Week 2 HW.3: DNA Design Challenge

3.1. Choose your protein.

In recitation, we discussed that you will pick a protein for your homework that you find interesting. Which protein have you chosen and why? Using one of the tools described in recitation (NCBI, UniProt, google), obtain the protein sequence for the protein you chose.

Miraculin - https://rest.uniprot.org/uniprotkb/P13087.fasta https://rest.uniprot.org/uniprotkb/P13087.txt

>sp|P13087|MIRA_SYNDU Miraculin OS=Synsepalum dulcificum OX=3743 PE=1 SV=3
MKELTMLSLSFFFVSALLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHG
GGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMP
CRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTV
CGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

3.2. Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.

Using https://www.bioinformatics.org/sms2/rev_trans.html:

atgaaagaactgaccatgctgagcctgagctttttttttgtgagcgcgctgctggcggcg
gcggcgaacccgctgctgagcgcggcggatagcgcgccgaacccggtgctggatattgat
ggcgaaaaactgcgcaccggcaccaactattatattgtgccggtgctgcgcgatcatggc
ggcggcctgaccgtgagcgcgaccaccccgaacggcacctttgtgtgcccgccgcgcgtg
gtgcagacccgcaaagaagtggatcatgatcgcccgctggcgttttttccggaaaacccg
aaagaagatgtggtgcgcgtgagcaccgatctgaacattaactttagcgcgtttatgccg
tgccgctggaccagcagcaccgtgtggcgcctggataaatatgatgaaagcaccggccag
tattttgtgaccattggcggcgtgaaaggcaacccgggcccggaaaccattagcagctgg
tttaaaattgaagaattttgcggcagcggcttttataaactggtgttttgcccgaccgtg
tgcggcagctgcaaagtgaaatgcggcgatgtgggcatttatattgatcagaaaggccgc
cgccgcctggcgctgagcgataaaccgtttgcgtttgaatttaacaaaaccgtgtatttt

3.3. Codon optimization.

Describe why you need to optimize codon usage. Which organism have you chosen to optimize the codon sequence for and why?

Proteins are translated from mRNA by tRNA’s. The tRNA’s “pair” with codons from the mRNA. A codon is a 3-base sequence which is then mapped onto a single amino acid. As we covered last week, there are 64 different codons (permutations of a string of 3 nuceleotide bases) which map down to only 20 amino acids. The degeneracy means we can swap out parts of the DNA/mRNA to express the same amino acids aka proteins. Why would we do this? Because mRNA codons are translated into amino acids by the available tRNA in the organism. Each tRNA matches a codon (or several synonymous codons, see wobble pairing at 3rd base). There is not a uniform concentration of tRNA for all codons. So some mRNA codons will translate more efficiently than others, because there is more tRNA.

To restate:

  1. DNA encodes triplet codons.
  2. mRNA is transcribed from DNA.
  3. Ribosomes read mRNA in triplets.
  4. tRNAs carrying amino acids base-pair with codons (binding with the tRNA’s complementary anticodon)
  5. Translation rate is approximately proportional to local charged tRNA abundance and ribosomal processivity.

Multiple codons encode the same amino acid, yet different organisms use these synonymous codons at different frequencies (codon usage bias). If a gene from organism A is expressed in organism B without modification, the codon distribution may not match the tRNA pool of B.

You need to optimize codon usage in order to achieve (good) yields from your biomanufacturing process.

I choose Escherichia coli (E. coli) as the target host for optimization:

  • Takes less time
    • Cell division is faster
  • Well established protocols to isolate plasmid
    • Each cell has single chromosome
    • Single circular plasmid
    • Each replicated cell has exact copy of DNA
  • Easy method

3.4. You have a sequence! Now what?

What technologies could be used to produce this protein from your DNA? Describe in your words how the DNA sequence can be transcribed and translated into your protein. You may describe either cell-dependent or cell-free methods, or both.

Recombinant expression in a host organism like E. Coli.

  1. Clone the coding sequence into an expression vector (a plasmid).
    • Promoter - T7 under lac control: binds the RNA polymerase
    • Ribosome binding site - Shine–Dalgarno AGGAGG: recruits ribosome
    • Coding sequence - see Miraculin DNA sequence above.
    • Terminator - hairpin-forming sequence: stops transcription
    • Antibiotic resistance gene - ampR: for selection of culture
  2. Transform into E. Coli (transform the plasmid into host cells.)
    1. Bacteria are given a heat shock.
    2. Colonies grow.
    3. Pick colonies.
      1. Plate on ampicillin → only plasmid-containing cells survive.
    4. Inoculate the liquid cultures (by introducing single colonies)
  3. Induce expression (e.g., add IPTG if T7/lac system).
    • T7 RNA polymerase binds promoter
    • DNA is transcribed into mRNA
    • Ribosome binds RBS on mRNA.
    • tRNA translates into protein, stop at terminator.
      • tRNAs decode codons
      • Amino acids polymerize into polypeptide
  4. Harvest. Cells are lysed. Protein is purified.
    1. Lyse cells (sonication or chemical lysis).
    2. Purify protein (e.g., His-tag + Ni-NTA affinity column).

Apparently E. coli is possible but non-ideal for a cysteine-rich, glycosylated plant secreted protein like miraculin.

3.5. [Optional] How does it work in nature/biological systems?

Describe how a single gene codes for multiple proteins at the transcriptional level. Try aligning the DNA sequence, the transcribed RNA, and also the resulting translated Protein!!! See example below.