Group Final Project

Group Name: Phage Forge

Group Members:

@2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji, and @2026a-keerthana-gunaretnam

Project Documentation

Proposal:

By: @2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji

  • We decided to focus on the main area of increasing the stability of the MS2 phage lysis protein L, with a possible secondary goal of reducing the dependency on host DnaJ, while still maintaining the lysis action.
  • The tools AlphaFold, Clustal Omega, BLAST, ESM, and ESMFold were discussed.
  • BLAST can pull out homologous lysis proteins from the databases.
  • Clustal Omega can create MSAs to identify essential L48-S49 residues, and the pore-forming regions that must not be mutated.
  • ESM can create mutation heatmaps, which can guide the use of ESMFold to obtain highest score foldings in mutatable regions.
  • AlphaFold Multimer predicts whether the subunits of our protein can successfully create a pore in the host membrane, and also to check whether N-terminus can break the interaction with DnaJ.
  • We also identified a few pitfalls, with majors ones dealing with limited training datasets, that may not be properly aligned towards creating a transmembrane lysis protein.
  • Some other pitfalls include the lack of proper annotations for amurins; the possibility of an over-stable protein to form non-functional aggregates; and the vulnerability of modified protein to host proteases.

Paper summaries:

By: @2026a-ritika-saha
MS2 Lysis of Escherichia coli Depends on Host Chaperone DnaJ

The study shows that the MS2 phage lysis protein L requires the host chaperone DnaJ for efficient host cell lysis. A missense mutation (P330Q) in the highly conserved C-terminal domain of DnaJ blocks MS2 L-mediated lysis at 30 °C and delays lysis at higher temperatures, without affecting overall L protein synthesis. The defect is specific to L-mediated lysis and does not affect lysis by other phage lysis proteins.

Genetic suppressor screening identified Lodj alleles of the L gene that bypass the DnaJ requirement. These alleles encode truncated L proteins lacking the highly basic N-terminal domain, indicating that this domain confers dependence on DnaJ. Biochemical assays demonstrated that wild-type L forms a membrane-associated complex with DnaJ, whereas the P330Q DnaJ variant cannot interact with L.

The authors propose that DnaJ functions as a chaperone that facilitates proper folding or conformational activation of full-length L, preventing steric interference from the N-terminal domain and allowing L to interact with its unknown cellular target. Removal of the dispensable N-terminal domain eliminates the need for chaperone assistance and accelerates lysis.

The work identifies DnaJ as a host factor regulating MS2 lysis timing and suggests that chaperone-dependent modulation of lysis may be an evolutionary strategy to optimize phage replication cycles.


Mutational analysis of the MS2 lysis protein L

This study performed comprehensive mutational and genetic analyses of the MS2 phage lysis protein L to identify residues and domains required for function. Random mutagenesis of the 75-aa L protein showed that most loss-of-function mutations cluster in the C-terminal half of the protein, especially around a conserved Leu-Ser (LS) dipeptide motif. Many inactivating mutations were conservative amino-acid substitutions and did not affect protein accumulation or membrane association, suggesting that L function depends on specific protein–protein interactions rather than nonspecific membrane disruption.

Functional studies demonstrated that L-mediated lysis requires interaction with the host chaperone DnaJ. The highly basic N-terminal domain of L is dispensable for lytic activity but mediates DnaJ dependence. Truncation of this domain or certain suppressor mutations bypassed the chaperone requirement and restored rapid lysis.

Biochemical and genetic data support a model in which L is an integral membrane protein whose essential domains (including the LS motif and neighboring regions) form a helical structure that likely engages a host membrane target protein. The interaction may occur near sites of membrane curvature associated with peptidoglycan biosynthesis rather than by forming nonspecific membrane lesions.

The work, supported in part by the Center for Phage Technology and associated laboratories including research by Ry Young, suggests that MS2 L functions through a specific heterotypic protein–protein interaction mechanism and that chaperone-dependent regulation helps control lysis timing during infection.

The study refines the mechanistic model of MS2 lysis, proposing that conserved structural motifs rather than general membrane disruption drive lytic activity.


In vitro characterization of the phage lysis protein MS2-L

This study provides detailed in vitro and in vivo characterization of the MS2 lysis protein MS2-L, focusing on its membrane insertion mechanism, oligomerization behavior, and interaction with the host chaperone DnaJ.

Key findings show that MS2-L is a 75-amino-acid phage toxin whose essential lytic activity resides in the C-terminal ~35 amino acids, which form a hydrophobic transmembrane region. The N-terminal soluble domain is not required for bacterial killing but modulates folding, membrane insertion efficiency, and chaperone interaction.

Biochemical assays demonstrate that MS2-L interacts directly with DnaJ, primarily through the soluble N-terminal domain. However, this interaction does not significantly affect membrane insertion, solubilization, or oligomerization of the toxin, suggesting that DnaJ functions more as a folding or stabilization partner rather than being essential for lytic activity.

