Week 5 — Protein Design Part II
HTGAA Spring 2026 | Week 5 Homework Designing peptide binders for A4V SOD1 and engineering MS2 L-protein mutants using protein language models and structural prediction.
Part A — SOD1 Binder Peptide Design
Target: Superoxide dismutase 1 (SOD1) carrying the A4V mutation (Ala→Val at residue 4), which causes familial ALS by destabilising the N-terminus and promoting toxic aggregation.
A4V Mutant SOD1 sequence used throughout:
Part 1 — Generate Binders with PepMLM
PepMLM (Peptide Masked Language Model) was used to generate peptide binders conditioned on the A4V mutant SOD1 sequence. The model was run via the PepMLM-650M HuggingFace Colab, with peptide length set to 12 amino acids and 4 peptides generated.
Mask token handling: The generated peptides initially contained a trailing X mask token at position 12. The masked position was resolved by exhaustively scoring all 20 standard amino acids at that position in the context of the target sequence and selecting the highest-probability amino acid. Pseudo-perplexity was then recalculated for all complete 12-mers using the masked language modelling approach — masking each position sequentially and computing the log-probability of the true residue.
Results
| # | Peptide sequence | Type | Pseudo-perplexity ↓ |
|---|---|---|---|
| 1 | WRSYAVGAALWK | PepMLM generated | 9.79 |
| 2 | WRYGAAAGEWWA | PepMLM generated | 11.19 |
| 3 | WRYPPTVVGHKD | PepMLM generated | 15.16 |
| 4 | KRSPVVAGEHKK | PepMLM generated | 18.27 |
| 5 | FLYRWLPSRRGG | Known binder (reference) | 20.42 |
Lower pseudo-perplexity = higher model confidence in binding. All four PepMLM-generated peptides outscored the known binder FLYRWLPSRRGG (20.42). Three of the four generated peptides begin with WR, suggesting PepMLM converged on tryptophan-arginine as a favoured N-terminal motif for engaging the SOD1 surface — W provides hydrophobic bulk and aromatic stacking, while R contributes electrostatic complementarity.
Part 2 — Evaluate Binders with AlphaFold3
Each peptide was co-folded with A4V mutant SOD1 as a two-chain complex on the AlphaFold Server. The ipTM (interface predicted TM-score) measures confidence in the predicted protein-peptide interface; a higher value indicates a more confident, tighter interface prediction.
Results
| Peptide | Type | ipTM ↑ | PAE min (Å) ↓ | Ranking score |
|---|---|---|---|---|
WRSYAVGAALWK | PepMLM | 0.58 | 4.12 / 5.28 | 0.67 |
WRYPPTVVGHKD | PepMLM | 0.43 | 6.52 / 8.34 | 0.56 |
WRYGAAAGEWWA | PepMLM | 0.37 | 7.49 / 8.40 | 0.51 |
KRSPVVAGEHKK | PepMLM | 0.37 | 6.63 / 8.79 | 0.51 |
FLYRWLPSRRGG | Known binder | 0.36 | 7.00 / 10.37 | 0.49 |
PAE min values shown as SOD1→peptide / peptide→SOD1. No steric clashes detected in any model. All structures: fraction_disordered = 0.07.
Analysis: AlphaFold3 predicts that WRSYAVGAALWK forms the most confident interface with A4V SOD1 (ipTM 0.58), substantially exceeding the known binder (0.36). The interface PAE of 4.12/5.28 Å is the tightest of all five peptides. In the predicted structure, WRSYAVGAALWK docks along the surface β-barrel near the N-terminal region where V4 sits, suggesting it may directly engage the destabilised N-terminus. WRYPPTVVGHKD ranks second (ipTM 0.43); WRYGAAAGEWWA and KRSPVVAGEHKK both score 0.37, comparable to the known binder. The known binder shows the weakest peptide→SOD1 interface PAE (10.37 Å), consistent with a loosely anchored docking pose.
WRSYAVGAALWK is the standout candidate — it outperforms the known binder on both pseudo-perplexity (9.79 vs 20.42) and ipTM (0.58 vs 0.36).
Part 3 — Evaluate Therapeutic Properties with PeptiVerse
Each PepMLM-generated peptide was evaluated on PeptiVerse for binding affinity, solubility, hemolysis probability, net charge, and molecular weight using the A4V SOD1 sequence as the target.
