SHRIMAY SAIKIA — HTGAA Spring 2026

About me

Biotech optimist with a background in astronomy, physics and neuroscience looking to build ethical biomachines for applications in energy, health and development.

Contact info

LinkedIn

Homework

Labs

Projects

Subsections of SHRIMAY SAIKIA — HTGAA Spring 2026

Homework

Weekly homework submissions:

  • Week 1 HW: Principles and Practices

    Class Assignment Application: SoilBuddy With climate change set to disrupt global agriculture and the unsustainability of commercial monocultures threatening to render the arable land left unusable, humanity urgently needs solutions facilitating soil stewardship to fortify our food supply. Existing solutions are either too expensive for small-to-mid farms, worsening inequality in the developing world, impractical for massive commercial farms, necessitating guesswork set to be upended by the sea change wrought by climate change, or provide, at best, noisy, time-lagged feedback through remote sensing.

  • Week 2 HW: DNA Read, Write and Edit

    Part 0 Done. Part 1 Since it’s passe to create “MIT” with the electrophoresis gel, I decided to reverse the order of the letters to spell “TIM” instead. Part 2 I don’t have in-person access to a node, so can’t perform the wet lab component.

  • Week 3 HW: Lab Automation

    Part 1 Find and describe a published paper that utilizes the Opentrons or an automation tool to achieve novel biological applications. The paper I’ll be analyzing is titled “Development of a high-throughput minimum inhibitory concentration (HT-MIC) testing workflow” published in Frontiers in Microbiology. In summary, the researchers used an Opentrons OT-2 robot to automate an assay used to test the safety-efficacy profile of an antibiotic. They accomplished this by programmatically preparing a serial dilution of the antibiotic candidate across multiple 96-well plates with replicates, innoculating the wells with the test bacteria, then measuring the optical density of each well with a plate reader to determine bacterial viability after the antibiotic challenge.

  • Week 4 HW: Protein Design Part I

    Part A Number of amino acids = 500g/(100 Da) = 5 mol = 3.0 x 10^24 molecules of amino acids (approx). Over the course of digestion, the polynucleotides are broken down into constituent nucleobases prior to absorption. Considering the degeneracy of codons, these 20 amino acids were sufficient to produce a diversity of proteins, and were evolutionarily conserved due to a lack of strong selection pressure against them (ie. they were “good enough”). . They could’ve formed abiotically given the presence of organic precursors such as carboxylic acids, amines and small molecule side groups, catalyzed by zeolites, and triggered by lightning and heat on the primordial earth or extraterrestrial asteroids respectively. Left-handed spirals. Yes, some examples are $\pi$ helices and $3_{10}$ helices. It’s more energetically stable given L-amino acids and D-saccharides predominate natural protein helices and the sugar-phosphate backbone of polynucleotides respectively. In aqueous environments, the hydrophobic portions of beta sheets are driven together by steric interactions while the hydrophilic groups facilitate relatively strong intermolecular hydrogen bonding. Beta sheets allow for strong intermolecular bonding, in hydrophobic zippers, that renders misfolded proteins more stable than their functional conformations and facilitates the addition of more proteins to the aggregate fibril - the biochemical basis of amyloid pathogenesis. Yes, you could make materials out of amyloid beta sheets but they’d only be stable under aqueous conditions and would be potential biotoxins. . Part B I chose to investigate an antifreeze protein from an arctic bacterium as a potential solution for winter snow-clearing.

  • Week 5: HW Protein Design Part II

    Part A Part 1: Generate Binders with PepMLM Binder Sequence Perplexity Score WRYYATVARHKE 15.38014901 WLYYVVVLRHGE 32.45105037 WRYYAAGARLKE 11.75101427 WRYYATAVELKG 10.44080960 Part 2: Evaluate Binders with AlphaFold3 Peptide ID Binder Sequence ipTM Score Location Peptide 0 WRYYATVARHKE 0.35 Approaches the $\beta$ barrel; surface-bound Peptide 1 WLYYVVVLRHGE 0.33 Approaches the $\beta$ barrel; surface-bound Peptide 2 WRYYAAGARLKE 0.35 Approaches the $\beta$ barrel; surface-bound Peptide 3 WRYYATAVELKG 0.22 Conforms to the dimer interface; binds to a pocket Control FLYRWLPSRRGG 0.31 Surrounding the $\beta$ barrel; surface-bound While peptides 0-2 exceed the control (known binder)’s ipTM scores, indicating stronger protein-protein interaction, they still represent low confidence values. I would not conclude that they produce stronger protein-protein interactions for use as potential molecular glues.

  • Week 6 HW: Genetic Circuits Part I

    Assignment: DNA Assembly What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose? The NEB 2X master mix includes engineered thermostable DNApol to synthesize complimentary strands during the extension phase of PCR, with low error rate and high expressivity to enable faster, more accurate DNA replication. It includes a buffer to maintain optimum pH for enzymatic catalysis and prevent the denaturation of enzyme or nucleic acids, as well as ${Mg}{Cl}_{2}$ to provide $Mg^{2+}$ as a cofactor for DNApol.

  • Week 7 HW: Genetic Circuits Part II

    Intracellular Artificial Neural Networks (IANNs) 1. What advantages do IANNs have over traditional genetic circuits, whose input/output behaviors are Boolean functions? IANNs more easily provides for graded responses and can scale intelligent responses; they can approximate every mathematical function and not just step functions.

