https://pages.htgaa.org/2026a/kaleab-berhanu-weldesenbet/homework/week-05-hw-protein-design-part-ii/index.htmlProtein Design Part 2 SOD1_A4V Mutated Code Used. —> MATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTS AGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVV HEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ Part 1: PepMLM Generated Peptides Summary The four PepMLM-generated peptides were conditioned on the SOD1 A4V mutant sequence with a target length of 12 amino acids, with the exception of Peptide 2, which came out at 15 residues. Perplexity scores reflect the model’s confidence in each binder, where a lower score indicates higher confidence. Peptide 1 (WLYGAAGVRWGX) has the lowest perplexity at 13.06, making it the model’s most confident prediction, though it contains an X residue at the final position, which represents an unresolved or masked amino acid and should be noted as a potential issue before advancing it further. Peptides 2, 3, and 4 all cluster between 17 and 20, reflecting moderate confidence. The known binder FLYRWLPSRRGG is included as a structural and therapeutic benchmark and does not carry a perplexity score since it was not generated by PepMLM.Hugoen