and V2 fragments, 9 µL of Pro Master Mix, and water if needed should add up to 12 µL (see Arbor Biosciences myTXTL guidance↩︎

  6. A traditional formula for calculating PFU/mL is PFU/mL = number of plaques / (dilution factor * plated volume in mL) ↩︎ ↩︎

  7. ANOVA traditionally conducted via 6-part process: 1) Calculate raw data 2) Calculate group means 3) Calculate overall mean 4) Compute sum of squares between groups 5) Compute sum of squares within groups 6) Calculate F-statistic (see 6sigma↩︎ ↩︎

Group Final Project

Gemini_Generated_Image_m0isq4m0isq4m0is Gemini_Generated_Image_m0isq4m0isq4m0is

Bacteriophage Engineering Group Project Inputs_William & Mary Node Group 1 2

Group Project_Protein Design 1

  • Selected Goal: Increased stability (easiest)

  • Brainstorm Session Questions:

    • Which tools/approaches from recitation you propose using (e.g., “Use Protein Language Models to do in silico mutagenesis, then AlphaFold-Multimer to check complexes.”)
      • We’ll attempt to run multi-environment/conditional modeling and simulation to down-select lysis stability approaches that show the greatest resilience across environments/conditions.
      • The team has selected a project focused on enhancing the stability of the Lysis Protein, a decision influenced by the group’s current experience level. The primary objective is to improve thermodynamic stability while concurrently preserving the native protein fold and maintaining functional integrity. The proposed methodology involves utilizing BLAST for identifying homologous sequences, followed by Clustal Omega to ascertain conserved residues susceptible to mutation intolerance. Subsequently, ESM2 will be employed to score candidate substitutions based on evolutionary plausibility. This will be succeeded by the application of ESM-Fold to predict and refine the integrity of the protein fold, as well as to optimize existing backbones. The results may then be further subjected to EvolvePro for accelerated directed evolution. Tools like Boltz-1 and ProteinMPNN offer a capability for redesigning solvent-exposed residues and optimizing the core packing of the protein. We can cross their performance for comparison. All selected variant candidates are slated for computational stress-testing under a range of environmental conditions that could potentially induce destabilization. Selected variant candidates that pass the stress test are prioritized for downstream experimental validation.
    • Why do you think those tools might help solve your chosen sub-problem?
      • The previous bullet point addresses tool functionality in our workflow, explaining why and how various tools will assist us in accomplishing our goal
    • Name one or two potential pitfalls (e.g., “We lack enough training data on phage–bacteria interactions.”).
      • One potential pitfall is that we may have insufficient in vitro quality and quantity of data to test the environmental constraints of interest. Thus wet-lab work would be needed to back-up the findings, in addition to follow-up
      • There are open questions regarding the validity of the stated research approach (i.e., if the approach makes sense relative to the larger goal of increased stability)
    • Include a schematic of your pipeline
      • See workflow schematic below
        • Screenshot_2026-05-19_Workflow Screenshot_2026-05-19_Workflow

Group Project_Protein Design 2 3

  1. See results below

  2. Notebook Inputs:

  • Inputted L-Protein Mutants.csv file for analysis
    • Noted Encounter Issues and Resolutions:
      • Part 12 involved a step wherein the cell would be run and there would exist a prompt by which an upload of the “L-Protein Mutants - Sheet1.csv” was required. The current “L-Protein Mutants” file offered in the laboratory was listed as an excel file. We proceeded by saving the data into a .csv file that reflects the desired file name and uploading.
  1. Utilized experimental data [4]