Native mass spectrometry revealed that MS2-L assembles into high-order oligomeric complexes (≥10 monomers) after insertion into lipid nanodiscs, and oligomerization is driven mainly by the transmembrane domain. In detergent environments, oligomer formation is reduced, indicating that membrane lipid context is important for stable assembly.

Fluorescence microscopy and cryo-electron microscopy showed that MS2-L expression in bacteria leads to peripheral membrane clustering, followed by sequential lesion formation beginning in the outer membrane, then disruption of the peptidoglycan layer, and finally inner membrane disintegration with cytoplasmic leakage.

The data support a model in which MS2-L functions as a pore-forming phage toxin that kills cells through higher-order oligomerization within the bacterial membrane, rather than by directly inhibiting peptidoglycan biosynthesis. Chaperone DnaJ binds MS2-L but is not required for membrane insertion or pore assembly, suggesting its role is mainly in modulating toxin folding or stability.

These findings strengthen the concept that MS2-L belongs to the amurin/single-gene lysis protein family and may be useful for bioengineering applications such as bacterial ghost cell production and antimicrobial design.


Phage therapy: From biological mechanisms to future directions

This review from Elsevier surveys the biological mechanisms, clinical development, and future directions of phage therapy as a strategy to combat antimicrobial resistance. It explains that therapeutic phages should ideally be strictly lytic, highly host-specific, and thoroughly characterized to ensure safety and efficacy.

The article describes how phages kill bacteria through mechanisms such as inhibition of essential cellular processes, expression of lysis proteins, or disruption of bacterial membranes. It also discusses advances in phage engineering, including synthetic genome construction and modification of phage host range and virulence.

Clinical applications of phage therapy are highlighted, particularly for treating drug-resistant infections where antibiotics are ineffective. However, challenges remain, including bacterial resistance to phages, regulatory hurdles, manufacturing standardization, and the need to understand phage–host interactions.

Future directions include the use of genetically modified or synthetic phages, computational prediction of therapeutic candidates, and integration of phage therapy with conventional antimicrobial strategies. Overall, phage therapy is presented as a promising but still developing alternative to antibiotics in the fight against antimicrobial resistance.


Generative design of novel bacteriophages with genome language models

This preprint reports the first experimental demonstration of generative design of complete bacteriophage genomes using genome language models (Evo 1 and Evo 2). The authors fine-tuned models on about 15,000 Microviridae phage genomes to enable autoregressive generation of full viral genomes guided by template-based prompts and biologically motivated design constraints.

The workflow involved computational generation followed by multi-tier filtering for sequence quality, host tropism specificity, and evolutionary diversity. Constraints included genome length (4–6 kb), GC content, absence of long homopolymers, preservation of phage-like gene architecture, and spike protein similarity to the template phage to maintain host targeting.

Experimental validation showed that about 285 of 302 synthesized genome candidates could be assembled, and 16 produced viable infectious phages that inhibited growth of the target host strain. These generated phages displayed substantial sequence novelty, containing hundreds of mutations relative to natural Microviridae genomes, while preserving functional genome organization.

Structural and functional analyses indicated that some generated phages possessed altered protein interfaces but maintained compatible capsid–protein interactions. Cryo-electron microscopy and structure prediction suggested context-dependent co-evolution of structural proteins such as capsid and packaging proteins.

Fitness assays showed that several AI-generated phages matched or exceeded the replication and lytic performance of the template phage, and phage cocktail experiments demonstrated rapid suppression of resistant bacterial strains through recombination and mutation-driven adaptation.

The study was conducted with biosafety considerations, including restricting model training to bacteriophage genomes and using well-characterized laboratory strains. The work was supported by researchers affiliated with institutions such as the Stanford University and the Arc Institute.

Overall, the paper proposes a framework for generative genome engineering, showing that AI models can design biologically viable and evolutionarily novel bacteriophages, potentially enabling future synthetic biology and phage-based therapeutic development.


Overview of the Project Proposal: Engineering the MS2 Phage Lysis Protein L

By: @2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji

1. Project Goal

Our primary goal is to increase the structural stability of the MS2 bacteriophage lysis protein (L) while maintaining its ability to lyse bacterial cells.

Our secondary goal is to reduce the dependency of L on the host chaperone DnaJ, which normally assists the protein in folding or activation. Reducing this dependency could allow the lysis protein to function more efficiently and independently in engineered systems.

The MS2 L protein is a 75-amino-acid single-gene lysis toxin whose C-terminal region forms a hydrophobic transmembrane domain responsible for membrane disruption and pore formation, while the basic N-terminal domain interacts with host factors such as DnaJ. Previous studies show that truncation of the N-terminal region can bypass the DnaJ requirement while preserving lysis activity.

