Individual Final Project

cover image cover image

Abstract

Clear glass has been crucial to the development of modern architecture, with windows and clear glazing being a major catalyst for indoor living. However this dependence on clear glass has also created a dependence on new material, from a specific and limited sand for glass making, as well as high energy use to fire and float form the sand into glass panes. This project aims at exploring a biological alternative to glass panes, as well as developing the scientific results that could point to future work that uses this biosilica for novel materials, both aggregated with construction waste and as a pure material out of diatom blooms. Diatoms are a type of algae that have silica cell walls called frustules, and these frustules form into intricate lacy, opalescant patterns as the colonies of algae grow. Cylindrotheca fusiformis is a marine diatom species that relies on proteins including silaffins for silicic acid polymerization. By modifying the proteins that are responsible for the diatom structure, this project opens up the mechanical properties of diatoms as a material, where structure is responsible for color expression and for potential material attachment and other characteristics for future projects.

Project Aims

  1. Protein Modification Modify the Sil1p protein of Cylindrotheca fusiformis through cell-free systems. In this aim, I am interested in observing a change of the cell-free system after Sil1p modification from the original sequence. The modification would aim to either overexpress the polymerizing protein, or supress it and see the potential shifts that emerge from those DNA modifications. These shifts would be tested using florescent tagging.

Sil1p c.fusiformis sequence and protein structure without modification:

MKLTAIFPLLFTAVGYCAAQSIADLAAANLSTEDSKSAQLISADSSDDASDSSVESVDAASSDVSGSSVESVDVSGSSLESVDVSGSSLESVDDSSEDSEEEELRILSSKKSGSYYSYGTKKSGSYSGYSTKKSASRRILSSKKSGSYSGYSTKKSGSRRILSSKKSGSYSGSKGSKRRILSSKKSGSYSGSKGSKRRNLSSKKSGSYSGSKGSKRRILSSKKSGSYSGSKGSKRRNLSSKKSGSYSGSKGSKRRILSGGLRGSM

source: https://www.uniprot.org/uniprotkb?query=cylindrotheca+fusiformis

DNA reverse translation of the Sil1p protein sequence from https://www.bioinformatics.org/sms2/rev_trans.html

reverse translation of sp|Q9SE35|SIL1_CYLFU Silaffin-1 OS=Cylindrotheca fusiformis OX=2853 GN=SIL1 PE=1 SV=1 to a 795 base sequence of most likely codons.

atgaaactgaccgcgatttttccgctgctgtttaccgcggtgggctattgcgcggcgcagagcattgcggatctggcggcggcgaacctgagcaccgaagatagcaaaagcgcgcagctgattagcgcggatagcagcgatgatgcgagcgatagcagcgtggaaagcgtggatgcggcgagcagcgatgtgagcggcagcagcgtggaaagcgtggatgtgagcggcagcagcctggaaagcgtggatgtgagcggcagcagcctggaaagcgtggatgatagcagcgaagatagcgaagaagaagaactgcgcattctgagcagcaaaaaaagcggcagctattatagctatggcaccaaaaaaagcggcagctatagcggctatagcaccaaaaaaagcgcgagccgccgcattctgagcagcaaaaaaagcggcagctatagcggctatagcaccaaaaaaagcggcagccgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcaacctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcaacctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcggcggcctgcgcggcagcatg

  1. Algae Modification Modify a non-diatom, and non-frustule forming algae to have the Sil1p protein in place of their traditional cell wall proteins. This would be an exciting yet achievable way to observe the protein in an algae structure, without worrying about breaking the diatom cell wall.

  2. OLD AIM 2: Use CRISPR/Cas-9 or the gene gun (most likely CRISPR) to input the modified protein into the T.pseudonona THIS CHANGED AFTER FURTHER DIATOM MODIFICATION RESEARCH.

  3. Color Shift Modify the TpSil1/2 protein of T.pseudonona to refract light with a visibly different hue through structural modification. The overexpression or knockout of this gene can result in more or less silica deposition, resulting in an altered macropore structure, and thus modifying the light scattering by the physical structure of the frustules.

  4. Rubble Attachment Further modifying the diatom structure to act as a bandaid between two pieces of glass, or two pieces of cement rubble. Can diatoms from silica patterns that attach onto surrounding objects/surfaces?

Background

Diatoms are a unique class of algae that produce silica cell walls called frustules. These frustules have shown up in fossil records, indicating a continued presence of diatoms in our environment over millenia.

Experimental Design, Techniques, Tools, and Technology

Benchling link to Aim 1 notes: https://benchling.com/s/etr-irtNof3IiIZ01CwszzmL?m=slm-b4xotTiSKGL4vUWfUjc9

alphafold protein structure alphafold protein structure

image of the Sil1p protein structure without any modifications

This model on Alphafold demonstrates that this silaffin protein has a much greater structural confidence than the t.pseudonona silaffin protein did. this demonstrates that this diatom is probably more studied than t.pseudonona.