  2. Experimental Correlation Results

  • The results below indicate poor correlation between the experimental data and the scores from the notebook. The values indicate high levels of uncertainty between the experimental data and the notebook scores. These results indicate that:
    • Screenshot_2026-05-19_Workflow2 Screenshot_2026-05-19_Workflow2
  1. 5 Mutations
  • A Heatmap of predicted mutations was given. The following mutations are chosen in coordinate form. While yellow indicates a high ratio, it shouldn’t be taken fully at face value.
    • Xavier Results
      • Screenshot_2026-05-19_Workflow_Xavier Screenshot_2026-05-19_Workflow_Xavier
      • Chose the using the Predicted Effects Graph (allows for a first pass)
        • Soluble-Region: Y39 (L), F5 (S)
        • Transmembrane Region: N53, E61, T52 (All L)
    • Raphael Results
      • The following are mutations propositions based on the Predicted Effects Graph:
        • Soluble Region:
          • F5Q: Clusal Omega shows that the 5 position is optimal for change as it is frequently switched. ESM-2 deems this mutation at this position to have the most promising score (1.795244).
          • F5P: Clustal Omega shows 5 position as frequently changing. ESM-2 deems this mutation as third best for position 5 (1.596891).
        • Transmembrane Region:
          • E61L: Clustal Omega shows high variance at position 61. ESM-2 demonstrates a high score of 1.818098.
          • F47L: Clustal Omega shows high variance at this position, showing the protein is most likely to retain functionality after a mutation here. ESM-2 demonstrates a decent positive score.
        • Free:
          • F5S, K50L, E61L: F5S mutation is supported by the Clustal Omega results as it is shown across multiple species. The K50L and E61L mutations are not supported as much by Clustal Omega but show high results in ESM-2.
    • Jason Results
      • Screenshot_2026-05-19_Workflow_Jason Screenshot_2026-05-19_Workflow_Jason
      • Soluble Region:
        • F5_R: Potentially reduces protein aggregation risk, increases solubility via Arginine inclusion
        • S9_Q: Potential glutamine inclusion could lead to more stable hydrogen bonds
        • C29_R: Current cysteine prone to potential misfolding. Arginine could improve solubility, potentially preventing clumping or misshapen configurations
      • Transmembrane Region:
        • L44_I: Increased isoleucine density might increase thermodynamic stability
        • A62_V: Valine hydrophobicity might help protein orientation and improve lipid piercing
    • Nana Results
      • Soluble Region:
        • Position 5 : F -> Q ( 1.79524445533752)
        • Position 17: N -> R (1.32365107536315)
      • Transmembrane Region:
        • Position : 40 V -> L ( 1.79524445533752)
        • Position 50 K -> L (2.56146419048309)
        • Position 65 R -> L (1.0260357856750488)
      • Mutants:
        • Mutant 1: METRQPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT
        • Mutant 2: METRFPQQSQQTPASTRRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT
        • Mutant 3: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYLLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT
        • Mutant 4: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT
        • Mutant 5: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVILTVTTLQQLLT
  1. Generated Multimeric Assemblies
    • Xavier Results
      • Oligomer: METRSPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLLAVIRTVTTLQQLLT
      • Chain Separated Based on:
        • Chain A: F5S: position 5, F → S

        • Chain B: Y39L: position 39, Y → L

        • Chain C: T52L: position 52, T → L

        • Chain D: N53L: position 53, N → L

        • Chain E: E61L: position 61, E → L

        • METRSPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

        • METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

        • METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLLQLLLSLLEAVIRTVTTLQQLLT

        • METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT

        • METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLLAVIRTVTTLQQLLT

      • Sequence Coverage Map
        • Screenshot_2026-05-19_Workflow_Xavier_2 Screenshot_2026-05-19_Workflow_Xavier_2
      • Predictions
        • Screenshot_2026-05-19_Workflow_Xavier_3 Screenshot_2026-05-19_Workflow_Xavier_3
      • Display 3D Structure
        • Screenshot_2026-05-19_Workflow_Xavier_4 Screenshot_2026-05-19_Workflow_Xavier_4
      • Plots
        • Screenshot_2026-05-19_Workflow_Xavier_5 Screenshot_2026-05-19_Workflow_Xavier_5
    • Raphael Results
      • F5Q:
        • Screenshot_2026-05-19_Workflow_Raphael_1 Screenshot_2026-05-19_Workflow_Raphael_1
        • Screenshot_2026-05-19_Workflow_Raphael_2 Screenshot_2026-05-19_Workflow_Raphael_2
      • F5P:
        • Screenshot_2026-05-19_Workflow_Raphael_3 Screenshot_2026-05-19_Workflow_Raphael_3
        • Screenshot_2026-05-19_Workflow_Raphael_4 Screenshot_2026-05-19_Workflow_Raphael_4
      • E61L:
        • Screenshot_2026-05-19_Workflow_Raphael_5 Screenshot_2026-05-19_Workflow_Raphael_5
        • Screenshot_2026-05-19_Workflow_Raphael_6 Screenshot_2026-05-19_Workflow_Raphael_6
      • F47L:
        • Screenshot_2026-05-19_Workflow_Raphael_7 Screenshot_2026-05-19_Workflow_Raphael_7
        • Screenshot_2026-05-19_Workflow_Raphael_8 Screenshot_2026-05-19_Workflow_Raphael_8
      • F5S, K50L, E61L:
        • Screenshot_2026-05-19_Workflow_Raphael_9 Screenshot_2026-05-19_Workflow_Raphael_9
        • Screenshot_2026-05-19_Workflow_Raphael_10 Screenshot_2026-05-19_Workflow_Raphael_10
          • RESULTS: Mutation 5 (F5S, K50L, E61L) produced very promising results. It seems that the soluble region cannot be improved (most likely due to its disordered nature which prevents it from forming a tangible final structure). But when the K at position 61 is changed into an L, the transmembrane region improves greatly. The stats for this rank are the following: pLDDT=62.4 pTM=0.565 ipTM=0.558.
            • Multimeric Assembly:
              • METRSPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLLAVIRTVTTLQQLLT:METRSPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLLAVIRTVTTLQQLLT:METRSPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLLAVIRTVTTLQQLLT:METRSPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLLAVIRTVTTLQQLLT:METRSPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLLAVIRTVTTLQQLLT
    • Jason Results
      • Original Wild-Type Sequence 3D visualization and Sequence Coverage Map
        • Screenshot_2026-05-19_Workflow_Jason_2 Screenshot_2026-05-19_Workflow_Jason_2
        • Screenshot_2026-05-19_Workflow_Jason_3 Screenshot_2026-05-19_Workflow_Jason_3
      • Multimeric Assembly based on mutations listed in 5.
        • METRRPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPRRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFIAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLVEVIRTVTTLQQLLT
          • Multimeric Assembly Sequence 3D visualization and Sequence Coverage Map
            • Screenshot_2026-05-19_Workflow_Jason_4 Screenshot_2026-05-19_Workflow_Jason_4
              • Unfortunately it appears that my introduced mutations did not improve the lysis abilities of the L protein based on the results above
    • Nana Results
      • Multimeric Assembly: METRQPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTRRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYLLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVILTVTTLQQLLT

All of Jason’s supporting prompts for this work listed below

Supporting PromptModel
In the final 2 cells, what does the ’effect_esm’ variable mean? What do these numbers indicate from a scoring standpoint? How do they fit into a larger context regarding mutated amino acid efficacy? Do NOT hallucinate when answering this promptGemini
Tell me where (i.e., in which cell) the 2.56 mutation value is located. Do NOT hallucinate when answering this promptGemini
I want you to go back to the following item from the response from 2 prompts ago: “n your notebook, you have a cell uploading ‘L-Protein Mutants - Sheet1.csv’, which contains experimental data like “Lysis” and “Protein Levels.” The goal of calculating effect_esm is often to see if the high model scores correlate with high experimental activity (efficacy) in the lab” Based on the effect_esm scores located in the final 2 cells, help interpret if or how the high model scores correlate with high experimental activity (efficacy) in the lab. Explain why there is (or isn’t correlation) based on these scores, and the underlying rationale(s) behind any/all correlation or lack thereof Do NOT hallucinate when answering this promptGemini
In the cell containing ‘interactive_heatmap(protein_sequence)’ there’s a graph titled ‘Predicted Effects of Mutations on Protein Sequence (LLR)’. How is this graph supposed to be read? How does one find the transmembrane and soluble regions from this graph (if that’s something one can find on this graph)? If coordinates with a single letter and 2 digits (ex. K32) can be discerned from this graph, how can they be discerned? Do NOT hallucinate when answering this promptGemini
METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT Take the protein sequence above and confirm that the first 40 positions (1-40) are the soluble region and positions 41-75 are the transmembrane region. If this is correct, explain why, and if this is incorrect, explain why Do NOT hallucinate when answering this promptGemini
Ok. So if I see a vertical selection in the ‘Predicted Effects of Mutations on Protein Sequence (LLR)’ graph located in the cell containing ‘interactive_heatmap(protein_sequence)’ that seems to have a mostly yellow-ish or light green hue to it, what does that mean? What does it imply for nth mutations that could occur at that specific position in the sequence? Do NOT hallucinate when addressing this promptGemini
If the first position in the following sequence shows up as a dark blue/almost purple color in the ‘Predicted Effects of Mutations on Protein Sequence (LLR)’ graph located in the cell containing ‘interactive_heatmap(protein_sequence)’, does that indicate a conserved region, or a region that should NOT be subject to amino acid mutations? Do NOT hallucinate when answering this promptGemini
Ok. So based on that logic, where/how do I find other conserved regions/essentially no go areas for amino acid mutations based on the information located in the ‘Predicted Effects of Mutations on Protein Sequence (LLR)’ graph located in the cell containing ‘interactive_heatmap(protein_sequence)’? Are these indicated by blue-ish or purple horizontal bands emanating from particular amino acid mutations located on the Y axis of the graph? Clarify these questions Do NOT hallucinate when answering this promptGemini
Yes, identify the coordinates of these solid dark blue vertical columnsGemini
Ok. I’d like you to take all the logic leading up to the creation of the ‘Predicted Effects of Mutations on Protein Sequence (LLR)’ graph located in the cell containing ‘interactive_heatmap(protein_sequence)’ and extend that to a new cell at the bottom of this notebook containing an almost 100% identical ‘Predicted Effects of Mutations on Protein Sequence (LLR)’ graph compared with the ‘Predicted Effects of Mutations on Protein Sequence (LLR)’ graph located in the cell containing ‘interactive_heatmap(protein_sequence)’. The only difference is that I want visual indicators (maybe vertical red lines) indicating the beginnings and ends of the respective soluble and transmembrane regions of the sequence. This would make it easier to distinguish things in the graph. Leave all other code in the notebook untouched. Just extend the code behind the creation of the ‘Predicted Effects of Mutations on Protein Sequence (LLR)’ graph located in the cell containing ‘interactive_heatmap(protein_sequence)’ and its underlying logic to a new cell at the bottom of this notebook. Do NOT hallucinate when creating this codeGemini
Ok. So taking a look at the ‘Predicted Effects of Mutations on Protein Sequence (LLR)’ graph in the penultimate cell with the soluble and transmembrane regions, it looks like the following mutations are promising/favored: –Soluble Region (First F): Amino Acid Mutation Q –Soluble Region (First S): Amino Acid Mutation Q –Transmembrane Region (First C): Amino Acid Mutation L –Transmembrane Region (First C): Amino Acid Mutation R If you can give specific graph coordinates for each of the mutations listed above, do so. If there isn’t enough granularity in what was written above, indicate as such. Do NOT hallucinate when addressing this promptGemini
Apologies, not understanding the following: –How is it that C29 sits in the Soluble N-terminal region if the positions on the graph indicate it is within the Transmembrane region? Is there something wrong with the graph? How can these points be reconciled? –Not seeing a second C at position 65 within the wild-type sequence (METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT) Do NOT hallucinate when replying to this prompt. If you are at risk of hallucinating, indicate as suchGemini
Ok. So not exactly following the logic behind the placement of the dashed lines indicating the positional start and the ends of the soluble and transmembrane regions based on the X axis information. By that logic it visually looks like the first C located within the wild-type sequence (METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT) falls right inside the transmembrane region. Clarify what’s going on Do NOT hallucinate when answering this promptGemini