  • Week 9 HW: Cell-Free Systems

    Homework Part A Assignment 1. Explain the main advantages of cell-free protein synthesis over traditional in vivo methods, specifically in terms of flexibility and control over experimental variables. Name at least two cases where cell free expression is more beneficial than cell production. It lacks the stress response, proteostasis and detoxification of an in vivo environment, allowing for much higher expression of protein including toxic varieties or those incorporating xenobiotic compounds, as in bio-orthogonal experiments. Reaction conditions are standard and can be externally controlled/varied (eg temperature) more precisely than in in vivo systems. The progress of reaction is more easily followed using imaging techniques, allowing for rapid optimization and sequential syntheses. Two cases where cell-free expression is better than cell production are the expression of protein toxic to bacterial/fungal chassis (eg antibacterial/antifungal compounds) as well as proteins intended for use in human medicine (free of endotoxins).

  • Week 10 HW: Imaging and Measurement

    Waters Lab Part I 28006.60Da z=32 based on consecutive m/z’s (875.4421, 848.9162); MW = 27982Da; Accuracy = 99.9% No, its amplitude above background could mean it’s not reliably distinguished from background noise. Waters Lab Part II When a protein unfolds, several more ionizable sites on the polypeptide are exposed. As such, the denatured protein will exhibit several more m/z peaKs, and typically at higher m/z values than the native protein conformation.

  • Week 11 HW: Building Genomes

    Part A I enjoyed the sense of oneness and how it spoke to the power of science to transcend divisions of identity and geography Part B: Cell-Free Protein Synthesis | Cell-Free Reagents E. coli Lysate: Provides biological medium and machinery (eg ribosomes) Salts/Buffer: Optimal pH, ionic atmosphere and osmolarity Energy / Nucleotide System: Power transcription/translation Translation Mix (Amino Acids): Allow for translation to produce mRNA from DNA Additives: Nicotinamide in particular allows for the regeneration of NAD Backfill: Maintain appropriate volume for manipulation of the biological systems

  • Week 12 HW: Bioproduction

  • Week 13 HW: Biodesign of Living Materials

  • Week 14 HW: Biofabrication

Subsections of Homework

Week 1 HW: Principles and Practices

cover image cover image

Class Assignment

Application: SoilBuddy

With climate change set to disrupt global agriculture and the unsustainability of commercial monocultures threatening to render the arable land left unusable, humanity urgently needs solutions facilitating soil stewardship to fortify our food supply. Existing solutions are either too expensive for small-to-mid farms, worsening inequality in the developing world, impractical for massive commercial farms, necessitating guesswork set to be upended by the sea change wrought by climate change, or provide, at best, noisy, time-lagged feedback through remote sensing.

I propose SoilBuddy as a low-cost, real-time, large-area biomachine platform to supercharge the soil microbiome using nature’s own solutions. The crux of SoilBuddy is intelligent biosensing that incorporates human-readable signals, provides an attack surface for genetic circuit-based intervention, and can integrate with existing, non-biological soil monitoring/fertilization workflows. At the same time, SoilBuddy features means to intervene in the soil microbiome by orchestrating microorganisms, and modulating nitrogenation, oxygenation and ion levels in the soil.

Getting to brass tacks, I outline its sensor/effector features below, with core functions necessary for a MVP in bold:

Sensing

  • pH –> Pigment
  • Nitrogenation –> Multiplexed pigment / biofluorescence
  • Oxygenation –> infrared pigment
  • Pathogen –> checkerboard pigment

Effector

  • pH (proton pumps)
  • pH buffering (zwitterion secretion)
  • Nitrogenation (modulating different metabolic circuits)
  • Oxygenation (modulating different metabolic circuits)
  • Pathogen defense (phage libraries, defense proteins, orchestrate natural predators)
  • Microbiome orchestration (quorum sensing mlcs, chemokines)

Governance Goals

While I was inspired by the four tenets of biomedical ethics, I reckoned the most important goals relevant to SoilBuddy are Non-Maleficence and Justice. Given the echoes of the GMO debate from earlier in the century, and the proliferative capacity of bacterial systems, prioritizing safeguards against ecological contamination are crucial for governing our bacteria-based platform. At the same time, given the long history of agricultural intervention being wielded as a political tool to harm access to food and development, it’s crucial that we prioritize justice in the administration of SoilBuddy to ensure its applications prove to be a tool for good.

Goal 1: Non-Maleficence

In the context of SoilBuddy, a commitment to non-maleficence - articulated in the credos “first, do no harm” - involves a rejection of utilitarian logic to instead foreground safeguards against proliferation and mitigation of unintended consequences before the launch of SoilBuddy.

1.1: Counter-Proliferation

SoilBuddy must be governed to prevent runaway proliferation in wild ecosystems and spillover events should be minimized as far as possible.

1.2: Mitigation

Before applying SoilBuddy, practitioners in the SoilBuddy ecosystem must enact measures that mitigate the harm caused by both foreseen unintended consequences (ie. known risks of biotech in agriculture per se, such as gene contamination) as well as unforeseen unintended consequences (ie. put in place inherent safeguards or plans of action to manage unknown unknowns).

