Group Final Project
Group Name: Phage Forge
Group Members:
@2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji, and @2026a-keerthana-gunaretnam
@2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji, and @2026a-keerthana-gunaretnam
By: @2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji
By: @2026a-ritika-saha
MS2 Lysis of Escherichia coli Depends on Host Chaperone DnaJ
The study shows that the MS2 phage lysis protein L requires the host chaperone DnaJ for efficient host cell lysis. A missense mutation (P330Q) in the highly conserved C-terminal domain of DnaJ blocks MS2 L-mediated lysis at 30 °C and delays lysis at higher temperatures, without affecting overall L protein synthesis. The defect is specific to L-mediated lysis and does not affect lysis by other phage lysis proteins.
Genetic suppressor screening identified Lodj alleles of the L gene that bypass the DnaJ requirement. These alleles encode truncated L proteins lacking the highly basic N-terminal domain, indicating that this domain confers dependence on DnaJ. Biochemical assays demonstrated that wild-type L forms a membrane-associated complex with DnaJ, whereas the P330Q DnaJ variant cannot interact with L.
The authors propose that DnaJ functions as a chaperone that facilitates proper folding or conformational activation of full-length L, preventing steric interference from the N-terminal domain and allowing L to interact with its unknown cellular target. Removal of the dispensable N-terminal domain eliminates the need for chaperone assistance and accelerates lysis.
The work identifies DnaJ as a host factor regulating MS2 lysis timing and suggests that chaperone-dependent modulation of lysis may be an evolutionary strategy to optimize phage replication cycles.
Mutational analysis of the MS2 lysis protein L
This study performed comprehensive mutational and genetic analyses of the MS2 phage lysis protein L to identify residues and domains required for function. Random mutagenesis of the 75-aa L protein showed that most loss-of-function mutations cluster in the C-terminal half of the protein, especially around a conserved Leu-Ser (LS) dipeptide motif. Many inactivating mutations were conservative amino-acid substitutions and did not affect protein accumulation or membrane association, suggesting that L function depends on specific protein–protein interactions rather than nonspecific membrane disruption.
Functional studies demonstrated that L-mediated lysis requires interaction with the host chaperone DnaJ. The highly basic N-terminal domain of L is dispensable for lytic activity but mediates DnaJ dependence. Truncation of this domain or certain suppressor mutations bypassed the chaperone requirement and restored rapid lysis.
Biochemical and genetic data support a model in which L is an integral membrane protein whose essential domains (including the LS motif and neighboring regions) form a helical structure that likely engages a host membrane target protein. The interaction may occur near sites of membrane curvature associated with peptidoglycan biosynthesis rather than by forming nonspecific membrane lesions.
The work, supported in part by the Center for Phage Technology and associated laboratories including research by Ry Young, suggests that MS2 L functions through a specific heterotypic protein–protein interaction mechanism and that chaperone-dependent regulation helps control lysis timing during infection.
The study refines the mechanistic model of MS2 lysis, proposing that conserved structural motifs rather than general membrane disruption drive lytic activity.
In vitro characterization of the phage lysis protein MS2-L
This study provides detailed in vitro and in vivo characterization of the MS2 lysis protein MS2-L, focusing on its membrane insertion mechanism, oligomerization behavior, and interaction with the host chaperone DnaJ.
Key findings show that MS2-L is a 75-amino-acid phage toxin whose essential lytic activity resides in the C-terminal ~35 amino acids, which form a hydrophobic transmembrane region. The N-terminal soluble domain is not required for bacterial killing but modulates folding, membrane insertion efficiency, and chaperone interaction.
Biochemical assays demonstrate that MS2-L interacts directly with DnaJ, primarily through the soluble N-terminal domain. However, this interaction does not significantly affect membrane insertion, solubilization, or oligomerization of the toxin, suggesting that DnaJ functions more as a folding or stabilization partner rather than being essential for lytic activity.
Native mass spectrometry revealed that MS2-L assembles into high-order oligomeric complexes (≥10 monomers) after insertion into lipid nanodiscs, and oligomerization is driven mainly by the transmembrane domain. In detergent environments, oligomer formation is reduced, indicating that membrane lipid context is important for stable assembly.
