Week 5 HW: Protein Design Part II :: 2026a-madeline-eibner-gebhardthttps://pages.htgaa.org/2026a/madeline-eibner-gebhardt/homework/week-05-hw-proteins_ii/index.htmlA. SOD1 Binder Peptide Design Part 1: Generate Binders with PepMLM Mutant SOD sequence: MATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ Binder peptides generated with PepMLM, evaluated with AlphaFold: Peptide Perplexity ipTM Location WRVPAAGAELGX 7.415045 0.41 Over disordered region WHYYAAAVRWKX 15.435134 0.37 Across 2 rows in sheet WLYPAAGLRHWX 16.586151 0.26 Over small helix WRYYAAALALGX 7.577719 0.38 Over sheet region, peptide is a helix For comparison, here is a known SOD1-binder peptide:Hugoen