Therefore, our design strategy focuses on:

  • Stabilizing the transmembrane and oligomerization regions
  • Maintaining essential functional motifs such as the L48–S49 motif
  • Exploring modifications to the N-terminal region to reduce DnaJ dependence

2. Computational Tools and Approaches

We will use a multi-step computational protein engineering pipeline combining sequence analysis, machine-learning mutagenesis predictions, and structural modeling.

2.1 BLAST – Homolog Discovery

First, we will use BLAST to identify homologous lysis proteins from related bacteriophages.

Purpose:

  • Identify evolutionarily conserved residues
  • Discover natural sequence variations that maintain function
  • Build a dataset for multiple sequence alignment

This will help determine which regions are functionally constrained vs mutable.

2.2 Clustal Omega – Multiple Sequence Alignment (MSA)

Using sequences obtained from BLAST, we will perform multiple sequence alignment with Clustal Omega.

Purpose:

  • Identify highly conserved residues, especially around the L48–S49 motif
  • Map essential structural regions
  • Determine which residues are safe to mutate

Regions with high conservation will be protected from mutation, while variable regions may be targeted for stability improvements.

2.3 ESM (Protein Language Models) – In Silico Mutagenesis

Next, we will use ESM (Evolutionary Scale Modeling) protein language models to perform systematic mutation scanning.

Purpose:

  • Generate mutation heatmaps
  • Predict which amino acid substitutions improve protein fitness or stability
  • Identify mutations compatible with the evolutionary sequence landscape

This step will guide rational mutation selection instead of random mutagenesis.

2.4 ESMFold – Structure Prediction for Mutants

Promising mutations from ESM analysis will be modeled using ESMFold.

Purpose:

  • Predict 3D structures of mutant proteins
  • Evaluate structural stability
  • Ensure the transmembrane helix remains intact

Mutations that significantly distort the fold will be discarded.

2.5 AlphaFold Multimer – Oligomerization and Host Interaction

Finally, we will use AlphaFold Multimer to analyze:

  1. L protein oligomerization
  2. Potential interactions with DnaJ

Purpose:

  • Predict whether mutated L proteins can form the oligomeric pore complex
  • Evaluate whether N-terminal mutations reduce interaction with DnaJ

Since MS2-L likely forms large oligomeric pores (>10 subunits) in the membrane, maintaining correct protein in1.Phage L protein sequence

Computational Workflow:

  1. Phage L protein sequence
  2. BLAST Search (find homologous lysis proteins)
  3. Multiple Sequence Alignment (Clustal Omega)
    • identify conserved vs mutable residues
  4. ESM Mutation Scanning (generate mutation heatmaps)
  5. Select Candidate Mutations (stability or N-terminal modifications)
  6. Structure Prediction (ESMFold)
  7. Complex/Oligomer Prediction (AlphaFold Multimer)
  8. Final Mutant Candidates (stable + functional lysis protein)

3. Proposed Engineering Pipeline

Computational workflow we will follow.

4. Expected Outcomes

Our pipeline aims to produce engineered variants of the MS2 L protein with:

  • Increased structural stability
  • Reduced aggregation risk
  • Maintained transmembrane insertion
  • Potentially reduced dependency on host DnaJ

These optimized proteins could be useful in applications such as:

  • Synthetic phage engineering
  • Bacterial ghost cell production
  • Antimicrobial protein development

5. Potential Pitfalls

5.1 Limited Training Data

Most protein language models and structural predictors are trained primarily on globular proteins, not small transmembrane phage toxins.

This may reduce prediction accuracy for MS2 L.

5.2 Risk of Over-Stabilization

Mutations designed to increase stability may cause:

  • Protein aggregation
  • Improper membrane insertion
  • Loss of functional oligomerization

Thus stability must be balanced with function.

5.3 Poor Annotation of Amurin Proteins

Single-gene lysis proteins (also called amurins) are poorly annotated in sequence databases.

This may limit the quality of homologous sequences used for alignment and training.

5.4 Host Protease Sensitivity

Mutations may unintentionally expose protease cleavage sites, making the engineered protein less stable inside bacterial cells.

6. Future Work

If promising mutants are identified computationally, the next steps would include:

  • Experimental expression in E. coli
  • Measuring lysis timing
  • Measuring protein stability
  • Testing DnaJ independence

This would validate whether computational predictions translate into improved biological function.