Fluorescence microscopy and cryo-electron microscopy showed that MS2-L expression in bacteria leads to peripheral membrane clustering, followed by sequential lesion formation beginning in the outer membrane, then disruption of the peptidoglycan layer, and finally inner membrane disintegration with cytoplasmic leakage.
The data support a model in which MS2-L functions as a pore-forming phage toxin that kills cells through higher-order oligomerization within the bacterial membrane, rather than by directly inhibiting peptidoglycan biosynthesis. Chaperone DnaJ binds MS2-L but is not required for membrane insertion or pore assembly, suggesting its role is mainly in modulating toxin folding or stability.
These findings strengthen the concept that MS2-L belongs to the amurin/single-gene lysis protein family and may be useful for bioengineering applications such as bacterial ghost cell production and antimicrobial design.
Phage therapy: From biological mechanisms to future directions
This review from Elsevier surveys the biological mechanisms, clinical development, and future directions of phage therapy as a strategy to combat antimicrobial resistance. It explains that therapeutic phages should ideally be strictly lytic, highly host-specific, and thoroughly characterized to ensure safety and efficacy.
The article describes how phages kill bacteria through mechanisms such as inhibition of essential cellular processes, expression of lysis proteins, or disruption of bacterial membranes. It also discusses advances in phage engineering, including synthetic genome construction and modification of phage host range and virulence.
Clinical applications of phage therapy are highlighted, particularly for treating drug-resistant infections where antibiotics are ineffective. However, challenges remain, including bacterial resistance to phages, regulatory hurdles, manufacturing standardization, and the need to understand phage–host interactions.
Future directions include the use of genetically modified or synthetic phages, computational prediction of therapeutic candidates, and integration of phage therapy with conventional antimicrobial strategies. Overall, phage therapy is presented as a promising but still developing alternative to antibiotics in the fight against antimicrobial resistance.
Generative design of novel bacteriophages with genome language models
This preprint reports the first experimental demonstration of generative design of complete bacteriophage genomes using genome language models (Evo 1 and Evo 2). The authors fine-tuned models on about 15,000 Microviridae phage genomes to enable autoregressive generation of full viral genomes guided by template-based prompts and biologically motivated design constraints.
The workflow involved computational generation followed by multi-tier filtering for sequence quality, host tropism specificity, and evolutionary diversity. Constraints included genome length (4–6 kb), GC content, absence of long homopolymers, preservation of phage-like gene architecture, and spike protein similarity to the template phage to maintain host targeting.
Experimental validation showed that about 285 of 302 synthesized genome candidates could be assembled, and 16 produced viable infectious phages that inhibited growth of the target host strain. These generated phages displayed substantial sequence novelty, containing hundreds of mutations relative to natural Microviridae genomes, while preserving functional genome organization.
Structural and functional analyses indicated that some generated phages possessed altered protein interfaces but maintained compatible capsid–protein interactions. Cryo-electron microscopy and structure prediction suggested context-dependent co-evolution of structural proteins such as capsid and packaging proteins.
Fitness assays showed that several AI-generated phages matched or exceeded the replication and lytic performance of the template phage, and phage cocktail experiments demonstrated rapid suppression of resistant bacterial strains through recombination and mutation-driven adaptation.
The study was conducted with biosafety considerations, including restricting model training to bacteriophage genomes and using well-characterized laboratory strains. The work was supported by researchers affiliated with institutions such as the Stanford University and the Arc Institute.
Overall, the paper proposes a framework for generative genome engineering, showing that AI models can design biologically viable and evolutionarily novel bacteriophages, potentially enabling future synthetic biology and phage-based therapeutic development.
By: @2026a-nourelden-rihan, @2026a-ritika-saha, @2026a-rahul-yaji
Our primary goal is to increase the structural stability of the MS2 bacteriophage lysis protein (L) while maintaining its ability to lyse bacterial cells.
Our secondary goal is to reduce the dependency of L on the host chaperone DnaJ, which normally assists the protein in folding or activation. Reducing this dependency could allow the lysis protein to function more efficiently and independently in engineered systems.
The MS2 L protein is a 75-amino-acid single-gene lysis toxin whose C-terminal region forms a hydrophobic transmembrane domain responsible for membrane disruption and pore formation, while the basic N-terminal domain interacts with host factors such as DnaJ. Previous studies show that truncation of the N-terminal region can bypass the DnaJ requirement while preserving lysis activity.
