Subsections of Rida Mughal — HTGAA Spring 2026
Homework
Weekly homework submissions:
Week 1 HW: Principles and Practices
First, describe a biological engineering application or tool you want to develop and why.
Week 2 HW: DNA Read Write and Edit
Benchling & In-silico Gel Art Ladder Life 1 kb Plus 1 Lambda - SacI XhoI 2 Lambda - PvuI SacI 3 Lambda - PvuI XhoI 4 Lambda - SacI XhoI DNA Design Challenge Choose your protein For this project, I’ve chosen a Curli protein, csgA, as a protein of interest. The protein sequence is below, taken from UNIPROT:
Subsections of Homework
Week 1 HW: Principles and Practices
First, describe a biological engineering application or tool you want to develop and why.
Acetic acid bacteria engineered to co-express enzymes that synthesize polyalanine which polymerize the cellulose scaffold to create conductive bacterial cellulose to be used in wearable sensors.
Recent breakthroughs in medical devices have driven substantial growth in engineered living material and biomaterials. Bacterial cellulose (BC) is a popular choice for developing wearable electronics due to its mechanical properties, flexibility, and biocompatibility. Researchers have been able to develop BC composite materials and sensors that can perform as resistors, capacitors, or piezoelectric sensors. For example, Jiang et al, have developed a BC composite hydrogel by mixing GO and PEDOT : PSS in the culture medium to apply to flexible supercapacitors after drying. Many other researchers have developed ways of introducing conductivity into BC films to be used as sensors or for other wearable devices. However, little research has been done combining synthetic biology with the goal of creating a conductive BC membrane for use in wearable devices. This research goal focuses on engineering acetic acid bacteria (AAB) to co-express enzymes that synthesize polyalanine, a segment of a protein which polymerizes the cellulose secreted from AAB to create a conductive cellulose film.
Governance Goals:
Ensure data privacy ethical data collection
• How is the data taken from the sensor handled?
• Is the data stored privately and protected from misuse
Promote health equity and equal access
• Easy access to sensors and software, promoting health equity
• Ensuring the device is easy to use for different ages/ groups, including easy to understand UX, simple mechanisms of use, and offering customer support
Foster Autonomy
• Users must retain control on how the data is collected and shared
• Users must give meaningful consent to healthcare practitioner
| Does the option: | TD:Proper use of data collection | TD:Follow global non malfeasance laws | TD:Easy accessibility and use of device | HP:Ensure meaningful consent | HP:Define escalation threshold | HP:Report issues | HR:Perform regular audits | HR:Tracking and reporting incidents |
|---|---|---|---|---|---|---|---|---|
| Enhance Biosecurity | ||||||||
| • By preventing incidents | 3 | 3 | 1 | 1 | 1 | 2 | 3 | 2 |
| • By helping respond | 2 | 1 | ||||||
| Promote health equity | ||||||||
| • By preventing incident | 2 | 3 | 3 | 3 | 2 | 1 | 2 | 1 |
| • By helping respond | 2 | 1 | 2 | 2 | ||||
| Foster Autonomy | ||||||||
| • By preventing incidents | 3 | 2 | 3 | 3 | 3 | 2 | 1 | 2 |
| • By helping respond |
KEY
TD: Tech Developers
HP: Health Practitioners
HR: Health Regulators
Based on the analysis, the governance actions that should be prioritized here are those pertaining to data protection and privacy. Medical devices and sensors handle highly sensitive and personal data on the human body which, if misused, can cause great harm to the end user. Strong privacy protections are a prerequisite of trust, for the device to be used properly, users must be able to trust their data is not being breached, mishandled, or misused. Prevention is the key here, if the data is misused or breached, it cannot be taken back so responses to data breaches can be ineffective.
Lecture questions:
1. Nature’s machinery for copying DNA is called polymerase. What is the error rate of polymerase? How does this compare to the length of the human genome. How does biology deal with that discrepancy?
The error rate of polymerase is 1:10^6, which, combined with the length of the human genome, would result in hundreds of thousands of errors. However, DNA polymerase has the ability to “proofread”. Meaning, it contains a 3’-5; exonuclease which is able to correct incorrectly paired nucleotides.
2. How many different ways are there to code (DNA nucleotide code) for an average human protein? In practice what are some of the reasons that all of these different codes don’t work to code for the protein of interest?
There are many different ways to code DNA, some reasons it doesn’t always work can be due to degredation or protein misfolding.
3. What’s the most commonly used method for oligo synthesis currently?
The most commonly used method for oglio synthesis involves coupling with phosphoramidite. This methos was developed in 1981 and is still used today.
5. Why is it difficult to make oligos longer than 200nt via direct synthesis?
There can be an accumulation of error when using direct synthesis.
7. Why can’t you make a 2000bp gene via direct oligo synthesis?
Typical methods for direcy oligo synthesis are limited to producing fragments of around 200 nucleotides, making developing high quality, longer DNA fragments difficult
8. [Using Google & Prof. Church’s slide #4] What are the 10 essential amino acids in all animals and how does this affect your view of the “Lysine Contingency”?