L-Protein Mutants Project Summary:

The MS2 bacteriophage L-protein is a small 75-residue lysis protein with two functional regions: a soluble N-terminal domain (residues 1–40) that interacts with the bacterial chaperone DnaJ, and a transmembrane domain (residues 41–75) that disrupts the inner membrane to trigger host cell lysis. The goal of this project was to computationally design five single-point mutants with the potential to retain or enhance lysis activity. This was done by first running a Clustal Omega Multiple Sequence Alignment to map out conserved positions across homologs, all of which turned out to cluster exclusively in the soluble domain, pointing to the DnaJ interface as the most functionally constrained region of the protein. An LLR mutation heatmap was then generated and cross-referenced against an experimental lysis dataset; three mutations that appeared in both were excluded after showing a lysis score of zero experimentally, highlighting that LLR scores reflect structural stability rather than functional activity. The final five mutants, Y39L and S9Q in the soluble domain, and K50L, N53L, and T52L in the transmembrane domain, were selected based on the highest LLR scores while avoiding all conserved and experimentally failed positions.

Each mutant was then modeled as an octameric pore complex using AlphaFold Multimer to simulate the expected membrane assembly. The key findings were:

  • All five mutants formed a cylinder-like pore structure, consistent with the expected transmembrane assembly
  • pLDDT scores were low (< 50) across all models, and PAE plots showed near-zero confidence for inter-chain contacts
  • Running the same pipeline on R30Q, an experimentally validated lytic mutant, produced identical low-confidence results, suggesting this is a systematic limitation of AlphaFold for this class of small membrane-disrupting proteins rather than a reflection of the mutants’ actual viability
  • All five mutants remain candidates for wet lab validation

Details:

L-Protein Mutants

Option 1: Mutagenesis

Here is the Pictures of the Clustal Omega Multiple Sequence Alignment (MSA) Output

Clustal Omega Multiple Sequence Alignment (MSA) Output for the MS2 L Protein Part 1 Clustal Omega Multiple Sequence Alignment (MSA) Output for the MS2 L Protein Part 1 Clustal Omega Multiple Sequence Alignment (MSA) Output for the MS2 L Protein Part 2 Clustal Omega Multiple Sequence Alignment (MSA) Output for the MS2 L Protein Part 2

It seems like these Positions [21,25,28-29,33,35-37,40] have an “*” which means these have not changed at all and most probably are a totally conserved crucial region that should not be mutated, Positions [17,26,30] have a “:” which means they are highly conserved, but mutations that are very similar in shape, structure and chemical properties are tolerated, the rest seem to be more flexible.

Interesting Finding here, All the conserved regions seem to be in the Soluble Domain (1-40) that is responsible for DnaJ Interaction :D

This is the generated L Protein Mutation Heatmap

L Protein Mutation Heatmap L Protein Mutation Heatmap

I tried to cross reference with the experimental data sheet but it was quite hard to do manually so i wrote a script and ran it on Here on Colab to just find the common ones across the two files and came up with 3 common ones, however even though these 3 had quite a high LLR Score, the experimental data showed a Lysis score of 0, and i believe this shows the limitation in the structure based modeling, it predicted structural stability but failed to account for the functional mechanism of lysis.

Common Mutations Common Mutations

The common mutations identified by my algorithm

So Then i Filtered my generated mutations first to target the soluble domain (1-40) first while making sure to avoid the totally conserved regions [21,25,28-29,33,35-37,40], the highly conserved regions [17,26,30] and my 3 common matches to avoid choosing mutants that are either disrupting the protein or have been already experimented on with no lysis observed.

The two mutations i have decided to go with for the Soluble Domain are:

IndexPositionWild_Type_AAMutation_AALLR Score
139YL2.24177968502044
29SQ2.01432478427886

These have the highest LLR score in this region and avoid any conservative regions in the protein

Then i repeated the steps again, this time targeting the transmembrane domain (41-75) and followed the same criteria, and i picked these 2 mutations:

IndexPositionWild_Type_AAMutation_AALLR Score
350KL2.56146776676178
453NL1.86493206024169

And Again because These have the highest LLR score in this region and avoid any conservative regions in the protein

For the Final 5th mutant i decided to pick this one:

IndexPositionWild_Type_AAMutation_AALLR Score
552TL1.81396758556365

Because this one still has a relatively high LLR Score and is in the area where the L Protein does not overlap with either the Coat Protein or the replicase ones.

so here is the full 5 Mutations table i chose:

IndexPositionWild_Type_AAMutation_AALLR Score
139YL2.24177968502044
29SQ2.01432478427886
350KL2.56146776676178
453NL1.86493206024169
552TL1.81396758556365

AlphaFold Multimer Runs

Mutant 1 (Y39L)

The Monomer Sequence: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

The Multimer Sequence (the one i used for Alphafold Multimer): METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

Mutant 1 Multimer Front View Mutant 1 Multimer Front View Mutant 1 Multimer Side View Mutant 1 Multimer Side View

The L Proteins do form a cylinder like shape mimicking the transmembrane pore but the piDDT score are very low (<50) so this probably won’t express well or won’t express at all if done in wet lab :(.