Goal 2: Justice

In the context of SoilBuddy, our construction of justice pertains to its distribution and development into perpetuity – I mean to open-source soil health.

2.1: Material Equity

Governance should focus on ensuring geographic and socioeconomic equity in access to the materiel of SoilBuddy, administering its distribution on the basis that food ought to be a human right, in line with the UN’s SDGs.

2.2: IP Equity

Governance should guard against the privatization of developments on SoilBuddy as a platform, recognizing that, again, access to food as a human right contributes to the common good of the species. Insomuch as SoilBuddy will start off open-source, its derivative art should also be accessible to all.

Governance Actions

Option One: Building-in Self-Limitation as a Technical Strategy (“Self-Limitation”)

Similar to how nuclear power plants exported under technical assistance programs are designed to make weaponization impossible, one governance action for industrial, academic and governmental practitioners in the SoilBuddy ecosystem to undertake would be stressing self-limitation when designing SoilBuddy: incorporating failsafes (eg robust, immutable genetic kill-switches) within SoilBuddy to mitigate the risks of unknown unknowns when it comes to mitigating accidental proliferation; and only including biosensor and effector modalities amenable which negate or greatly minimize the risk of deliberate proliferation.

Academic practitioners will need to self-police their research into SoilBuddy to avoid the development of high-risk features, as will industrial stakeholders, despite the potential upside of risky features in contravention of safety-first design principles. National governments must agree to avoid research into safeguard-free SoilBuddy platforms despite the agricultural productivity they may enjoy, not to speak of avoidig the weaponization of SoilBuddy to wage agricultural war. International governments will have to dedicate scarce resources, and scarcer funding to coercive as well as persuasive measures to promote this technical strategy, promoting global buy-in despite political differences as well as counterproliferative interdiction.

A great uncertainty remains as to whether such kill-switches remain biologically feasible, and robust to accidental/natural degradation (eg mutations, horizontal gene transfer). Pessimistically speaking, this strategy also assumes an alignment of academic-industrial complexes away from private interests, not to speak of strategic apparatuses of power. Given how anything short of absolute, collective alignment will rapidly corrode the incentive of collective security that motivates cooperation on this technical strategy, it is also unclear exactly how stable such an arrangement will be without active enforcement against rogue states and non-state actors.

Beyond the failure modes analyzed while elucidating the policy’s assumptions, it is also possible this technical strategy of self-limitation could dampen the research momentum required to make headway on a key technology of humanity’s food future; that, shirking risk altogether might prevent a substantially greater benefit that outweighs even the existential risk of SoilBuddy’s proliferation and inequitable distribution (ie. concentration within centers of comparative advantage) which could actualy be a more efficacious state of affairs.

Option Two: Mandating Equitable Access as an Explicit Policy Measure (“Legislating Equity”)

Switching gears from food, let’s consider the state of California’s Assembly Bill 685 as a piece of legislation enshrining access to water as a human right; in a similar fashion, option two would involve (inter)national legislation (and requisite enforcement) guaranteeing equitable access to the material and IP of SoilBuddy as the key to a more secure food supply across geopolitical borders and strata of development. This stands in stark contrast to the oligopolistic pricing of economic factor inputs and complementary agritech/biotech goods used in the production of food crop in certain major agricultural markets, as well as the fervent privatization of IP governing crop cultivation methods – much like the denial by John Deere of farmers’ right to repair their equipment, but in contraposition to Norman Borlaug’s methods of knowledge-sharing that underpinned the green revolution.

Given the bottlenecks manufacturing inequity – such as mass production, marketing and distribution – lie in industry, academia does not figure in Option Two as much insofar as we discount the role of university corporations that might own key patents and licenses withholding access to SoilBuddy platforms and developments thereof. Taking them to constitute industrial actors for the sake of argument, we thus find that the key stakeholders in Option Two are the industry players charged with balancing the profit motive and corporate responsibility, national regulators that must maintain the free market incentive to innovate with an interest in delivering on their duty to citizens, and international government faced with material limitations in enforcing violations of legislated equity despite national interests in shaping the competitiveness of their own agricultural productivity, or those of others.

Specifically, taking this legislation to be an international treaty guaranteeing mechanisms of cross-subsidization pegged to national income levels viz debt and requiring the registration of SoilBuddy IP with a INGO, we find that Option Two also requires the assumption of total cooperation to negate private incentives to cheat (in an economic sense). Beyond overlapping similarities with Option One’s modes of failure at the industrial and national levels, Option Two relies even more on state and international capacity for the enforcement of this law since there isn’t a structural incentive to ensure equity, as much as there is one to maintain technical non-proliferation due to salutary effects on SoilBuddy metabolic budgets, the avoidance of legal liability or sidestepping openings that might facilitate corporate espionage.

Apart from the failure of legislated equity to take off given the precedent of global pharmaceutical distribution, there is a distinct risk that this legislation may be weaponized for hybrid contestation on the international level. On the other hand, should there be comprehensive good-faith buy-in, the runaway success of mandated equity might paradoxically entrench corollary inequities in the distribution of R&D capacity across the Global South by eliminating the incentive to develop indigenous agritech capabilities, or entrench inter-nation trade dependencies, that if not adequately de-risked, could be disrupted by trade disruptions - innocuous as they might be, such as the maritime trade disruption caused by the Ever Given’s freak beaching in the Suez Canal.

