Week 5 HW: Protein Design Part II :: 2026a-samriddh-sadhukhanhttps://pages.htgaa.org/2026a/samriddh-sadhukhan/homework/week-05-hw-protein-design-part-ii/index.htmlPart A Part 1 I added the protein sequence from UniProt after mutating it, and changed the parameters, as needed. The Sequence: MATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ I ended up with these 4 results. I added the given peptide sequence and calculated the Pseudo Perplexity for the same. Part 2Hugoen