Therefore, our design strategy focuses on:
We will use a multi-step computational protein engineering pipeline combining sequence analysis, machine-learning mutagenesis predictions, and structural modeling.
First, we will use BLAST to identify homologous lysis proteins from related bacteriophages.
Purpose:
This will help determine which regions are functionally constrained vs mutable.
Using sequences obtained from BLAST, we will perform multiple sequence alignment with Clustal Omega.
Purpose:
Regions with high conservation will be protected from mutation, while variable regions may be targeted for stability improvements.
Next, we will use ESM (Evolutionary Scale Modeling) protein language models to perform systematic mutation scanning.
Purpose:
This step will guide rational mutation selection instead of random mutagenesis.
Promising mutations from ESM analysis will be modeled using ESMFold.
Purpose:
Mutations that significantly distort the fold will be discarded.
Finally, we will use AlphaFold Multimer to analyze:
Purpose:
Since MS2-L likely forms large oligomeric pores (>10 subunits) in the membrane, maintaining correct protein in1.Phage L protein sequence
Computational workflow we will follow.
Our pipeline aims to produce engineered variants of the MS2 L protein with:
These optimized proteins could be useful in applications such as:
Most protein language models and structural predictors are trained primarily on globular proteins, not small transmembrane phage toxins.
This may reduce prediction accuracy for MS2 L.
Mutations designed to increase stability may cause:
Thus stability must be balanced with function.
Single-gene lysis proteins (also called amurins) are poorly annotated in sequence databases.
This may limit the quality of homologous sequences used for alignment and training.
Mutations may unintentionally expose protease cleavage sites, making the engineered protein less stable inside bacterial cells.
If promising mutants are identified computationally, the next steps would include:
This would validate whether computational predictions translate into improved biological function.
Generating random mutations in the Lysis protein while avoiding the loss of function or non sense codons.The Python script was generated solely by the Google Gemini 2.5 Flash, that is in-built in Google Colab. The prompt was:
Develop a Python program in Google Colab that processes an amino acid sequence and generates mutated versions of it based on experimental data. The program should perform the following steps:
Prompt the user to enter an amino acid sequence.
Load mutation data from a publicly accessible Google Sheet URL (https://docs.google.com/spreadsheets/d/11WzDDNkQDEiqbUSGV0ZCqITGctyNFpD7xnPlhsj2BhE/edit?gid=0#gid=0).
The data contains information about amino acid changes and their associated ‘Lysis’ activity.
Filter the mutation data to include only ‘active’ mutations (where ‘Lysis’ is not 0). Extract the ‘Original_Residue’, ‘Position’, and ‘Mutated_Residue’ from the relevant columns (e.g., ‘Amino Acid Change’ and ‘Amino Acid Position’ or a ‘Mutation’ column like ‘X###Y’).
Create a helper function to format amino acid sequences by inserting a space after every 5 amino acids for better readability.
Implement a function generate_random_mutation_combinations(sequence, mutation_df, num_mutations) that takes an original amino acid sequence, the filtered active mutations DataFrame, and the desired number of mutations as input.
This function should:
Randomly select mutations from the available options for the chosen unique positions.
Return the new mutated sequence and print the applied mutations.
Generate Multiple Mutated Sequences: Prompt the user for the number of mutated sequences they wish to generate. For each requested sequence:
Call the generate_random_mutation_combinations function.
Display the generated sequence with a clear heading (e.g., ‘Sequence 1:’, ‘Sequence 2:’, etc.).
Print both the original and the mutated sequences, using the formatting function defined in step 5.
In a separate code block, display each generated mutated sequence individually using display() so that each sequence is easily copyable by the user.
The generated mutational sequences were:
0. METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT (Original)
AF2 Multimer was used to co-fold the mutant Lysis protein (METRFPQQSQQTPASTNRRRPFKHEDYPCQRQQRSSTLYVLIFLAFFLSKFTNQLLLSLLEAVIRTVTTLQQLLT) and DnaJ:
The plDDT score indicates that the model is not confident about the folding of the input random mutated L protein. Overall, it suggests that the random mutation approach is very time consuming to obtain leads, and very computation-intensive. Due to limited computational resources, cofolding was not performed for other sequences.

Later, cofolding was performed using Alphafold server, and the results obtained are shown below:
