https://pages.htgaa.org/2026a/raphael-aca/homework/week-05-hw-protein-design-part-ii/index.htmlPart A: SOD1 Binder Peptide Design (From Pranam) Part 1: Generate Binders with PepMLM This is the human SOD1 sequence containing the A4V mutation: MATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ Binder Pseudo Perplexity 0 WHYYATGARWGE 16.929015 1 WRYGAVALELKK 12.714672 2 WRSPAAAARWWK 9.155765 3 WRYPATAAALKX 4.843841 4 FLYRWLPSRRGG N/A Info The table generated by PepMLM detailing possible peptides to bind to mutant SOD1 along with their pseudo perplexity scores. Peptide 4 is an already known SOD1-binding peptide.Hugoen