Option Three: Engineering Markets to Incentivize Equity (“Incentivized Equity”)

Apart from altruism and compulsion, a third drive worth exploring is that of economic incentives that might appeal to naturally self-interested, rational economic agents. Similar to the ethos underpinning the FDA orphan drugs scheme, I propose the disbursement of strings-attached market incentives such as tax holidays, targeted research funding, export preferences, indirect subsidies and fast-track approval to govern the nonproliferative development and equitable distribution of SoilBuddy.

Here, a finer dissection of industry is necessary. We lump industry’s R&D side of house with academia in the form of the academic-industrial complex, which will naturally be incentivized by the targeted fiscal outlays promoting responsible SoilBuddy platform development to incorporate biosafety features in the IP that will head into commercialization; this can be verified by funding bodies during progress reviews and the tiered disbursement of funding tranches subject to the satisfactory fulfilment of performance metrics germane to non-maleficent and just SoilBuddy platforms. Next, industrial players overseeing commercialization, production and marketing will be incentivized by corporate incentives such as tax holidays and indirect subsidies to stay faithful to safety-first IP, as well as allow regulatory oversight of their products to ensure they meet the counterproliferative and equitable design features articulated above. On the international level, member fee waivers at INGOs as well as the enactment of diplomatic commons would promote good faith adherance to biosafety in the use and distribution of SoilBuddy, just as the UN has slowly but steadily driven development across the board, and the WTO common prosperity through responsible trade.

Option Three rests heavily on governmental capacity for the microeconomic to international administration of the scheme, from the efficient disbursement of funds, to the capacity for responsible statesmanship promoting the common good. Aside from the obvious failure mode should government failure (ie. rent-seeking) distort incentives for the responsible development and distribution of SoilBuddy, there is the crucial issue of national strategic interest in the performance of the biotech firms developing SoilBuddy in the high-income biotech exporters likely to muster the industrial and governmental heft to implement Option Three in the first place; importing nations might indeed suffer dumping should the subsidies provided for the responsible development and disbursement of SoilBuddy be anti-competitive. Thus, strong international governance of SoilBuddy’s trade is pivotal in maintaining the sustainability of SoilBuddy’s application worldwide.

Evaluation of Governance Actions

We evaluate the governance actions on their efficacy in meeting the governance outcomes articulated above, as well as policy desirability, feasibility and sustainability.

Governance Outcome / Policy FeatureOption One “Self-Limitation”Option Two “Legislated Equity”Option Three “Incentivized Equity”
Non-Maleficence (Counterproliferation)122
Non-Maleficence (Mitigation)123
Justice (Material Equity)323
Justice (IP)323
Desirability (Scale of drawbacks)112
Feasibility (Policy implementation)322
Sustainability (Policy sustainment)213

Selection of Governance Action(s)

I would select Option One (“Self-Limitation”) and Option Two (“Legislated Equity”) as complementary policies that offer both a high-uncertainty, high-reward as well as moderately-achievable option comprehensively guaranteeing biosecurity on both counts, of non-maleficence and justice.

Option One (“Self-Limitation”) alone would seem the most promising governance action barring its inability to directly achieve justice. It is also highly contingent on the biological underpinnings of SoilBuddy, which is an unfortunately uncertain, if rewarding bet. Given the shortfall of a single policy, we pursue either Options Two (“Legislated Equity”) or THree (“Incentivized Equity”) as a synergistic policy that, in a swiss cheese fashion, provides better coverage of biosecurity objectives.

The key differentiator between Option Two (“Legislated Equity”) and Option Three (“Incentivized Equity”) lay in the unsustainability of fiscal outlays at both the national and international levels as required for the latter, as well as the greater alignment of coercive incentive in the former to adhere to non-maleficence. As a whole, Option Two is attainable, though contingent on the tedious, if achievable negotiation of international interests to settle on a suitable piece of biosecurity legislation.

Crucially, both policies hinge on the fair assumption that there is sufficient technical as well as state capacity to see SoilBuddy through in the first place in a responsible manner. At the same time, we qualify that, pending further research, the technical research underpinning first-of-its-kind killswitches and safety measures required for Option One is more uncertain than international cooperation on the governance of a risky technology, which has precedent in the historical governance of nuclear energy, as well as more contemporary discussions of human germline editing and mirror life.

Ethical Concerns and Appropriate Governance Actions

This week’s class and this exercise as a whole have brought to mind two worries, one deontological and the other of a more utilitarian turn. Firstly, I questioned if the governance of biosecurity might err on the side of caution and unduly impinge on the freedom of sovereign individuals to pursue their SoilBuddy-related curiosities, or nations to self-actualize their agricultural potetial. Applying a Lockean construction of the tradeoff between governance and freedom, however, one realizes that the necessary surrender of a few freedoms pertaining to the riskiest of technologies, especially ones that might have existential implications for the species and planet as a whole, really is a freedom from, to channel Isaiah Berlin, a greater evil; the freedom to feed our individual or collective curiosities is contingent on the responsible stewardship of the commons which make it possible.