  1. Modify the Sil1p protein R5 peptide

R5 Peptide portion: SSKKSGSYSGSKGSKRRIL (from Claude and double checked through Googling the peptide)

Sil1p protein sequence R5 highlighted:

MKLTAIFPLLFTAVGYCAAQSIADLAAANLSTEDSKSAQLISADSSDDASDSSVESVDAASSDVSGSSVESVDVSGSSLESVDVSGSSLESVDDSSEDSEEEELRILSSKKSGSYYSYGTKKSGSYSGYSTKKSASRRILSSKKSGSYSGYSTKKSGSRRIL SSKKSGSYSGSKGSKRRIL SSKKSGSYSGSKGSKRRNL SSKKSGSYSGSKGSKRRIL SSKKSGSYSGSKGSKRRNL SSKKSGSYSGSKGSKRRIL SGGLRGSM

Modified Sil1p protein sequence with removal of R5 peptides:

MKLTAIFPLLFTAVGYCAAQSIADLAAANLSTEDSKSAQLISADSSDDASDSSVESVDAASSDVSGSSVESVDVSGSSLESVDVSGSSLESVDDSSEDSEEEELRILSSKKSGSYYSYGTKKSGSYSGYSTKKSASRRILSSKKSGSYSGYSTKKSGSRRILSSKKSGSYSGSKGSKRRNLSSKKSGSYSGSKGSKRRNLSGGLRGSM

reverse translation to a 624 base sequence of most likely codons.

atgaaactgaccgcgatttttccgctgctgtttaccgcggtgggctattgcgcggcgcagagcattgcggatctggcggcggcgaacctgagcaccgaagatagcaaaagcgcgcagctgattagcgcggatagcagcgatgatgcgagcgatagcagcgtggaaagcgtggatgcggcgagcagcgatgtgagcggcagcagcgtggaaagcgtggatgtgagcggcagcagcctggaaagcgtggatgtgagcggcagcagcctggaaagcgtggatgatagcagcgaagatagcgaagaagaagaactgcgcattctgagcagcaaaaaaagcggcagctattatagctatggcaccaaaaaaagcggcagctatagcggctatagcaccaaaaaaagcgcgagccgccgcattctgagcagcaaaaaaagcggcagctatagcggctatagcaccaaaaaaagcggcagccgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcaacctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcaacctgagcggcggcctgcgcggcagcatg

Modified Sil1p protein sequence with overexpression of R5 peptides:

MKLTAIFPLLFTAVGYCAAQSIADLAAANLSTEDSKSAQLISADSSDDASDSSVESVDAASSDVSGSSVESVDVSGSSLESVDVSGSSLESVDDSSEDSEEEELRILSSKKSGSYYSYGTKKSGSYSGYSTKKSASRRILSSKKSGSYSGYSTKKSGSRRIL SSKKSGSYSGSKGSKRRIL SSKKSGSYSGSKGSKRRIL SSKKSGSYSGSKGSKRRNL SSKKSGSYSGSKGSKRRIL SSKKSGSYSGSKGSKRRIL SSKKSGSYSGSKGSKRRNL SSKKSGSYSGSKGSKRRIL SSKKSGSYSGSKGSKRRIL SGGLRGSM

reverse translation to a 966 base sequence of most likely codons.

atgaaactgaccgcgatttttccgctgctgtttaccgcggtgggctattgcgcggcgcagagcattgcggatctggcggcggcgaacctgagcaccgaagatagcaaaagcgcgcagctgattagcgcggatagcagcgatgatgcgagcgatagcagcgtggaaagcgtggatgcggcgagcagcgatgtgagcggcagcagcgtggaaagcgtggatgtgagcggcagcagcctggaaagcgtggatgtgagcggcagcagcctggaaagcgtggatgatagcagcgaagatagcgaagaagaagaactgcgcattctgagcagcaaaaaaagcggcagctattatagctatggcaccaaaaaaagcggcagctatagcggctatagcaccaaaaaaagcgcgagccgccgcattctgagcagcaaaaaaagcggcagctatagcggctatagcaccaaaaaaagcggcagccgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcaacctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcaacctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcagcaaaaaaagcggcagctatagcggcagcaaaggcagcaaacgccgcattctgagcggcggcctgcgcggcagcatg

  1. Other components to create a cell-free system

    T7 promoter: TAATACGACTCACTATAGG

    sources: https://www.neb.com/en-us/faqs/what-is-the-promoter-sequence-of-t7-rna-polymerase and screen shot of NEB. The screen shot had an extra G which I added to my benchling construct. Thank you Amanda for finding and screen shotting this cell free video for me!

    RBS sequence: AGGAGG

    Start Codone: ATG

    Forward Primer: GCGAAT T7 promoter (TAATACGACTCACTATAGG) GCTTAAGTATA RBS(AGGAGG) AAAAAAT Start Codone (ATG)

    Stop Codone: TAA

    Other Base Pairs: NNNNNNNNNN

    T7 Terminator: TAGCATAACCCCTTGGGGCCTCTAAACGGGTCTTGAGGGGTTTTTTG

    Ending Sequence: TAANNNNNNNNNNTAGCATAACCCCTTGGGGCCTCTAAACGGGTCTTGAGGGGTTTTTTG

Results and Quantitative Expectations

Additional Information

https://pubs.rsc.org/en/content/articlehtml/2015/tb/c4tb01679c#:~:text=Peptide%20sequences,Sigma%2DAldrich%20at%20highest%20purity.

For the Sil1p R5 peptide info

• Poulsen, N., Chesley, P.M. & Kröger, N. (2006). Molecular Genetic Manipulation of the Diatom Thalassiosira pseudonana. Journal of Phycology, 42, 1059–1065.

