https://pages.htgaa.org/2026a/joe-krushelnick/homework/week-5-hw-protein-design-ii/index.htmlPart A: Generate Binders with PepMLM Begin by retrieving the human SOD1 sequence from UniProt (P00441) and introducing the A4V mutation. Sequence with mutation: MATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTS AGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVV HEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ Using the PepMLM Colab linked from the HuggingFace PepMLM-650M model card: Generate four peptides of length 12 amino acids conditioned on the mutant SOD1 sequence. WRYYAAALRHKG WRYYAVAARHKK WRSYVVVLELGG HHYPAVAVALKG FLYRWLPSRRGG To your generated list, add the known SOD1-binding peptide FLYRWLPSRRGG for comparison. Part BHugoen