Results
| Peptide | Binding affinity | pKd/pKi | Solubility | Hemolysis (prob.) | Net charge | MW (Da) |
|---|---|---|---|---|---|---|
WRSYAVGAALWK | Medium | 7.032 | Soluble (1.000) | Non-hemolytic (0.025) | +1.76 | 1407.6 |
WRYGAAAGEWWA | Weak | 6.986 | Soluble (1.000) | Non-hemolytic (0.091) | −0.24 | 1423.5 |
WRYPPTVVGHKD | Weak | 4.802 | Soluble (1.000) | Non-hemolytic (0.021) | +0.85 | 1454.6 |
KRSPVVAGEHKK | Weak | 5.355 | Soluble (1.000) | Non-hemolytic (0.011) | +2.85 | 1335.6 |
Analysis: All four peptides are predicted to be fully soluble and non-hemolytic. WRSYAVGAALWK is the only peptide classified as a medium binder (pKd 7.032), aligning with its superior AlphaFold3 ipTM. Notably, WRYPPTVVGHKD ranked 2nd structurally (ipTM 0.43) yet shows the weakest predicted affinity (pKd 4.802), suggesting its AF3 interface may not reflect strong binding energetics. All molecular weights fall within a reasonable therapeutic range (~1300–1455 Da).
Peptide selected to advance: WRSYAVGAALWK. This peptide consistently ranks first across all three evaluation layers — lowest pseudo-perplexity (9.79), highest ipTM (0.58) with tightest interface PAE, and strongest predicted binding affinity (pKd 7.032). It is fully soluble, non-hemolytic, and carries a mildly positive net charge (+1.76) that may aid electrostatic engagement with the SOD1 surface.
Part 4 — Generate Optimised Peptides with moPPIt
moPPIt uses Multi-Objective Guided Discrete Flow Matching (MOG-DFM) to simultaneously optimise binding affinity, hemolysis safety, non-fouling, and motif engagement at user-specified residue positions — a fundamentally different design paradigm from PepMLM’s sequence-conditioned sampling.
Parameters used:
- Target: A4V mutant SOD1
- Peptide length: 12 amino acids
- Objectives enabled: Hemolysis, Affinity, Solubility, Motif
- Motif positions: residues 1–6 (the N-terminal region containing the A4V mutation site)
- Samples: 4
Results
| # | Peptide | Hemolysis ↑ | Non-fouling ↑ | pKd ↑ | Motif score ↑ |
|---|---|---|---|---|---|
| 1 | KKQEYKEILTCR | 0.978 | 0.833 | 7.20 | 0.889 |
| 2 | EQKKQFKEYACN | 0.953 | 0.833 | 6.61 | 0.885 |
| 3 | FSKKRASYRQLC | 0.935 | 0.750 | 6.62 | 0.833 |
| 4 | RQKKKPGGKYFY | 0.965 | 0.833 | 6.58 | 0.737 |
moPPIt vs PepMLM: While PepMLM consistently converged on WR N-termini, moPPIt generated peptides rich in charged residues (K, R, E) and cysteines — reflecting steering toward the charged N-terminal pocket of SOD1. moPPIt’s explicit motif guidance at residues 1–6 ensures all generated peptides are designed to engage the A4V mutation site directly. The top candidate KKQEYKEILTCR achieves pKd 7.20 and motif score 0.889.
Pre-clinical advancement criteria: Before advancing to clinical studies, candidates would require: (1) experimental binding validation via SPR or ITC; (2) cellular toxicity assays; (3) protease stability profiling; (4) in vivo pharmacokinetic studies; (5) aggregation inhibition assays in SOD1-expressing neuronal cell lines. KKQEYKEILTCR (moPPIt) and WRSYAVGAALWK (PepMLM) would be advanced as primary candidates for head-to-head experimental comparison.
Part C — L-Protein Engineering
Objective: Engineer the MS2 bacteriophage lysis protein (L-protein) to overcome E. coli resistance. E. coli acquires resistance by mutating the DnaJ chaperone, preventing L-protein folding and function. The goal is to design variants that are DnaJ-independent or more efficient membrane lytics.
Wild-type L-protein sequence (UniProt P03609):
Domain structure:
| Domain | Residues | Function |
|---|---|---|
| Soluble domain | 1–41 | Interacts with DnaJ chaperone; key to resistance mechanism |
| Transmembrane domain | 42–75 | Inserts into membrane; forms pores that lyse bacterial cell |
Option 1 — ESM2 Log Likelihood Ratio Score-Guided Mutagenesis
Scoring methodology
ESM2 (facebook/esm2_t6_8M_UR50D) was used to compute Log Likelihood Ratios (LLRs) for all possible single amino acid substitutions at every position:
A positive LLR indicates the model considers the mutation more evolutionarily likely than the wild-type — a proxy for structural tolerance. The full scoring run produced 1,500 mutation scores (75 positions × 20 amino acids).
ESM2 vs Experimental Data Correlation
| Metric | Value |
|---|---|
| Mutations matched between ESM and experimental data | 100 |
| Mean LLR for beneficial mutations (lysis=1) | −0.156 |
| Mean LLR for detrimental mutations (lysis=0) | −0.407 |
| Point-biserial correlation (r) | 0.098 |
| p-value | 0.331 (not significant) |
ESM2 LLR scores show weak, non-significant correlation with experimental lysis activity (r=0.098, p=0.33). Experimentally confirmed beneficial mutations such as R20W and L44P carry negative LLR scores, while some detrimental mutations (e.g. C29R, LLR=2.40) rank very highly. ESM2 captures evolutionary fitness in general protein families, not specifically lysis function — demonstrating a key limitation of sequence-only language models for small, atypical membrane proteins with few evolutionary homologues.
Top ESM2 mutations by region
Soluble domain (positions 1–41):
| Mutation | Position | LLR score |
|---|---|---|
| C29R | 29 | 2.395 |
| Y39L | 39 | 2.242 |
| S9Q | 9 | 2.014 |
| F5Q | 5 | 1.795 |
| Y27R | 27 | 1.628 |
| F22R | 22 | 1.602 |
Transmembrane domain (positions 42–75):
| Mutation | Position | LLR score |
|---|---|---|
| K50L | 50 | 2.562 |
| N53L | 53 | 1.865 |
| E61L | 61 | 1.818 |
| T52L | 52 | 1.814 |
| A45L | 45 | 1.539 |
| Q71L | 71 | 1.126 |
Option 1 Mutants and AF2-Multimer Results
Five mutants were designed by selecting the highest-LLR positions per region (≥3 mutations each, 2 soluble, 2 TM, 1 mixed). Each was co-folded with DnaJ using AF2-Multimer (ColabFold).
| Mutant | Mutations | Region | LLR scores | ipTM | pTM | pLDDT |
|---|---|---|---|---|---|---|
| O1-M1 | C29R, Y39L, S9Q | Soluble | 2.40, 2.24, 2.01 | 0.170 | 0.530 | 75.29 |
| O1-M2 | F5Q, Y27R, F22R | Soluble | 1.80, 1.63, 1.60 | 0.140 | 0.520 | 75.03 |
| O1-M3 | K50L, N53L, E61L | TM | 2.56, 1.87, 1.82 | 0.150 | 0.520 | 76.10 |
| O1-M4 | T52L, A45L, Q71L | TM | 1.81, 1.54, 1.13 | 0.150 | 0.520 | 76.10 |
| O1-M5 | C29R, Y39L, K50L | Mixed | 2.40, 2.24, 2.56 | 0.160 | 0.530 | 75.31 |
Mutant sequences:
| Mutant | Sequence |
|---|---|
| WT | METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
| O1-M1 | METRFPQQQQQTPASTNRRRPFKHEDYPRRRQQRSSTLLVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
| O1-M2 | METRQPQQSQQTPASTNRRRPRKHEDRPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
| O1-M3 | METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSLFTLQLLLSLLLAVIRTVTTLQQLLT |
| O1-M4 | METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLLIFLSKFLNQLLLSLLEAVIRTVTTLLQLLT |
| O1-M5 | METRFPQQSQQTPASTNRRRPFKHEDYPRRRQQRSSTLLVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT |
Option 3 — Random Mutagenesis Guided by Experimental Data
Method
A Python function was written to generate random mutation combinations constrained to experimentally validated beneficial positions (lysis=1) from the L-Protein Mutants dataset. Of 139 experimental mutations, 35 showed beneficial lysis activity at 13 positions: 10 in the soluble domain and 3 in the TM region.
Validated beneficial positions:
| Region | Positions | Confirmed substitutions |
|---|---|---|
| Soluble | 13, 15, 18, 19, 20, 23, 25, 26, 30, 31 | P13L, S15A, R18G/I, R19S/H, R20W/L, K23E, E25V/G/D, D26G, R30Q/L, R31I |
| TM | 44, 45, 46 | L44P, A45P, I46F |
The function ensures ≥3 mutations per mutant, avoids stop codon-inducing mutations, and satisfies the 2-soluble / 2-TM / 1-mixed regional requirement.