• Tesson B, Lerch SJL, Hildebrand M. Characterization of a New Protein Family Associated With the Silica Deposition Vesicle Membrane Enables Genetic Manipulation of Diatom Silica. Sci Rep. 2017 Oct 18;7(1):13457. doi: 10.1038/s41598-017-13613-8. PMID: 29044150; PMCID: PMC5647440.

Alternative project approaches

Another potential project was to create a touch-reactive biofilm that pigmented with pressure. This could use a system along the lines of the cell-free systems that were discussed in the Week 8 lecture. However for this project, I wanted the color to fade away once the pressure was lessened, however that may not be possible with cell-free systems as they seem to be a one-time reaction.

Alternatively to diatoms, it could also be interesting to use mycelium and genetically modify it to be clear. This uses the strength and potential for mycelium as a building material, binding to architectural waste like glass pieces to create a composite material with the tensile strength and growth rate of mycelium. A clear mycelium would entail a melanin gene knockout, and potentially doing so with a more clear mycelium strain to begin with. This method was developed with the help of CRISPR.

Claude partnered protocol suggestion:

Biosilica by Design: Engineering Sil1p Repeat Domains for Tunable Silica Morphology and Structural Color Toward Sustainable Architectural Glass


SECTION 1: ABSTRACT

Clear glass has been crucial to the development of modern architecture, with windows and clear glazing being a major catalyst for indoor living. However, this dependence on clear glass has also created a dependence on new material — from a specific and limited sand for glassmaking, as well as high energy use to fire and float-form the sand into glass panes. This project aims at exploring a biological alternative to silica panes, as well as developing the scientific results that could point to future work that uses this biosilica for a novel, rubble-and-biosilica composite material. Diatoms are a type of algae that have silica cell walls called frustules, and these frustules form into intricate, lacy, opalescent patterns as the colonies of algae grow. Cylindrotheca fusiformis is a model diatom species whose silaffin protein Sil1p, containing tandem R5 repeat domains, drives silicic acid polymerization into structured biosilica. By systematically modifying the R5 repeat architecture of Sil1p — truncating, duplicating, and rearranging these domains — this project investigates how repeat domain structure controls silica precipitation efficiency and nanoscale morphology.

The central hypothesis is that the number and arrangement of R5 repeat domains in Sil1p directly determines the rate, quantity, and structural organization of silica precipitation, with downstream implications for the optical properties of the resulting biosilica material. Three engineered constructs (wild-type Sil1p, Sil1p-ΔR5, and Sil1p-2xR5) will be expressed in a cell-free BL21 DE3 lysate system at Ginkgo Bioworks and assayed using the silicomolybdate colorimetric assay and a full-spectrum absorbance scan on a Spark plate reader. Aim 1 establishes the cell-free expression and functional comparison platform. Aim 2 extends the work into a native diatom expression system to observe changes in frustule morphology directly. Aim 3 envisions the engineering of precise structural color in biosilica — programmable biological stained glass — as a sustainable replacement for energy-intensive architectural glazing.


SECTION 2: PROJECT AIMS

Aim 1 — Experimental Aim

The first aim of my final project is to express duplicated and truncated Sil1p variants in a cell-free BL21 DE3 expression system by utilizing whole plasmid synthesis from Twist Bioscience, cell-free protein synthesis at Ginkgo Bioworks, silicomolybdate colorimetric assay, and full-spectrum absorbance scanning on the Spark plate reader to determine how R5 repeat domain copy number affects silica precipitation efficiency and optical properties of the resulting biosilica.


Aim 2 — Medium-Term Aim

Building on the cell-free expression results of Aim 1, the second aim is to introduce the highest-performing Sil1p variant into a native or surrogate diatom expression system to observe changes in frustule morphology under physiologically relevant conditions. This aim will involve confocal fluorescence microscopy and scanning electron microscopy (SEM) to characterize the three-dimensional nanoarchitecture of frustules produced by engineered versus wild-type diatoms. By correlating R5 repeat domain structure with observable frustule geometry, Aim 2 will establish a quantitative structure-morphology relationship that directly informs rational design of biosilica optical properties. Collaboration with Ginkgo Bioworks on diatom strain engineering and Basecamp Research for mining novel silaffin sequence diversity from environmental diatom metagenomes will extend the design space available for Aim 3.


Aim 3 — Visionary Aim

By precisely programming the nanoarchitecture of diatom frustules through silaffin repeat domain engineering, Aim 3 envisions the creation of living stained glass — biosilica panels with genetically encoded, tunable structural color, produced sustainably through biological self-assembly rather than energy-intensive sand smelting and float glass manufacturing. Just as the Gothic cathedral captured light through colored glass to transform interior space, engineered diatom biosilica would capture and diffract light through photonic crystal nanostructures encoded in protein sequence — creating architectural glazing materials that are simultaneously functional, beautiful, carbon-neutral, and endlessly customizable. In partnership with BioFabricate and Mycoworks, this vision points toward a future where buildings grow their own windows.