Mutant 1 Multimer Predicted Aligned Error (PAE) Mutant 1 Multimer Predicted Aligned Error (PAE)

This is the Predicted Aligned Error (PAE), i asked AI (Gemini) how to interpret this and it said this:

Gemini’s Interpretation of Predicted Aligned Error (PAE) Plots Gemini’s Interpretation of Predicted Aligned Error (PAE) Plots

So following this, it seems like each monomer folds correctly with high confidence yet their together-grouping is not reliable at all with very low confidence scores possibly hinting that the pore forming shape we saw might not actually happen (i hope i understood that correctly XD)

Mutant 2 (S9Q)

The Monomer Sequence: METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

The Multimer Sequence (the one i used for Alphafold Multimer): METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQQQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

Mutant 2 Multimer Front View Mutant 2 Multimer Front View Mutant 2 Multimer Side View Mutant 2 Multimer Side View

Same exact findings for this mutant too :(.

Mutant 2 Multimer Predicted Aligned Error (PAE) Mutant 2 Multimer Predicted Aligned Error (PAE)

Again, Same Here as well. (it is the same for all five mutants :(. )

Mutant 3 (K50L)

The Monomer Sequence: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT

The Multimer Sequence (the one i used for Alphafold Multimer): METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT

Mutant 3 Multimer Front View Mutant 3 Multimer Front View Mutant 3 Multimer Side View Mutant 3 Multimer Side View Mutant 3 Multimer Predicted Aligned Error (PAE) Mutant 3 Multimer Predicted Aligned Error (PAE)

Mutant 4 (N53L)

The Monomer Sequence: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT

The Multimer Sequence (the one i used for Alphafold Multimer): METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTLQLLLSLLEAVIRTVTTLQQLLT

Mutant 4 Multimer Front View Mutant 4 Multimer Front View Mutant 4 Multimer Side View Mutant 4 Multimer Side View Mutant 4 Multimer Predicted Aligned Error (PAE) Mutant 4 Multimer Predicted Aligned Error (PAE)

Mutant 5 (T52L)

The Monomer Sequence: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT

The Multimer Sequence (the one i used for Alphafold Multimer): METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFLNQLLLSLLEAVIRTVTTLQQLLT

Mutant 5 Multimer Front View Mutant 5 Multimer Front View Mutant 5 Multimer Side View Mutant 5 Multimer Side View Mutant 5 Multimer Predicted Aligned Error (PAE) Mutant 5 Multimer Predicted Aligned Error (PAE)

I Actually decided to pick a mutant from the Experimental Data Sheet and made sure it has been proven to have the Lysis Effect, my aim is to try to perform the AlphaFold Multimer step for it, to have a look at how different it might be, the mutant i picked was R30Q.

This is the monomer sequence: METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

This is the full Alphafold sequence i used: METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT:METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

Experimental Mutant Multimer Front View Experimental Mutant Multimer Front View Experimental Mutant Multimer Side View Experimental Mutant Multimer Side View Experimental Mutant Multimer Predicted Aligned Error (PAE) Experimental Mutant Multimer Predicted Aligned Error (PAE)

Well i got bad news and good news, the bad news is, the structre is also of very low confidence and the Predicted Aligned Error (PAE) Plot shows the same low confidence for the monomer’s interaction with each othe, the good news though is that this is the run of a mutant that has been experimentally validated and has the lysis effect and protein level determined, so maybe this gives me hope that my five mutants might actually stand a chance in a wet lab validation regardless of the very low confidence scores it got.

Subsections of Group Final Project

Week 4

Proposal:

By: @2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji

  • We decided to focus on the main area of increasing the stability of the MS2 phage lysis protein L, with a possible secondary goal of reducing the dependency on host DnaJ, while still maintaining the lysis action.
  • The tools AlphaFold, Clustal Omega, BLAST, ESM, and ESMFold were discussed.
  • BLAST can pull out homologous lysis proteins from the databases.
  • Clustal Omega can create MSAs to identify essential L48-S49 residues, and the pore-forming regions that must not be mutated.
  • ESM can create mutation heatmaps, which can guide the use of ESMFold to obtain highest score foldings in mutatable regions.
  • AlphaFold Multimer predicts whether the subunits of our protein can successfully create a pore in the host membrane, and also to check whether N-terminus can break the interaction with DnaJ.
  • We also identified a few pitfalls, with majors ones dealing with limited training datasets, that may not be properly aligned towards creating a transmembrane lysis protein.
  • Some other pitfalls include the lack of proper annotations for amurins; the possibility of an over-stable protein to form non-functional aggregates; and the vulnerability of modified protein to host proteases.