Yeah that’s the issue. Taking a look at this excerpt from the answer to the last prompt and seeing the essence of the issue: “You will find that the C is the 29th letter. If the red line is to the right of that C, then the C is correctly in the Soluble region.” The red line is to the left of the C in question. Clarify what’s going on here Do NOT hallucinate when answering this promptGemini
Yes, please provide this code blockGemini
Please explain this error:Gemini
For the mutations that are favored/more yellow colored in the ‘Corrected Protein Regions: Soluble v. Transmembrane’ graph located in cell ‘0ZrSuXEGIzsR’, what is the biological logic/rationale behind why the model is giving these mutations yellow colors? Is it binding ability counterbalanced against potential damage to the protein structurally or negative therapeutic effects (toxicity, etc.)? Help clarify this (or these) biological logic/rationales Do NOT hallucinate when addressing this promptGemini
To clarify, when we say the term ‘residue’ in the context of proteins, are we referring to amino acid positions located within the wild-type sequence (METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT)? Do NOT hallucinate when addressing this promptGemini
Ok. Tell me about the following residues (including their formal names) and why mutating them would or might make sense or would be favorable within the context of the wild-type sequence (METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT): –Soluble Region: F5, S9, C29 –Transmembrane Region: K50 Do NOT hallucinate when addressing this promptGemini
Might there be a similar K50L-style trade-off for E61L? Why or why not? Do NOT hallucinate when addressing this queryGemini
So according to the ‘functional defect’ logic described during the course of the last 2 prompts, which 2 alternate yellow-ish colored mutations located in the Transmembrane region would be ideal for mutation, that would NOT hinder lysing abilities (i.e. ability to kill desired cells)? Do NOT hallucinate when addressing this promptGemini
The residue in location 52 is labeled T. Is that Alanine? Did you mean residue 62 when describing Alanine in your reply to the last prompt?Gemini
My only concern with these chosen mutations in the transmembrane region is that they’re not exactly yellow. They seem to be shades of lighter green, which isn’t outright blue, but still not exactly screamingly positive Do NOT hallucinate when addressing this promptGemini
Think the following mutations might be worth pursuing based on their color (see ‘Corrected Protein Regions: Soluble v. Transmembrane’ graph in penultimate cell in workbook as reference): Reference on how to read what I wrote regarding the ‘Soluble Region’ and ‘Transmembrane Region’ below: LETTER[NUMBER] (X Axis)_Letter (Y Axis) Soluble Region: –F5_R –S9_Q –C29_R Transmembrane Region: –L44_I –A62_V This is all based on the following wild-type sequence (METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT) Want to go beyond color justification to talk about the benefits of each mutation from a structural and/or functional standpoint Do NOT hallucinate when addressing this promptGemini
What is a thiol group in simple terms? Why would the swap out of the Cytesine for Ariginine in C29 –> R be useful due to Arginine’s positive charge? Explain in simple termsGemini
What is the lipid bilayer? How does it relate to A62_V?Gemini
How do I make a multimeric assembly based on mutations to the wild-type sequence located under the ‘Input protein sequence(s), then hit Runtime -> Run all’ cell? Do I just add each mutated sequence next to each other separated by colons and go from there? Do NOT hallucinate when addressing this queryGemini
Ok. Here’s my wild-type sequence: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT Output 5 individual/separate mutated sequences based on the wild sequence above on the following modifications per individual/separated sequence: –Change the ‘F’ in the 5th position left of the 1st ‘M’ to an ‘R’ –Change the ‘S’ in the 9th position left of the 1st ‘M’ to a ‘Q’ –Change the ‘C’ in the 29th position left of the 1st ‘M’ to an ‘R’ –Change the ‘L’ in the 44th position left of the 1st ‘M’ to an ‘I’ –Change the ‘A’ in the 62nd position left of the 1st ‘M’ to a ‘V’ Do NOT hallucinate when addressing this promptGemini
Thank you. What does the ‘Sequence coverage’ graphic under the ‘Run Prediction’ cell mean/display exactly? Do NOT hallucinate when addressing this promptGemini
What do the results located under the ‘Run Prediction’ and ‘Display 3D structure’ cells indicate about the mutated sequences inputted? Are they strong or weak in combination relative to the goal of improving the stability and autofolding of the Lysis protein in the MS2 bacteriophage (from which the original wild-type sequence originated). I believe the results seem to be suboptimal based on the shape and color outputted in the ‘Display 3D structure’ cell but I’m not sure if that’s the case, and if it is, why that’s the case Do NOT hallucinate when addressing this promptGemini

  1. This Bacteriophage Engineering Group Project was completed by a select group of William & Mary Node students in March 2026 (Xavier Lewis-Palmer, Raphael Aca, Nana Agyei Afrane-Asare, and Jason Ross) ↩︎

  2. This is a Markdown version of the “HTGAA_Bacteriophage Engineering Group Project Brainstorming Doc.__William & Mary Node” Google Doc. (https://docs.google.com/document/d/1676c1tgFUlGaP-Bwp9_vDexbk3VsOJeuQeylNfvz76o/edit?usp=sharing↩︎

  3. Based on Opt. 1: Mutagenesis workflow in Protein Design II - Phage HW Sheet (https://docs.google.com/document/d/e/2PACX-1vSKF3Q5PY_T-McPiQoCVr6A9HpUxHedSAPmqikf9pHeoMM1Xt_EDAKOuUR0WlNMP-TZAMErUPbARhGh/pub↩︎