Secondly, from the standpoint of effective altruism, I wondered if governance might be enacting longtermist harm by impeding the pace of technological research necessary to mitigate the existential threat the species faces to its food supply. Again, on the balance of probabilities this more consequentialist reasoning enables, we conclude that the risk of massive ecological contamination in the image of an Atwood dystopia requires that we factor in guardrails against irreversible harm borne of an irresponsibly Pandoran scientific accelerationism.

On a metacognitive level, inasmuch as one might worry about the balance of caution and speed required to safely realize the promise of SoilBuddy for food security across the species, it is this very debate that constantly refines humanity’s construction of this negotiation between risk and reward.

Week 2 Lecture Prep

Professor Jacobson

  1. Polymerase has an error rate of 1:10^6. Given the length of the human genome, ~3.2 Gbp, the number of expected errors (3200) is substantial; the error rate of polymerase is significant for the length of the human genome. The error rate of polymerase is mitigated by proofreading during DNA replication, as well as MutS-mediated mismatch repair after replication.

  2. Taking the average human protein to contain ~400 amino acids in its primary structure, this means ~400 mRNA codons would be necessary to code for it. Given the degeneracy of the genetic code, working backwards and assuming a roughly equal proportion of different amino acids for the sake of argument, the codon table implies 4^(820) * 3^(120) * 2^(1220) = 1.3210^178 different sets of DNA triplet codes to encode the typical human protein. In practice, certain DNA triplet code sequences encode mRNAs that are more structurally stable, degradation-resistent, and amenable to translational regulatory elements necessary for mRNA translation and protein folding.

Dr. LeProust

  1. Solid-phase phosphoramidite synthesis.
  2. Due to accumulated errors, the yield for fully-synthesized sequences is impractically low, especially since they have to be purified and isolated. For long sequences, steric hindrance near the substrate as well as chemical degradation further reduce yield.
  3. For similar reasons as above, direct synthesis’ stepwise inefficiency would cause the yield to be impractically low.

George Church

  1. They are: Phenylalanine, Threonine, Tryptophan, Leucine, Lysine, Methionine, Arginine, Histidine, Isoleucine and Valine [1]. To use the Jurassic Park example at surface value, I think picking lysine was a poor choice for omnivorous/carnivorous dinosaurs since they were able to obtain the essential amino acid from their diet, or the environment. At the same time, it offers a broader lesson on building safeguards into our biotechnology; even if we replaced lysine with a xenobiotic amino acid, for example, simply relying on one failsafe doesn’t provide a reasonable amount of biosecurity.

[1] Lopez MJ, Mohiuddin SS. Biochemistry, Essential Amino Acids. [Updated 2024 Apr 30]. In: StatPearls [Internet]. Treasure Island (FL): StatPearls Publishing; 2025 Jan-. Available from: https://www.ncbi.nlm.nih.gov/books/NBK557845/

Week 2 HW: DNA Read, Write and Edit

Part 0

Done.

Part 1

Since it’s passe to create “MIT” with the electrophoresis gel, I decided to reverse the order of the letters to spell “TIM” instead.

Digest artwork Digest artwork

Part 2

I don’t have in-person access to a node, so can’t perform the wet lab component.

Part 3

Part 3.1

I chose to investigate an inorganic pyrophosphatase-driven proton pump because it’s the most relevant to the SoilBuddy MVP. Here are other candidates I considered and why I rejected them:

  • Bacteriorhodopsin: +Prokaryote-native -Light-driven rxn is impractical for a soil-dwelling bacterium
  • Membrane H+-ATPase: +Native cellular localization at membrane is favorable -High risk of cross-talk with native membrane proton pumps and may preclude bacterial survival
  • Methanogenic proton pump: - Presupposing an electron acceptor for the correct functioning of the proton pump limits our choices of target organism and may hinder the systems integration of other effector means for SoilBuddy

The sequence is as follows, obtained from UniProt

>AAK86977.2 H+ translocating pyrophosphate synthase [Agrobacterium fabrum str. C58]
MTVIPIVILCGVLSVVYAVWTTKSVLDADQGNERMREIAGYIREGAQAYLTRQYLTIAIVGLIVAVLAWY
LLSAIAAIGFVIGAVLSGVAGFVGMHVSVRANLRTAQAASHSLGAGLDIAFKSGAITGMLVAGLALLGVS
IYYFVLTSVLGHPPGSRAVIDALVSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNP
ATIADNVGDNVGDCAGMAADLFETYAVSVVATMVLAAIFFAGTPILESAMVYPLAICGACILTSIAGTFF
VKLGTNNSIMGALYKGLIATGVFSVAGLAVATYATVGWGTIGTVAGMEITGTNLFFCGLVGLVVTALIVV
ITEYYTGTNKRPVNSIAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIGTYQLGGLFGTGIAVTAML
GLAGMIVALDAFGPVTDNAGGIAEMAGLDPDVRKATDALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYA
NDLSYFAANGDTYPYFKDIGEISFSLANPYVVAGLLFGGLIPYLFGGIAMTAVGKAASAIVEEVRRQFRE
KPGIMAGTEKPDYGRAVDLLTKAAIREMVIPSLLPVLAPLVVYFGVLLISGSKASAFAALGASLLGVIIN
GLFVAISMTSGGGAWDNAKKSFEDGFIDKDGVRHVKGSEAHKASVTGDTVGDPYKDTAGPAVNPAIKITN
IVALLLLAVLAH