Paper summaries:

By: @2026a-ritika-saha
MS2 Lysis of Escherichia coli Depends on Host Chaperone DnaJ

The study shows that the MS2 phage lysis protein L requires the host chaperone DnaJ for efficient host cell lysis. A missense mutation (P330Q) in the highly conserved C-terminal domain of DnaJ blocks MS2 L-mediated lysis at 30 °C and delays lysis at higher temperatures, without affecting overall L protein synthesis. The defect is specific to L-mediated lysis and does not affect lysis by other phage lysis proteins.

Genetic suppressor screening identified Lodj alleles of the L gene that bypass the DnaJ requirement. These alleles encode truncated L proteins lacking the highly basic N-terminal domain, indicating that this domain confers dependence on DnaJ. Biochemical assays demonstrated that wild-type L forms a membrane-associated complex with DnaJ, whereas the P330Q DnaJ variant cannot interact with L.

The authors propose that DnaJ functions as a chaperone that facilitates proper folding or conformational activation of full-length L, preventing steric interference from the N-terminal domain and allowing L to interact with its unknown cellular target. Removal of the dispensable N-terminal domain eliminates the need for chaperone assistance and accelerates lysis.

The work identifies DnaJ as a host factor regulating MS2 lysis timing and suggests that chaperone-dependent modulation of lysis may be an evolutionary strategy to optimize phage replication cycles.


Mutational analysis of the MS2 lysis protein L

This study performed comprehensive mutational and genetic analyses of the MS2 phage lysis protein L to identify residues and domains required for function. Random mutagenesis of the 75-aa L protein showed that most loss-of-function mutations cluster in the C-terminal half of the protein, especially around a conserved Leu-Ser (LS) dipeptide motif. Many inactivating mutations were conservative amino-acid substitutions and did not affect protein accumulation or membrane association, suggesting that L function depends on specific protein–protein interactions rather than nonspecific membrane disruption.

Functional studies demonstrated that L-mediated lysis requires interaction with the host chaperone DnaJ. The highly basic N-terminal domain of L is dispensable for lytic activity but mediates DnaJ dependence. Truncation of this domain or certain suppressor mutations bypassed the chaperone requirement and restored rapid lysis.

Biochemical and genetic data support a model in which L is an integral membrane protein whose essential domains (including the LS motif and neighboring regions) form a helical structure that likely engages a host membrane target protein. The interaction may occur near sites of membrane curvature associated with peptidoglycan biosynthesis rather than by forming nonspecific membrane lesions.

The work, supported in part by the Center for Phage Technology and associated laboratories including research by Ry Young, suggests that MS2 L functions through a specific heterotypic protein–protein interaction mechanism and that chaperone-dependent regulation helps control lysis timing during infection.

The study refines the mechanistic model of MS2 lysis, proposing that conserved structural motifs rather than general membrane disruption drive lytic activity.


In vitro characterization of the phage lysis protein MS2-L

This study provides detailed in vitro and in vivo characterization of the MS2 lysis protein MS2-L, focusing on its membrane insertion mechanism, oligomerization behavior, and interaction with the host chaperone DnaJ.

Key findings show that MS2-L is a 75-amino-acid phage toxin whose essential lytic activity resides in the C-terminal ~35 amino acids, which form a hydrophobic transmembrane region. The N-terminal soluble domain is not required for bacterial killing but modulates folding, membrane insertion efficiency, and chaperone interaction.

Biochemical assays demonstrate that MS2-L interacts directly with DnaJ, primarily through the soluble N-terminal domain. However, this interaction does not significantly affect membrane insertion, solubilization, or oligomerization of the toxin, suggesting that DnaJ functions more as a folding or stabilization partner rather than being essential for lytic activity.

Native mass spectrometry revealed that MS2-L assembles into high-order oligomeric complexes (≥10 monomers) after insertion into lipid nanodiscs, and oligomerization is driven mainly by the transmembrane domain. In detergent environments, oligomer formation is reduced, indicating that membrane lipid context is important for stable assembly.

Fluorescence microscopy and cryo-electron microscopy showed that MS2-L expression in bacteria leads to peripheral membrane clustering, followed by sequential lesion formation beginning in the outer membrane, then disruption of the peptidoglycan layer, and finally inner membrane disintegration with cytoplasmic leakage.

The data support a model in which MS2-L functions as a pore-forming phage toxin that kills cells through higher-order oligomerization within the bacterial membrane, rather than by directly inhibiting peptidoglycan biosynthesis. Chaperone DnaJ binds MS2-L but is not required for membrane insertion or pore assembly, suggesting its role is mainly in modulating toxin folding or stability.

These findings strengthen the concept that MS2-L belongs to the amurin/single-gene lysis protein family and may be useful for bioengineering applications such as bacterial ghost cell production and antimicrobial design.


Phage therapy: From biological mechanisms to future directions

This review from Elsevier surveys the biological mechanisms, clinical development, and future directions of phage therapy as a strategy to combat antimicrobial resistance. It explains that therapeutic phages should ideally be strictly lytic, highly host-specific, and thoroughly characterized to ensure safety and efficacy.