Option 3 Mutants and AF2-Multimer Results
| Mutant | Mutations | Region | ipTM | pTM | pLDDT |
|---|---|---|---|---|---|
| O3-M1 | P13L, R18G, E25G | Soluble | 0.160 | 0.530 | 75.03 |
| O3-M2 | R20W, K23E, R30Q | Soluble | 0.160 | 0.520 | 74.97 |
| O3-M3 | L44P, A45P, I46F | TM | 0.150 | 0.530 | 75.07 |
| O3-M4 | L44P, I46F, R19S | TM-focused | 0.180 | 0.540 | 75.16 |
| O3-M5 | S15A, E25V, L44P, A45P | Mixed | 0.180 | 0.540 | 74.93 |
Mutant sequences:
| Mutant | Sequence |
|---|---|
| WT | METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
| O3-M1 | METRFPQQSQQTLASTNGRRPFKHGDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
| O3-M2 | METRFPQQSQQTPASTNRRWPFEHEDYPCQRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
| O3-M3 | METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFPPFFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
| O3-M4 | METRFPQQSQQTPASTNRSRPFKHEDYPCRRQQRSSTLYVLIFPAFFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
| O3-M5 | METRFPQQSQQTPAATNRRRPFKHVDYPCRRQQRSSTLYVLIFPPIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT |
Option 1 vs Option 3 — Comparative Analysis
| Criterion | Option 1 (ESM-guided) | Option 3 (Experimental-guided) |
|---|---|---|
| Mutation selection basis | ESM2 LLR (evolutionary likelihood) | Experimental lysis=1 validated mutations |
| Best ipTM achieved | 0.170 (O1-M1: C29R, Y39L, S9Q) | 0.180 (O3-M4 and O3-M5) |
| ESM-experimental correlation | Weak (r=0.098, p=0.33) | Not applicable |
| Coverage of sequence space | Full genome scan (all 75 positions) | Limited to 13 validated positions |
| Risk of harmful mutations | Higher — high LLR ≠ lysis activity | Lower — all mutations pre-validated |
| Best candidate to advance | O1-M1 (C29R, Y39L, S9Q) | O3-M5 (S15A, E25V, L44P, A45P) |
Option 3 produces slightly better AF2-Multimer scores because its mutations are drawn from positions experimentally confirmed to preserve or improve lysis function — the protein is more likely to retain a folded, interaction-competent conformation. Option 1 provides a richer, genome-wide map of evolutionary tolerance via the ESM2 heatmap, but its predictions do not correlate well with lysis phenotype for this atypical small membrane protein. Together, both approaches offer complementary views: Option 1 highlights evolutionarily permissive positions, while Option 3 grounds mutation selection in direct functional evidence.
Defining a “good” mutant: A good L-protein mutant must simultaneously satisfy: (1) computational — high pLDDT in the soluble domain indicating stable folding; (2) mechanistic — altered or weakened interface with DnaJ, reflecting chaperone independence; (3) functional — maintained TM helix propensity for efficient membrane insertion; and (4) experimental — clear plaques on DnaJ-mutant resistant E. coli strains in plaque assays, which is the definitive test this project addresses. O3-M5 (S15A, E25V, L44P, A45P) is the top candidate to advance — it targets both resistance mechanisms simultaneously by combining soluble-domain mutations that reduce DnaJ dependency with TM mutations that alter membrane insertion geometry.
Assignment Summary
| Part | Tool used | Key result |
|---|---|---|
| A-1 | PepMLM | WRSYAVGAALWK (perplexity 9.79) outperforms known binder (20.42) |
| A-2 | AlphaFold3 | WRSYAVGAALWK ipTM 0.58 vs known binder 0.36; tightest predicted interface |
| A-3 | PeptiVerse | All peptides soluble + non-hemolytic; WRSYAVGAALWK only medium binder (pKd 7.03) |
| A-4 | moPPIt | KKQEYKEILTCR — pKd 7.20, motif score 0.889; targets A4V site directly |
| C Option 1 | ESM2 + AF2-Multimer | Heatmap generated; weak ESM-experiment correlation (r=0.098); best: O1-M1 (ipTM 0.17) |
| C Option 3 | Experimental data + AF2-Multimer | Best candidates: O3-M4 and O3-M5 (both ipTM 0.18) |
| Overall | — | SOD1 binder: WRSYAVGAALWK; L-protein: O3-M5 (S15A, E25V, L44P, A45P) |