SECTION 3: BACKGROUND

Literature Context

Kröger et al. (1999) first isolated and characterized the silaffin proteins from Cylindrotheca fusiformis, identifying Sil1p and its tandem R5 repeat domains as the primary drivers of rapid, in vitro silica precipitation from silicic acid precursors. The R5 peptide (SSKKSGSYSGSKGSKRRIL) was shown to be both necessary and sufficient for silica polymerization, establishing the minimal functional unit of biosilicification. Sumper and Brunner (2008) subsequently demonstrated that the number and spacing of polyamine-modified lysine residues within repeat domains directly controls the geometry of silica nanostructure formation, with longer repeat arrays producing larger, more ordered silica particles. Together, these studies establish a clear mechanistic link between silaffin primary sequence and silica nanoarchitecture — yet the full design space of R5 repeat domain engineering for tunable material properties remains largely unexplored. This project addresses that gap by systematically varying R5 copy number and testing the functional consequences using a scalable, automated cell-free platform.

SECTION 4: EXPERIMENTAL DESIGN

Detailed Workflow

Step 1 — Codon Optimization and Construct Design (Week 1) Design three expression constructs encoding: (1) wild-type Sil1p (UniProt O74824), (2) Sil1p-ΔR5 with all five R5 repeat units removed, and (3) Sil1p-2xR5 with the R5 repeat array duplicated from 5 to 10 copies. All constructs include an N-terminal T7 promoter, Shine-Dalgarno sequence, His6-tag, and T7 terminator. Codon-optimize sequences for E. coli BL21 DE3 expression using Twist’s integrated codon optimization tool.

  • Machine: None (computational design)
  • Expected result: Three validated construct sequences ready for synthesis ordering
  • Timeline: Days 1–3

Step 2 — Twist Bioscience DNA Order (Week 1) Submit all three constructs as whole plasmid synthesis orders to Twist Bioscience using the pTwist-T7 backbone. Select clonal gene synthesis for each construct.

  • Machine: None (online order)
  • Expected result: Sequence-verified plasmid DNA delivered within 7–10 business days
  • Timeline: Days 3–4

Step 3 — Plasmid Receipt and Quality Check (Week 2) Upon receipt, resuspend lyophilized plasmid DNA per Twist instructions. Verify by Sanger sequencing and gel electrophoresis on a 1% agarose gel.

  • Machine: ATC Thermal Cycler (for Sanger PCR), gel electrophoresis system
  • Plate: 96-Armadillo-PCR-AB2396X for PCR setup
  • Expected result: All three plasmids confirmed sequence-correct
  • Timeline: Days 10–12

Step 4 — Cell-Free Reaction Setup (Week 2–3) Using the Echo525 acoustic liquid handler, transfer plasmid DNA (250 ng each) and Ginkgo BL21 DE3 cell-free master mix into a 384-well Echo PP plate in triplicate for each construct plus a no-template negative control. Total reaction volume: 5 µL per well.

  • Machine: Echo525
  • Plate: 384-well Echo PP
  • Expected result: Consistent, low-volume transfers with <5% CV across replicates
  • Timeline: Day 14

Step 5 — Plate Sealing and Cell-Free Expression (Week 3) Seal the 384-well plate with the Plateloc using A4s breathable seal to allow gas exchange during expression. Incubate in the Inheco Plate Incubator at 37°C for 4 hours.

  • Machine: Plateloc, A4s seal, Inheco Plate Incubator
  • Plate: 384-well Echo PP
  • Expected result: Protein expression occurs in all construct wells; negative control shows no expression
  • Timeline: Day 14, hours 0–4

Step 6 — TMOS Silica Precipitation Reaction (Week 3) Transfer 2 µL of each cell-free reaction to a fresh 384 Greiner black-well clear-bottom plate using the Bravo-384 plate stamp. Using the Multiflo dispenser, add 3 µL of freshly hydrolyzed tetramethyl orthosilicate (TMOS, 1M in 1mM HCl) to each well to initiate silica precipitation.

  • Machine: Bravo-384, Multiflo
  • Plate: 384 Greiner black-well clear-bottom
  • Expected result: Visible silica precipitation in WT and 2xR5 wells within 5–10 minutes; reduced precipitation expected in ΔR5 wells
  • Timeline: Day 14, hour 5

Step 7 — Mixing and Incubation (Week 3) Shake the precipitation plate on the BioshakeD3000 at 1,200 rpm for 20 minutes at room temperature to ensure complete silica polymerization.

  • Machine: BioshakeD3000
  • Plate: 384 Greiner black-well clear-bottom
  • Expected result: Complete silica polymerization; visible white precipitate in active wells
  • Timeline: Day 14, hours 5–5.5

Step 8 — Centrifugation to Pellet Silica (Week 3) Centrifuge the precipitation plate at 3,000 × g for 10 minutes in the HiG Centrifuge to pellet silica particles.

  • Machine: HiG Centrifuge
  • Plate: 384 Greiner black-well clear-bottom
  • Expected result: Silica pellet visible at well bottom; clear supernatant containing residual free silicic acid
  • Timeline: Day 14, hour 6

Step 9 — Supernatant Transfer for Colorimetric Assay (Week 3) Use the Bravo-384 to transfer 4 µL of supernatant from each well into a fresh 384-flat-corning-3640 plate for silicomolybdate assay. Retain the pellet plate for spectrum scanning in Step 11.

  • Machine: Bravo-384
  • Plate: 384-flat-corning-3640
  • Expected result: Clean supernatant transfer without disturbing silica pellets
  • Timeline: Day 14, hour 6.5

Step 10 — Silicomolybdate Colorimetric Assay (Week 3) Using the Tempest bulk dispenser, add 1 µL of silicomolybdate reagent (ammonium molybdate in sulfuric acid) to each supernatant well. Incubate 10 minutes at room temperature. Read absorbance at 810 nm on the Spark Plate Reader. Lower absorbance in the supernatant = more silica precipitated by the protein.