The article describes how phages kill bacteria through mechanisms such as inhibition of essential cellular processes, expression of lysis proteins, or disruption of bacterial membranes. It also discusses advances in phage engineering, including synthetic genome construction and modification of phage host range and virulence.

Clinical applications of phage therapy are highlighted, particularly for treating drug-resistant infections where antibiotics are ineffective. However, challenges remain, including bacterial resistance to phages, regulatory hurdles, manufacturing standardization, and the need to understand phage–host interactions.

Future directions include the use of genetically modified or synthetic phages, computational prediction of therapeutic candidates, and integration of phage therapy with conventional antimicrobial strategies. Overall, phage therapy is presented as a promising but still developing alternative to antibiotics in the fight against antimicrobial resistance.


Generative design of novel bacteriophages with genome language models

This preprint reports the first experimental demonstration of generative design of complete bacteriophage genomes using genome language models (Evo 1 and Evo 2). The authors fine-tuned models on about 15,000 Microviridae phage genomes to enable autoregressive generation of full viral genomes guided by template-based prompts and biologically motivated design constraints.

The workflow involved computational generation followed by multi-tier filtering for sequence quality, host tropism specificity, and evolutionary diversity. Constraints included genome length (4–6 kb), GC content, absence of long homopolymers, preservation of phage-like gene architecture, and spike protein similarity to the template phage to maintain host targeting.

Experimental validation showed that about 285 of 302 synthesized genome candidates could be assembled, and 16 produced viable infectious phages that inhibited growth of the target host strain. These generated phages displayed substantial sequence novelty, containing hundreds of mutations relative to natural Microviridae genomes, while preserving functional genome organization.

Structural and functional analyses indicated that some generated phages possessed altered protein interfaces but maintained compatible capsid–protein interactions. Cryo-electron microscopy and structure prediction suggested context-dependent co-evolution of structural proteins such as capsid and packaging proteins.

Fitness assays showed that several AI-generated phages matched or exceeded the replication and lytic performance of the template phage, and phage cocktail experiments demonstrated rapid suppression of resistant bacterial strains through recombination and mutation-driven adaptation.

The study was conducted with biosafety considerations, including restricting model training to bacteriophage genomes and using well-characterized laboratory strains. The work was supported by researchers affiliated with institutions such as the Stanford University and the Arc Institute.

Overall, the paper proposes a framework for generative genome engineering, showing that AI models can design biologically viable and evolutionarily novel bacteriophages, potentially enabling future synthetic biology and phage-based therapeutic development.


Overview of the Project Proposal: Engineering the MS2 Phage Lysis Protein L

By: @2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji

1. Project Goal

Our primary goal is to increase the structural stability of the MS2 bacteriophage lysis protein (L) while maintaining its ability to lyse bacterial cells.

Our secondary goal is to reduce the dependency of L on the host chaperone DnaJ, which normally assists the protein in folding or activation. Reducing this dependency could allow the lysis protein to function more efficiently and independently in engineered systems.

The MS2 L protein is a 75-amino-acid single-gene lysis toxin whose C-terminal region forms a hydrophobic transmembrane domain responsible for membrane disruption and pore formation, while the basic N-terminal domain interacts with host factors such as DnaJ. Previous studies show that truncation of the N-terminal region can bypass the DnaJ requirement while preserving lysis activity.

Therefore, our design strategy focuses on:

  • Stabilizing the transmembrane and oligomerization regions
  • Maintaining essential functional motifs such as the L48–S49 motif
  • Exploring modifications to the N-terminal region to reduce DnaJ dependence

2. Computational Tools and Approaches

We will use a multi-step computational protein engineering pipeline combining sequence analysis, machine-learning mutagenesis predictions, and structural modeling.

2.1 BLAST – Homolog Discovery

First, we will use BLAST to identify homologous lysis proteins from related bacteriophages.

Purpose:

  • Identify evolutionarily conserved residues
  • Discover natural sequence variations that maintain function
  • Build a dataset for multiple sequence alignment

This will help determine which regions are functionally constrained vs mutable.

2.2 Clustal Omega – Multiple Sequence Alignment (MSA)

Using sequences obtained from BLAST, we will perform multiple sequence alignment with Clustal Omega.

Purpose:

  • Identify highly conserved residues, especially around the L48–S49 motif
  • Map essential structural regions
  • Determine which residues are safe to mutate

Regions with high conservation will be protected from mutation, while variable regions may be targeted for stability improvements.

2.3 ESM (Protein Language Models) – In Silico Mutagenesis

Next, we will use ESM (Evolutionary Scale Modeling) protein language models to perform systematic mutation scanning.

