https://pages.htgaa.org/2026a/rahul-yaji/homework/week-05-hw-protein-design-part-ii/index.htmlPart 1: Generate Binders with PepMLM Retrieve sequence and introduce mutation: (Pasted the sequence from UniPort, deleted M at 1st position, changed A to V at 4th position.) ATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ Structure of the native sequence- predicted vs actual: Generate 4 peptides using PepMLM Colab: index Binder Pseudo Perplexity 1 WRSPAVAVAHWE 7.76721411356481 2 WRVGWVGVELKE 24.2058244561383 3 WRSPAAXIEHKX 11.243453670563373 4 WRVYAAXIEWGK 20.449723821548965 Known binder: FLYRWLPSRRGG Perplexity score: 22.5252 A note about perplexity score: A key evaluation metric for language models that measures how well a probability model predicts a sample. Lower the score, higher the confidence of the model that the output satisfies the criteria.Hugoen