Homework
Weekly homework submissions:
Week 1 HW: Principles and Practices
- Bioengineering Application / Product to Be Developed Bioengineering Product A bioplastic derived from organic waste that is composed of 100% biopolymers, food-grade, and naturally biodegradable. This product is designed as an alternative to fossil-based polymer plastics that are widely used today, particularly for single-use packaging applications. Key Product Specifications • Main raw materials Sourced from underutilized organic waste, such as: o cassava peels
Week 2 HW: DNA Read, Write & Edit
Part 1: Benchling & In-silico Gel Art PART 3: DNA Design Challenge 3.1 Choose your protein Erythropoietin is a hormone that stimulates red blood cell production. Selected because: Vital in anemia therapy High-value biotechnology protein Relevant to the pharmaceutical industry Erythroproietin : sp|P01588|EPO_HUMAN Erythropoietin OS=Homo sapiens OX=9606 GN=EPO PE=1 SV=1 MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL KLYTGEACRTGDR
Published Paper on Opentrons Automation The paper entitled AssemblyTron: flexible automation of DNA assembly with Opentrons OT-2 lab robots, published in the journal Synthetic Biology (2023), reports the development of AssemblyTron, a software platform that automates DNA assembly workflows using the Opentrons OT-2 liquid-handling robot. The system integrates DNA construct design (for example, from design software such as j5) with automated execution on the OT-2 to perform molecular biology procedures in a precise and standardized manner. AssemblyTron is designed to support the Design–Build–Test–Learn (DBTL) cycle in synthetic biology by automating PCR optimization, Golden Gate assembly, and in vivo assembly (IVA).