Purpose:

  • Generate mutation heatmaps
  • Predict which amino acid substitutions improve protein fitness or stability
  • Identify mutations compatible with the evolutionary sequence landscape

This step will guide rational mutation selection instead of random mutagenesis.

2.4 ESMFold – Structure Prediction for Mutants

Promising mutations from ESM analysis will be modeled using ESMFold.

Purpose:

  • Predict 3D structures of mutant proteins
  • Evaluate structural stability
  • Ensure the transmembrane helix remains intact

Mutations that significantly distort the fold will be discarded.

2.5 AlphaFold Multimer – Oligomerization and Host Interaction

Finally, we will use AlphaFold Multimer to analyze:

  1. L protein oligomerization
  2. Potential interactions with DnaJ

Purpose:

  • Predict whether mutated L proteins can form the oligomeric pore complex
  • Evaluate whether N-terminal mutations reduce interaction with DnaJ

Since MS2-L likely forms large oligomeric pores (>10 subunits) in the membrane, maintaining correct protein in1.Phage L protein sequence

Computational Workflow:

  1. Phage L protein sequence
  2. BLAST Search (find homologous lysis proteins)
  3. Multiple Sequence Alignment (Clustal Omega)
    • identify conserved vs mutable residues
  4. ESM Mutation Scanning (generate mutation heatmaps)
  5. Select Candidate Mutations (stability or N-terminal modifications)
  6. Structure Prediction (ESMFold)
  7. Complex/Oligomer Prediction (AlphaFold Multimer)
  8. Final Mutant Candidates (stable + functional lysis protein)

3. Proposed Engineering Pipeline

Computational workflow we will follow.

4. Expected Outcomes

Our pipeline aims to produce engineered variants of the MS2 L protein with:

  • Increased structural stability
  • Reduced aggregation risk
  • Maintained transmembrane insertion
  • Potentially reduced dependency on host DnaJ

These optimized proteins could be useful in applications such as:

  • Synthetic phage engineering
  • Bacterial ghost cell production
  • Antimicrobial protein development

5. Potential Pitfalls

5.1 Limited Training Data

Most protein language models and structural predictors are trained primarily on globular proteins, not small transmembrane phage toxins.

This may reduce prediction accuracy for MS2 L.

5.2 Risk of Over-Stabilization

Mutations designed to increase stability may cause:

  • Protein aggregation
  • Improper membrane insertion
  • Loss of functional oligomerization

Thus stability must be balanced with function.

5.3 Poor Annotation of Amurin Proteins

Single-gene lysis proteins (also called amurins) are poorly annotated in sequence databases.

This may limit the quality of homologous sequences used for alignment and training.

5.4 Host Protease Sensitivity

Mutations may unintentionally expose protease cleavage sites, making the engineered protein less stable inside bacterial cells.

6. Future Work

If promising mutants are identified computationally, the next steps would include:

  • Experimental expression in E. coli
  • Measuring lysis timing
  • Measuring protein stability
  • Testing DnaJ independence

This would validate whether computational predictions translate into improved biological function.

Week 5

L-Protein Mutants Project Summary:

@2026a-nourelden-rihan

The MS2 bacteriophage L-protein is a small 75-residue lysis protein with two functional regions: a soluble N-terminal domain (residues 1–40) that interacts with the bacterial chaperone DnaJ, and a transmembrane domain (residues 41–75) that disrupts the inner membrane to trigger host cell lysis. The goal of this project was to computationally design five single-point mutants with the potential to retain or enhance lysis activity. This was done by first running a Clustal Omega Multiple Sequence Alignment to map out conserved positions across homologs, all of which turned out to cluster exclusively in the soluble domain, pointing to the DnaJ interface as the most functionally constrained region of the protein. An LLR mutation heatmap was then generated and cross-referenced against an experimental lysis dataset; three mutations that appeared in both were excluded after showing a lysis score of zero experimentally, highlighting that LLR scores reflect structural stability rather than functional activity. The final five mutants, Y39L and S9Q in the soluble domain, and K50L, N53L, and T52L in the transmembrane domain, were selected based on the highest LLR scores while avoiding all conserved and experimentally failed positions.

Each mutant was then modeled as an octameric pore complex using AlphaFold Multimer to simulate the expected membrane assembly. The key findings were:

  • All five mutants formed a cylinder-like pore structure, consistent with the expected transmembrane assembly
  • pLDDT scores were low (< 50) across all models, and PAE plots showed near-zero confidence for inter-chain contacts
  • Running the same pipeline on R30Q, an experimentally validated lytic mutant, produced identical low-confidence results, suggesting this is a systematic limitation of AlphaFold for this class of small membrane-disrupting proteins rather than a reflection of the mutants’ actual viability
  • All five mutants remain candidates for wet lab validation

Full documentation, sequences, and AlphaFold outputs are available in the week 5 homework.