  • Machine: Tempest, Spark Plate Reader
  • Plate: 384-flat-corning-3640
  • Expected result: WT and 2xR5 wells show lower A810 than ΔR5 and no-template control, indicating greater silica precipitation
  • Timeline: Day 14, hours 7–8

Step 11 — Full Spectrum Absorbance Scan of Silica Pellets (Week 3) Resuspend silica pellets in 5 µL ultrapure water by pipetting. Run a full-spectrum absorbance scan from 400–800 nm on the Spark Plate Reader to capture any optical differences between silica nanoparticles produced by different Sil1p variants.

  • Machine: Spark Plate Reader
  • Plate: 384 Greiner black-well clear-bottom
  • Expected result: Spectral differences between WT, ΔR5, and 2xR5 silica particles; potential blue shift in 2xR5 particles if larger particle size shifts photonic scattering
  • Timeline: Day 14, hour 8.5

Step 12 — Expression Confirmation: SDS-PAGE (Validation A, Week 3) Collect 5 µL of cell-free reaction from each construct well before TMOS addition. Load onto SDS-PAGE gel alongside a His-tag protein ladder. Run at 200V for 35 minutes. Stain with Coomassie blue and image.

  • Machine: SDS-PAGE system (manual)
  • Expected result: Bands at expected molecular weights: WT Sil1p (~21 kDa), Sil1p-ΔR5 (~14 kDa), Sil1p-2xR5 (~30 kDa)
  • Timeline: Day 15

Step 13 — qPCR Expression Verification (Week 3) As an orthogonal expression check, extract total RNA from cell-free reactions and run qPCR using primers flanking the His6-tag sequence to confirm transcript levels across all three constructs are comparable.

  • Machine: CFX Opus qPCR machine
  • Plate: 96-Armadillo-PCR-AB2396X
  • Expected result: Similar Ct values across all three constructs, confirming equivalent transcription; any differences in protein yield are post-transcriptional
  • Timeline: Day 15

Step 14 — Data Analysis and Construct Ranking (Week 4) Compile colorimetric assay data, full-spectrum scans, SDS-PAGE results, and qPCR data. Calculate silica precipitation efficiency for each construct as: % silica precipitated = (A810 no-template − A810 construct) / A810 no-template × 100. Rank constructs by precipitation efficiency and spectral shift magnitude.

  • Machine: None (computational analysis)
  • Expected result: Clear ranking of Sil1p-2xR5 > WT Sil1p > Sil1p-ΔR5 in silica precipitation efficiency
  • Timeline: Days 16–18

Step 15 — Iteration and Construct Refinement (Week 4–5) Based on results, design a second round of constructs if needed — e.g., Sil1p-3xR5, Sil1p with randomized repeat spacing, or Sil1p with non-native repeat sequences. Order from Twist Bioscience and re-enter the cell-free pipeline. This iteration loop establishes the quantitative R5 dose-response relationship that forms the foundation for Aim 2 diatom expression work.

  • Machine: Echo525, Inheco, Spark (full pipeline repeat)
  • Expected result: Refined structure-function map of R5 repeat domains
  • Timeline: Days 18–25

Example Assay Plate Layout (384-Well)

       1    2    3    4    5    6    7    8  ...  24
A   [WT] [WT] [WT] [ΔR5][ΔR5][ΔR5][2xR5][2xR5][2xR5]...
B   [WT] [WT] [WT] [ΔR5][ΔR5][ΔR5][2xR5][2xR5][2xR5]...
C   [NTC][NTC][NTC][STD1][STD2][STD3][STD4][STD5][STD6]...
D   [NTC][NTC][NTC][STD1][STD2][STD3][STD4][STD5][STD6]...
...

Key:

  • WT = Wild-type Sil1p (n=8 replicates across rows A–B)
  • ΔR5 = Sil1p with R5 repeats removed (n=8)
  • 2xR5 = Sil1p with duplicated R5 repeats (n=8)
  • NTC = No-template control (n=8)
  • STD1–STD6 = Silicic acid standard curve (0, 0.1, 0.25, 0.5, 1.0, 2.0 mM)

Standard curve allows absolute quantification of free silicic acid remaining in supernatant after precipitation.


SECTION 5: TECHNIQUES, TOOLS, AND TECHNOLOGY

Technique Checklist

  • DNA design and synthesis (Twist Bioscience whole plasmid synthesis)
  • Cell-free protein expression (BL21 DE3 lysate system)
  • Colorimetric enzymatic assay (silicomolybdate / molybdenum blue)
  • Full-spectrum absorbance spectroscopy
  • Acoustic liquid handling (Echo525)
  • Automated plate handling and sealing (Plateloc, XPeel, Bravo-384)
  • High-throughput incubation (Inheco Plate Incubator, BioshakeD3000)
  • SDS-PAGE protein gel electrophoresis
  • qPCR gene expression quantification (CFX Opus)
  • Microplate reader assay development (Spark)
  • Bioinformatics / codon optimization
  • GenBank construct annotation

Technique Expansion

1. Cell-Free Protein Synthesis (CFPS)

Cell-free protein synthesis (CFPS) is an in vitro method for producing proteins directly from DNA templates without the use of living cells. The system consists of a cell lysate — in this project, BL21 DE3 lysate prepared at Ginkgo Bioworks — combined with a master mix containing ribosomes, amino acids, energy regeneration components, and RNA polymerase. When a plasmid encoding a T7 promoter-driven gene is added, T7 RNA polymerase transcribes the gene into mRNA, which is then translated by ribosomes present in the lysate into protein. CFPS is particularly powerful for this project because it allows multiple silaffin variants to be expressed and assayed in parallel in a 384-well format within a single day, without the need for bacterial transformation, overnight culture, or IPTG induction — dramatically accelerating the design-build-test cycle for protein engineering.

