https://pages.htgaa.org/2026a/justine-de-riedmatten/homework/week-05-hw-protein-design-part-ii/index.htmlPart 1: Generate Binders with PepMLM 1. Begin by retrieving the human SOD1 sequence from UniProt (P00441) and introducing the A4V mutation. Human SOD1 Sequence (154AA per monomer - 308AA): MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQMATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ A4V mutation: The alanine to valine mutation at codon 4 (A4V) of SOD1 causes a rapid and progressive form of amyotrophic lateral sclerosis (ALS). In Uniprot, however, it appears that the sequence starts with Methionine, making the mutation from Alanine to Valine actually at codon 5.Hugoen