Part 3.2

The reverse translated nucleotide sequence is as follows, obtained using bioinformatics.org’s reverse translation tool

atgaccgtgattccgattgtgattctgtgcggcgtgctgagcgtggtgtatgcggtgtgg
accaccaaaagcgtgctggatgcggatcagggcaacgaacgcatgcgcgaaattgcgggc
tatattcgcgaaggcgcgcaggcgtatctgacccgccagtatctgaccattgcgattgtg
ggcctgattgtggcggtgctggcgtggtatctgctgagcgcgattgcggcgattggcttt
gtgattggcgcggtgctgagcggcgtggcgggctttgtgggcatgcatgtgagcgtgcgc
gcgaacctgcgcaccgcgcaggcggcgagccatagcctgggcgcgggcctggatattgcg
tttaaaagcggcgcgattaccggcatgctggtggcgggcctggcgctgctgggcgtgagc
atttattattttgtgctgaccagcgtgctgggccatccgccgggcagccgcgcggtgatt
gatgcgctggtgagcctgggctttggcgcgagcctgattagcatttttgcgcgcctgggc
ggcggcatttttaccaaaggcgcggatgtgggcggcgatctggtgggcaaagtggaagcg
ggcattccggaagatgatccgcgcaacccggcgaccattgcggataacgtgggcgataac
gtgggcgattgcgcgggcatggcggcggatctgtttgaaacctatgcggtgagcgtggtg
gcgaccatggtgctggcggcgattttttttgcgggcaccccgattctggaaagcgcgatg
gtgtatccgctggcgatttgcggcgcgtgcattctgaccagcattgcgggcacctttttt
gtgaaactgggcaccaacaacagcattatgggcgcgctgtataaaggcctgattgcgacc
ggcgtgtttagcgtggcgggcctggcggtggcgacctatgcgaccgtgggctggggcacc
attggcaccgtggcgggcatggaaattaccggcaccaacctgtttttttgcggcctggtg
ggcctggtggtgaccgcgctgattgtggtgattaccgaatattataccggcaccaacaaa
cgcccggtgaacagcattgcgcaggcgagcgtgaccggccatggcaccaacgtgattcag
ggcctggcggtgagcctggaaagcaccgcgctgccggcgattgtgattgtgggcggcatt
attggcacctatcagctgggcggcctgtttggcaccggcattgcggtgaccgcgatgctg
ggcctggcgggcatgattgtggcgctggatgcgtttggcccggtgaccgataacgcgggc
ggcattgcggaaatggcgggcctggatccggatgtgcgcaaagcgaccgatgcgctggat
gcggtgggcaacaccaccaaagcggtgaccaaaggctatgcgattggcagcgcgggcctg
ggcgcgctggtgctgtttgcggcgtatgcgaacgatctgagctattttgcggcgaacggc
gatacctatccgtattttaaagatattggcgaaattagctttagcctggcgaacccgtat
gtggtggcgggcctgctgtttggcggcctgattccgtatctgtttggcggcattgcgatg
accgcggtgggcaaagcggcgagcgcgattgtggaagaagtgcgccgccagtttcgcgaa
aaaccgggcattatggcgggcaccgaaaaaccggattatggccgcgcggtggatctgctg
accaaagcggcgattcgcgaaatggtgattccgagcctgctgccggtgctggcgccgctg
gtggtgtattttggcgtgctgctgattagcggcagcaaagcgagcgcgtttgcggcgctg
ggcgcgagcctgctgggcgtgattattaacggcctgtttgtggcgattagcatgaccagc
ggcggcggcgcgtgggataacgcgaaaaaaagctttgaagatggctttattgataaagat
ggcgtgcgccatgtgaaaggcagcgaagcgcataaagcgagcgtgaccggcgataccgtg
ggcgatccgtataaagataccgcgggcccggcggtgaacccggcgattaaaattaccaac
attgtggcgctgctgctgctggcggtgctggcgcat

Part 3.3

We need to optimize codons because different model organisms have aminoacyl-tRNAs in different abundances. Certain organisms may not have enough, or any, tRNAs with the anticodons corresponding to our nucleotide sequence, while for others, certain tRNAs may be more abundant, and thus facilitate more efficient translation of mature mRNA.

I’ll be optimizing my sequence for E. coli since it’s both a well-characterized transformation and plasmid amplification platform, and amenable to SoilBuddy’s target application. Given the length of the target sequence, I’ll hedge my bets on Golden Gate Assembly, and optimize my codons without the restriction sites for common type IIS enzymes such as BsaI, BbsI, BsmBI, and FokI. I used Twist Bioscience’s codon optimization tool:

ATGACAGTTATCCCTATAGTAATACTTTGTGGTGTTTTGTCGGTAGTCTACGCAGTTTGGACGAC
GAAGTCTGTCTTGGACGCTGACCAAGGTAATGAGAGAATGCGTGAGATCGCAGGTTACATACGTG
AGGGCGCACAAGCATACTTAACACGACAATACCTCACTATCGCTATCGTTGGGCTTATCGTAGCT
GTCTTAGCATGGTACTTATTATCAGCAATCGCAGCAATCGGGTTCGTCATAGGTGCTGTTCTTAG
TGGTGTAGCTGGATTCGTTGGTATGCACGTATCCGTTCGTGCTAATTTACGTACAGCACAAGCTG
CCTCACACTCTTTAGGGGCTGGTCTGGACATCGCTTTCAAGAGTGGAGCCATCACAGGTATGTTG
GTCGCCGGATTAGCCCTTCTTGGTGTTAGTATATACTACTTCGTCCTTACGTCGGTACTTGGGCA
CCCACCTGGGTCTAGAGCTGTTATAGACGCATTAGTTTCCTTGGGGTTCGGAGCATCGTTGATCT
CAATCTTCGCCCGTTTGGGTGGTGGTATCTTCACAAAGGGTGCAGACGTCGGCGGAGATCTTGTC
GGAAAGGTTGAGGCAGGTATCCCTGAGGACGACCCCCGTAATCCAGCTACAATCGCCGACAATGT
TGGAGACAATGTTGGTGACTGTGCAGGAATGGCCGCTGACCTCTTCGAGACTTACGCAGTTAGTG
TTGTTGCAACTATGGTTTTAGCCGCAATCTTCTTCGCTGGGACACCTATCTTAGAGTCTGCAATG
GTTTACCCATTAGCTATATGTGGAGCATGTATATTAACGTCCATCGCTGGTACGTTCTTCGTTAA
GTTAGGTACAAATAATAGTATCATGGGAGCCCTCTACAAGGGTTTAATCGCAACGGGAGTTTTCT
CTGTTGCAGGTCTTGCTGTTGCAACTTACGCAACAGTCGGTTGGGGTACTATCGGTACAGTAGCC
GGTATGGAGATAACTGGAACAAATTTGTTCTTCTGTGGTTTAGTAGGGTTAGTTGTCACAGCATT
GATAGTTGTAATAACAGAGTACTACACTGGAACTAATAAGCGACCAGTCAATTCCATCGCACAAG
CATCTGTCACAGGTCACGGGACGAATGTTATCCAAGGTTTAGCCGTTTCTTTAGAGTCGACAGCC
CTTCCTGCCATCGTCATAGTAGGCGGTATCATAGGTACTTACCAACTCGGTGGATTATTCGGTAC
AGGTATAGCCGTTACTGCAATGCTCGGATTGGCAGGCATGATAGTTGCCTTGGACGCATTCGGTC
CCGTAACAGACAATGCCGGTGGTATAGCTGAGATGGCTGGTCTTGACCCTGACGTCCGTAAGGCT
ACGGACGCACTCGACGCTGTAGGAAATACTACTAAGGCAGTCACGAAGGGATACGCTATAGGGTC
TGCAGGACTCGGTGCCTTGGTTCTCTTCGCCGCTTACGCTAATGACTTATCATACTTCGCAGCCA
ATGGTGACACATACCCTTACTTCAAGGACATCGGTGAGATCTCATTCTCATTGGCAAATCCATAC
GTTGTAGCCGGTTTATTATTCGGTGGATTAATCCCATACCTCTTCGGTGGTATCGCAATGACAGC
CGTCGGAAAGGCAGCTTCAGCCATCGTTGAGGAAGTTCGTCGGCAATTCCGAGAGAAGCCCGGTA
TCATGGCTGGTACGGAGAAGCCCGACTACGGGCGGGCAGTTGACCTGCTTACGAAGGCAGCCATT
CGTGAGATGGTTATCCCCAGTCTTTTACCTGTTCTCGCCCCTCTTGTAGTTTACTTCGGTGTTCT
TCTCATCTCTGGGTCGAAGGCTTCGGCTTTCGCAGCCCTCGGTGCTTCGTTATTGGGTGTTATCA
TAAATGGGTTGTTCGTAGCTATCAGTATGACGTCTGGTGGCGGGGCATGGGACAATGCCAAGAAG
TCATTCGAGGACGGGTTCATAGACAAGGACGGTGTTAGACACGTCAAGGGTAGCGAGGCTCACAA
GGCTTCCGTTACGGGTGACACAGTTGGTGACCCATACAAGGACACTGCCGGACCCGCCGTTAATC
CCGCTATCAAGATCACGAATATCGTTGCATTGCTTTTATTAGCAGTCCTCGCTCAC

Part 3.4

Once the target sequence is spliced into a cloning vector via golden gate assembly and a competent strain of E. coli is obtained, the bacteria could be transformed using heat shock treatment. After selection for expression of the cloning vector, transformed bacteria would be incubated in broth.

Cells would be extracted via centrifugation and lysis with detergent to release the membrane protein. The membrane protein would be purified using chromatography and verified using Western blot.

A cell-free protocol would use E. coli lysate to conduct the in vitro transcription then translation of the plasmid vector containing the target sequence. Purification and verification of the protein would similarly involve chromatography and Western blot.

Part 3.5

Upon transcription of a DNA sequence to pre-mRNA, post-transcriptional modification of the pre-mRNA involves alternative splicing, which allows for different combinations of exons to be present in the mature mRNA, and subsequently translated into protein isoforms.

Alternatively, transcription initiation complexes may form on different promoters within the gene, causing different transcripts to begin with.

Part 4

Part 4.1

Done

Part 4.2

ppase ppase

Part 5

Part 5.1: DNA Read

(i) I’d like to sequence the eDNA of the soil microbiome to gain an understanding of the organisms SoilBuddy would have to co-exist with.