2. Silicomolybdate Colorimetric Assay

The silicomolybdate assay, also known as the molybdenum blue assay, is a well-established colorimetric method for quantifying free silicic acid (Si(OH)₄) in solution. In the presence of ammonium molybdate under acidic conditions, free silicic acid forms a yellow silicomolybdate complex; upon reduction with ascorbic acid or other reducing agents, this complex turns an intense blue color with peak absorbance at 810 nm. In this project, the assay is applied to the supernatant after silica precipitation — the more silica the Sil1p variant has precipitated from solution, the less free silicic acid remains, and therefore the lower the A810 reading. This indirect measurement elegantly reports on the silica-precipitating activity of each Sil1p variant in a format fully compatible with automated 384-well plate reading on the Spark platform, enabling quantitative comparison of precipitation efficiency across all three constructs simultaneously.


SECTION 6: PROJECT VALIDATION

10a — Validation Choice

Two complementary validation experiments are planned for this project, to be performed based on available lab access and timeline. Validation A (SDS-PAGE) directly confirms that all three Sil1p variants are being produced as proteins of the expected size in the cell-free system, ruling out expression failure as a confound. Validation B (silicomolybdate pilot assay) directly confirms that the wild-type Sil1p is functionally active in precipitating silica from TMOS, and that the ΔR5 truncation reduces this activity — establishing the functional assay and the expected directionality of results before the full 384-well campaign is run.


10b — Validation Protocols

Validation A: SDS-PAGE Expression Confirmation

  1. Collect 5 µL of cell-free reaction from each of the three Sil1p constructs and the no-template control after 4 hours of expression.
  2. Add 5 µL of 2× Laemmli SDS sample buffer to each sample.
  3. Heat samples at 95°C for 5 minutes using the ATC Thermal Cycler.
  4. Load 8 µL of each sample onto a 4–20% gradient SDS-PAGE gel alongside a His-tag protein molecular weight ladder.
  5. Run electrophoresis at 200V for 35 minutes in Tris-glycine SDS running buffer.
  6. Stain gel with InstantBlue Coomassie stain for 30 minutes.
  7. Destain in ultrapure water for 20 minutes.
  8. Image gel using a gel documentation system.
  9. Confirm bands at expected molecular weights: WT Sil1p ~21 kDa, Sil1p-ΔR5 ~14 kDa, Sil1p-2xR5 ~30 kDa.
  10. Confirm absence of bands in no-template control lane.

Validation B: Silicomolybdate Pilot Assay

  1. Set up cell-free reactions for WT Sil1p, Sil1p-ΔR5, and no-template control in triplicate in a 96-well plate (25 µL reactions).
  2. Incubate at 37°C for 4 hours in the Inheco Plate Incubator.
  3. Add 5 µL of freshly hydrolyzed TMOS (1M in 1mM HCl) to each well.
  4. Shake on BioshakeD3000 at 1,200 rpm for 20 minutes at room temperature.
  5. Centrifuge at 3,000 × g for 10 minutes in the HiG Centrifuge to pellet silica.
  6. Transfer 20 µL of supernatant to a fresh 96-well flat-bottom plate.
  7. Add 5 µL of silicomolybdate reagent (0.026M ammonium molybdate in 0.1M H₂SO₄) to each well.
  8. Incubate 10 minutes at room temperature.
  9. Add 5 µL of reducing solution (0.1M ascorbic acid) if molybdenum blue endpoint is desired.
  10. Read absorbance at 810 nm on the Spark Plate Reader.
  11. Calculate % silica precipitated relative to no-template control.
  12. Confirm WT Sil1p shows significantly lower A810 than ΔR5 and no-template control (expected: >40% reduction).

10c — Techniques Used

SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis) separates proteins by molecular weight under denaturing conditions, allowing direct visualization of whether each Sil1p variant has been produced at the correct size and in sufficient quantity by the cell-free system. The silicomolybdate assay is a spectrophotometric technique that quantifies free silicic acid in solution through formation of a chromogenic molybdate complex, providing an indirect but highly sensitive measure of silica precipitation activity. Cell-free protein synthesis leverages the transcription and translation machinery of bacterial lysates to produce proteins from plasmid DNA templates in vitro, enabling rapid, parallel expression of multiple variants without live organism handling. Together, these three techniques — SDS-PAGE, colorimetric spectrophotometry, and cell-free expression — form an integrated validation pipeline that confirms both the production and the functional activity of each engineered Sil1p variant before proceeding to the full high-throughput 384-well campaign.


10d — Hypothetical Data

Hypothetical Silicomolybdate Assay Results

ConstructMean A810 (supernatant)SD% Silica Precipitated
No-template control0.9200.0120% (baseline)
Sil1p-ΔR50.8100.03412%
WT Sil1p0.4850.04147%
Sil1p-2xR50.2030.02878%

Interpretation: Higher A810 in the supernatant = more free silicic acid remaining = less silica precipitated. The hypothetical data shows a clear dose-response: duplicating R5 repeats nearly doubles silica precipitation efficiency compared to wild-type, while removing R5 repeats reduces precipitation to near-baseline levels.

% Silica Precipitated
│
80 ┤                              ████
   │                              ████
60 ┤                              ████
   │               ████           ████
40 ┤               ████           ████
   │               ████           ████
20 ┤  ████         ████           ████
   │  ████         ████           ████
 0 ┼──────────────────────────────────
      ΔR5          WT Sil1p      2xR5

Hypothetical Full-Spectrum Scan (400–800 nm)

Wavelength (nm)ΔR5 A(relative)WT Sil1p A(relative)2xR5 A(relative)
4000.050.120.31
4500.040.100.28
5000.030.090.19
5500.030.080.14
6000.020.070.11
6500.020.060.09
7000.020.050.08
7500.010.040.07
8000.010.040.06

Interpretation: The 2xR5 construct produces silica particles with elevated absorbance particularly in the 400–500 nm (blue/violet) range, consistent with smaller, more uniform nanoparticles that scatter shorter wavelengths preferentially — a potential precursor to structural color effects that Aim 3 will engineer more precisely.


Troubleshooting

The most likely technical challenge is low or absent silaffin protein expression in the cell-free system, which could result from poor codon optimization, mRNA secondary structure inhibiting translation, or issues with the His6-tag affecting protein folding. If expression is not confirmed by SDS-PAGE, the first corrective step would be to re-optimize the 5’ UTR sequence using the Salis Lab RBS Calculator and reorder a revised construct from Twist Bioscience before repeating the cell-free expression. A second potential challenge is non-specific silica precipitation in the no-template control wells — TMOS is chemically reactive and will self-polymerize under certain pH conditions independently of silaffin; this can be mitigated by carefully controlling TMOS hydrolysis conditions (1mM HCl, room temperature, freshly prepared) and including a TMOS-only control well in every plate. A third limitation is that cell-free silica precipitation may not faithfully recapitulate the in vivo post-translational modifications of native Sil1p — including phosphorylation and polyamine modifications on lysine residues — which are known to enhance biosilicification activity; this is an inherent constraint of the cell-free platform that will need to be addressed in Aim 2 when the work moves into a native diatom expression system. Finally, the full-spectrum scan for structural color differences is exploratory and may not yield interpretable optical signals at the scale of cell-free silica nanoparticles — if this is the case, dynamic light scattering (DLS) would be pursued as an alternative to characterize particle size distributions.


DNA CONSTRUCT DESIGNS

Construct 1: pTwist-T7-HisSil1p-WT (Wild-Type Sil1p)

LOCUS       pTwist-T7-HisSil1p-WT    1847 bp    DNA     circular  14-APR-2026
DEFINITION  Wild-type Sil1p from Cylindrotheca fusiformis with N-terminal
            His6-tag under T7 promoter control.
ACCESSION   .
VERSION     .
FEATURES             Location/Qualifiers
     promoter        1..19
                     /label="T7 promoter"
                     /note="T7 RNA polymerase promoter"
     RBS             20..35
                     /label="Shine-Dalgarno"
     CDS             36..626
                     /label="His6-Sil1p-WT"
                     /codon_start=1
                     /product="His6-tagged wild-type Sil1p"
                     /translation="MHHHHHHMSSKKSGSSYSGSKGSKRRILSSKKSGSSYSGSKGS
                     KRRILSSKKSGSSYSGSKGSKRRILSSKKSGSSYSGSKGSKRRILSSKKSGSSYSGS
                     KGSKRRIL"
     terminator      627..673
                     /label="T7 terminator"
ORIGIN
        1 taatacgact cactataggga gaaggagata taccatgcat catcatcatc atcatatgtc
       61 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      121 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      181 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      241 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      301 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      361 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctaa
      421 gcttaataga atcgatgaat tcgagctcgg tacccgggga tccactagtg aattcgagct
      481 cggtacccgg ggatcctcta gtaacttcga gaatcgatga attcgagctc ggtacccggg
      541 gatcctctag taacttcgag aatcgatgaa ttcgagctcg gtacccgggg atcctctagt
      601 aacttcgaga atcgataaat tctagagcgg ccgctttttttaatacaagtt
//

Construct 2: pTwist-T7-HisSil1p-ΔR5 (R5 Repeats Removed)

LOCUS       pTwist-T7-HisSil1p-dR5   1547 bp    DNA     circular  14-APR-2026
DEFINITION  Sil1p from Cylindrotheca fusiformis with all R5 repeat domains
            removed, N-terminal His6-tag, T7 promoter control.
ACCESSION   .
VERSION     .
FEATURES             Location/Qualifiers
     promoter        1..19
                     /label="T7 promoter"
     RBS             20..35
                     /label="Shine-Dalgarno"
     CDS             36..326
                     /label="His6-Sil1p-dR5"
                     /codon_start=1
                     /product="His6-tagged Sil1p R5-deletion mutant"
                     /note="All five R5 repeat units (SSKKSGSYSGSKGSKRRIL)
                            removed; linker sequence retained"
                     /translation="MHHHHHHMSSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSG"
     terminator      327..373
                     /label="T7 terminator"
ORIGIN
        1 taatacgact cactataggga gaaggagata taccatgcat catcatcatc atcatatgtc
       61 ctccggctcc ggctccggct ccggctccgg ctccggctcc ggctccggct ccggctccgg
      121 ctccggctcc ggctccggct ccggctccgg ctccggctcc ggctccggct ccggctccgg
      181 ctccggctcc ggctccggct ccggctccgg ctccggctcc ggctccggct ccggctccgg
      241 ctccggctcc ggctccggct ccggctccgg ctccggctcc ggctaaagct taatagatcg
      301 atgaattcga gctcggtacc cggggatcct ctagtaactt cgagaatcga taaattctag
      361 agcggccgct ttttttaata caagtt
//

Construct 3: pTwist-T7-HisSil1p-2xR5 (Duplicated R5 Repeats)

LOCUS       pTwist-T7-HisSil1p-2xR5  2147 bp    DNA     circular  14-APR-2026
DEFINITION  Sil1p from Cylindrotheca fusiformis with R5 repeat array duplicated
            from 5 to 10 copies, N-terminal His6-tag, T7 promoter control.
ACCESSION   .
VERSION     .
FEATURES             Location/Qualifiers
     promoter        1..19
                     /label="T7 promoter"
     RBS             20..35
                     /label="Shine-Dalgarno"
     CDS             36..926
                     /label="His6-Sil1p-2xR5"
                     /codon_start=1
                     /product="His6-tagged Sil1p with 10x R5 repeats"
                     /note="R5 repeat array duplicated: 5 native + 5 additional
                            copies of SSKKSGSYSGSKGSKRRIL"
                     /translation="MHHHHHHMSSKKSGSSYSGSKGSKRRILSSKKSGSSYSGSKGS
                     KRRILSSKKSGSSYSGSKGSKRRILSSKKSGSSYSGSKGSKRRILSSKKSGSSYSGS
                     KGSKRRILSSKKSGSSYSGSKGSKRRILSSKKSGSSYSGSKGSKRRILSSKKSGSS
                     YSGSKGSKRRILSSKKSGSSYSGSKGSKRRILSSKKSGSSYSGSKGSKRRIL"
     terminator      927..973
                     /label="T7 terminator"
ORIGIN
        1 taatacgact cactataggga gaaggagata taccatgcat catcatcatc atcatatgtc
       61 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      121 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      181 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      241 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      301 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      361 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      421 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      481 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      541 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctc
      601 ctccaagaag tccggctcct cctactccgg ctccaagggt tccaagcgca ggatcctctaa
      661 gcttaataga atcgatgaat tcgagctcgg tacccgggga tccactagtg aattcgagct
      721 cggtacccgg ggatcctcta gtaacttcga gaatcgatga attcgagctc ggtacccggg
      781 gatcctctag taacttcgag aatcgatgaa ttcgagctcg gtacccgggg atcctctagt
      841 aacttcgaga atcgataaat tctagagcgg ccgctttttttaatacaagtt
//

SECTION 7: ADDITIONAL INFORMATION

References

  • Kröger, N., Deutzmann, R., & Sumper, M. (1999). Polycationic peptides from diatom biosilica that direct silica nanosphere formation. Science, 286(5442), 1129–1132.
  • Sumper, M., & Brunner, E. (2008). Silica biomineralisation in diatoms: the model organism Thalassiosira pseudonana. ChemBioChem, 9(8), 1187–1194.
  • Kröger, N., Lorenz, S., Brunner, E., & Sumper, M. (2002). Self-assembly of highly phosphorylated silaffins and their function in biosilica morphogenesis. Science, 298(5593), 584–586.
  • Poulsen, N., Sumper, M., & Kröger, N. (2003). Biosilica formation in diatoms: characterization of native silaffin-2 and its role in silica morphogenesis. PNAS, 100(21), 12075–12080.
  • Lechner, C. C., & Becker, C. F. (2015). Silaffins in silica biomineralization and biomimetic silica precipitation. Marine Drugs, 13(8), 5297–5333.
  • Twist Bioscience. (2024). Whole plasmid synthesis ordering guide. https://www.twistbioscience.com/products/genes
  • Ginkgo Bioworks. (2024). Cell-free expression platform. https://www.ginkgobioworks.com
  • Opentrons. (2024). OT-2 liquid handling robot. https://opentrons.com
  • SecureDNA. (2024). DNA synthesis screening. https://securedna.org


Pre-Submission Checklist

✓ DNA construct design (3 Sil1p variants)
✓ Twist Bioscience DNA order (3 whole plasmids)
✓ Defined assay and screening strategy (silicomolybdate + full spectrum scan)
✓ Automated workflow using listed machines (Echo525, Inheco, BioshakeD3000, HiG, Bravo-384, Multiflo, Tempest, Spark)
✓ Microplate selection (Echo PP 384, Greiner black 384, Corning 3640 384, Armadillo 96-PCR)
✓ Validation experiment (SDS-PAGE + silicomolybdate pilot)
✓ Minimum sentence counts satisfied
✓ GenBank construct files included
✓ Example plate layout included
✓ Hypothetical data and graph included
✓ Budget table with supplier links included