The 10 essential amino acids are:
• Aspartate
•Histidine
•Cysteine
•Methionine
•Asparagine
•Lysine
•Arginine
•Tyrosine
•Threonine
•Serine
Lysine is already an essential amino acid, so the idea that the dinosaurs in Jurrasic Park needed to have lysine injections in order to survive, is flawed. Lysine is not able to be produced by animals anyways so the dinosaurs not able to synthesize lysine makes them regular animals and is not a method to control them.
Week 2 HW: DNA Read Write and Edit
Benchling & In-silico Gel Art
Ladder
Life 1 kb Plus
1
Lambda - SacI XhoI
2
Lambda - PvuI SacI
3
Lambda - PvuI XhoI
4
Lambda - SacI XhoI

DNA Design Challenge
Choose your protein
For this project, I’ve chosen a Curli protein, csgA, as a protein of interest. The protein sequence is below, taken from UNIPROT:
>sp|P28307|CSGA_ECOLI Major curlin subunit OS=Escherichia coli (strain K12) OX=83333 GN=csgA PE=1 SV=3 MKLLKVAAIAAIVFSGSALAGVVPQYGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQ TDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGG GNGAAVDQTASNSSVNVTQVGFGNNATAHQY
3.2. Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.
atgaaactgctgaaagtggcggcgattgcggcgattgtgtttagcggcagcgcgctggcg ggcgtggtgccgcagtatggcggcggcggcaaccatggcggcggcggcaacaacagcggc ccgaacagcgaactgaacatttatcagtatggcggcggcaacagcgcgctggcgctgcag accgatgcgcgcaacagcgatctgaccattacccagcatggcggcggcaacggcgcggat gtgggccagggcagcgatgatagcagcattgatctgacccagcgcggctttggcaacagc gcgaccctggatcagtggaacggcaaaaacagcgaaatgaccgtgaaacagtttggcggc ggcaacggcgcggcggtggatcagaccgcgagcaacagcagcgtgaacgtgacccaggtg ggctttggcaacaacgcgaccgcgcatcagtattaa
3.3. Codon optimization.
GCAACTGGTGCGGCAGCCTGTACCGGCTGTACCGGTGCAGCCGCGGGTACTGGTGGCTGCGGCGGCTGTGGCGCAACCACCGGTTGCGGCGGCTGCGGCGCCACTACCGGCACCGGTACAACCACCGCCGGTTGCGGTGGGTGCGCCGGTTGCGGTTGTGGCTGTACCGGCGGCTGCGGCGGCGGCTGCGGCACCGGCGGTACCGGCTGTTGCGGTTGCGCGGGCACCGCCACCGGTGGCTGCGGCGGATGCGGCGGCTGCGGCGGCTGCGCGGCGTGCTGTGCGACCGGCGGCTGCGGTGGCTGTGGCGGCTGTGGTGGTTGTGCGGCATGCGCCGCGTGCGCGGGCTGTGGCGGTTGTTGCTGCGGCGCCGCGTGTGCGGGTTGTGGAGCGGCCTGCACCGGTGCGGCGTGTGCCACCACCACCGCCACCTGCGCGGGTACCGCGACCGGCGGCTGTGGCGGCTGCGGTGGTTGTGCCGCGTGCGCGGGTTGCGGCTGTGGTTGTACCGGAGGCTGCGGCTGCACGGGCTGCGCCGGCGCCTGCTGCGGCGCGACTGGCTGTGGTTGCGGCTGTGCGGCGTGCGCCGGCTGCGGCGCCACCTGCACCGGCGCGTGTTGTGCCACCACCGCGTGCTGCTGCGCGGGCTGCGCGACCGGCGGCTGCGGCGGGTGTGGCGGCTGTGCGGCGTGTGGTGGCTGTGGCTGTGGTGGTGCGACCGGTACCGGTGGCGGTTGCTGCGCCGGCGGCGGCTGCGCCGGCTGCGGCGCGACCGGCGCGACCGCGGGCTGTGCGGGTTGCGCGACCACGGGTGCGACCTGCACCGGTGCGTGCTGTTGCGCCGGCTGCGGTTGCGGCGGCTGTACCACCACCGGAGGCTGTGCGGCCTGTGCCGGCTGCGGCTGCGGCGCATGCTGCTGCACCGGCGGGGCCACCTGTGCCGGAACCGGTGGCGCGGCGTGTGGCGGTTGTGCCGCGGCGGCAGCCTGCGCGGGCTGTGGCGCGGCGGCCACCGGCGCGTGCTGCGGCACCGGCGCCGCGGCCTGTGCGGGTACGACCACCGGCGGTTGCGGCGGCTGCGGCGGCTGTGCCGCGTGCGGCGGCTGCGGCTGCGGTGGCTGCGGCGGCACCGGCGGCGCCACCTGCGCGGGCGCGTGTTGTGGCTGCGGCGCGGGCTGTGCGGCGTGCGCCGGCTGCGCGGGCTGCGGCACCGGCGCCGCGTGTGGCACCGGCGCGTGCTGTTGCGCGGGTGGCACCGGCGGCGGCTGCACTACCACGGGCGGCTGCGCGGCCTGTGCAGCATGTGGCTGTGGTGCGTGTTGTGGCTGCGGCTGCGCGACGTGTGCGGGCACCGCGACCACAGCGGCCTAA Avoid cleavage sites of restriction enzymes: BamHI EcoRII HindIII NdeI XhoI
DNA Read
(i) What DNA would you want to sequence (e.g., read) and why? This could be DNA related to human health (e.g. genes related to disease research), environmental monitoring (e.g., sewage waste water, biodiversity analysis), and beyond (e.g. DNA data storage, biobank).
My research focuses on cellulose based material and biomaterials, so I would want to read DNA related to cellulose biosynthesis to understand what could affect a higher expression of cellulose in certain strains of acetic acid bacteria. My sequence which I isolated above is the cgsA sequence, so based on this, I would like to sequence he engineered curli genes and other variants to ensure they are being correctly encoded. I would also like to read more about promoter and regulatory sequenes controlling these genes.
(ii) In lecture, a variety of sequencing technologies were mentioned. What technology or technologies would you use to perform sequencing on your DNA and why?
Sanger sequencing is one good option based on what I’ve seen. This is due mainly to the well established protocols and high quality sequence data. I am trying to sequence cgsA, which is about 450 bp. It is small enough for Sanger sequencing and I wont need a high throughput or long- read method for a sequence of this size.
Also answer the following questions:
Is your method first-, second- or third-generation or other? How so?
This method was one of the first developed for reading nucleotide reagions.
What is your input? How do you prepare your input (e.g. fragmentation, adapter ligation, PCR)? List the essential steps.
The input is the cgsA plasmid. In order to prepare it, it should be purified to remove contaminants. Since it is a small sequence that is covered by sanger sequencing, I do not need to fragment it and I can use PCR is the concentration is low.
What are the essential steps of your chosen sequencing technology, how does it decode the bases of your DNA sample (base calling)?
With gel electrophoresis, I can read the sequence.
What is the output of your chosen sequencing technology?
A digital sequence of the DNA fragment
DNA Write
(i) What DNA would you want to synthesize (e.g., write) and why? These could be individual genes, clusters of genes or genetic circuits, whole genomes, and beyond. As described in class thus far, applications could range from therapeutics and drug discovery (e.g., mRNA vaccines and therapies) to novel biomaterials (e.g. structural proteins), to sensors (e.g., genetic circuits for sensing and responding to inflammation, environmental stimuli, etc.), to art (DNA origamis). If possible, include the specific genetic sequence(s) of what you would like to synthesize! You will have the opportunity to actually have Twist synthesize these DNA constructs! :)
I would be interested in synthesizing DNA for enzymes or proteins that would allow for either localization of oxxidative polymerization on cellulose or cellulose binding. I want to be able to express a conductive or redox active protein that can bind or react with a cellulose scaffold in order to create a conductive cellulose composite material. This would allow for polyalanine, a well studied conductive polymer that is used to create conductive cellulose scaffolds, to be able to better or more quickly bind to the cellulose pellicle. My current research focuses on bacterial cellulose and the use of cellulose as a biosensor or potential to be used in wearable device design. I see synthetic biology as a tool in order to be able to create this composite material.
DNA Edit
(i) What DNA would you want to edit and why? In class, George shared a variety of ways to edit the genes and genomes of humans and other organisms. Such DNA editing technologies have profound implications for human health, development, and even human longevity and human augmentation. DNA editing is also already commonly leveraged for flora and fauna, for example in nature conservation efforts, (animal/plant restoration, de-extinction), or in agriculture (e.g. plant breeding, nitrogen fixation). What kinds of edits might you want to make to DNA (e.g., human genomes and beyond) and why?
COntinuing on this same path of researhc, I would want to edit curli genes, cgsA, or cellulose biosynthesis genes. By editing these, I wcould potentially introduce amino acid changes or improve fiber denisty/ mechanical strength of the cellulose that is produced by acetic acid bacteria.
(ii) What technology or technologies would you use to perform these DNA edits and why? Also answer the following questions:
How does your technology of choice edit DNA? What are the essential steps? What preparation do you need to do (e.g. design steps) and what is the input (e.g. DNA template, enzymes, plasmids, primers, guides, cells) for the editing? What are the limitations of your editing methods (if any) in terms of efficiency or precision?
I would be interested in using CRISPR due to its precision and variety. This method would work by designing guide RNAs that direct the nuclease to a specific DNA sequence, which is then repaired using a donor template containing the desired edit. Preparation involves designing gRNAs, donor DNA templates, and expression plasmids, and transforming them into bacterial cells. Limitations include variable editing efficiency, potential off-target effects, and the need to optimize expression for this host organism.