(ii)

  1. I’d use Illumina NGS sequencing because it balances read-length - more than sufficient for analyzing eDNA fragments - with cost and thoroughput. It is classified as a 2nd-generation sequencing technology since it utilizes sequencing-by-synthesis, albeit in a massively parallel architecture.

  2. My input is purified DNA fragments obtained from soil solution. Depending on the distribution of fragment sizes, a coarse reading of which may be obtained with a pilot gel electrophoresis using a standard ladder, I will first use enzymatic fragmentation to produce suitable DNA fragments, then ligate Illumina NGS-specific adapters containing barcode sequences, and finally run a low number of PCR cycles to amplify my DNA fragments.

After PCR amplification, I’ll pool my samples to ensure equal representation in my library and verify their purity before loading them into the sequencer.

  1. Under Illumina NGS, the fragments of DNA in my library hybridize sparsely over the surface of the sequencer’s flow cell, thanks to the adapters ligated to the eDNA samples. The fragments first undergo bridge amplification PCR wherein multiple copies of the fragments (both forward and reverse strands corresponding to the fragment sequence) are generated in small clusters within the flow cell’s nanowells. Reverse strands are enzymatically cleaved and washed off the flow cell.

Once clusters are produced, the cell is flooded with a primer, DNA polymerase and modified fluorescently-tagged nucleotides which can only be incorporated by the DNA polymerase one base at a time to the oligomers surrounding the clusters. Unbound nucleotides are washed away, then a picture of the flow cell is taken, which reveals the specific base incorporated in each cluster by virtue of the unique wavelength of fluorescent light given off by each modified nucleotide (ie. A, T, C or G). The fluorescent tag blocking DNA synthesis is chemically inactivated, then the chip is again flooded with fluorescently-tagged nucleotides. This process repeats till the full length of DNA fragments has been replicated.

Specifically, Illumina NGS identifies the specific bases using the unique fluorescent signature emitted by the fluorescent tag attached to each of the four possible nucleotides.

  1. After demultiplexing, the output is short read data. I’d subsequently process the raw read data using a metagenomic analysis pipeline to identify specific taxa and species present in the original soil solution sample.

Part 5.2: DNA Write

(i) I’d like to synthesize DNA for a genetic circuit that regulates bacterial membrane protein pumps depending on external pH as part of my SoilBuddy MVP. I’d choose a set point optimized for food crops such as corn.

(ii)

  1. I’d use Gibson Assembly to put my genetic circuit together given the simplicity and reliability of the protocol. First, I’d identify appropriate restriction enzyme combinations for the BioBricks parts I’ll require. Next, I’ll pick two BioBricks parts at a time for insertion into the target plasmid.

Each BioBricks part and the vector will be digested in respective reaction chambers with the appropriate restriction enzymes, followed by thermal denaturation (and thus inactivation) of the restriction enzymes. Thereafter, the digested BioBricks parts and vector will be incubated together in molar amounts designed to optimize formation of the target construct along with a DNA ligase. After transformation into a bacterial platform, selection, amplification and extraction, repeat the process till all the BioBricks parts are incorporated within the recombinant plasmid vector.

  1. Needless to say, the process is extremely time-intensive due to the multiple, repetitive transformations and amplifications involved. While laboratory automation could allow the process to scale, it would be very resource-intensive. Lastly, while each particular step might be lossy, regular purification, selection and verification steps would ensure the desired vector is formed at the end of the day.

Part 5.3: DNA Edit

(i) One possible development of SoilBuddy would be a process rather than an organism that transforms native soil microbiota to enhance their salutary functions (eg nitrogen-fixing, pH buffering). To that end, I would like to edit prokaryotic bacteria and eukaryotic fungal DNA considering the particular niche of commensal microbiota near plant roots. This would involve, mainly, gene insertion to introduce novel gene products or base edits to enhance existing regulatory mechanisms in the microorganisms.

(ii)

  1. Given the range of target systems (both prokaryotic and eukaryotic) as well as payloads desired (ie. novel genes and edits), I would leverage the versatility of CRISPR. Taking a CRISPR-based gene knock-in of yeast as an example, we first design a DNA sequence encoding a gRNA that recognizes our target insertion site and has minimal off-target effects. Then, we select a yeast plasmid with an antibiotic selection marker and which contains a sequence encoding Cas9 endonuclease. Using Gibson assembly, we first digest the vector and gRNA-encoding sequence with appropriate restriction enzymes, then ligate the sequence into the plasmid using DNA ligase, transform the recombinant vector into competent yeast cells, select and amplify the plasmid through incubation.

We prepare a donor template containing the gene to be inserted and transform the exogenous donor template into yeast. Now, the yeast contains Cas9 endonuclease from expression of the plasmid, which hybridizes with gRNA (also expressed from transcrption of the plasmid DNA) to form ribonucleoprotein complex. The crRNA in the gRNA binds to the recognition site before Cas9 domain activity causes a double-stranded break in the yeast DNA. Thereafter, the donor template provides for Homology-Directed Repair that knocks in the intended gene.

  1. The preperatory work involves designing the gRNA, selecting yeast cells that are competent and do not suffer from damage to their Homology-Directed Repair mechanism, and selecting a donor template incorporating a reporter (eg GFP) such that unintended edit products are minimized. At the same time, edited yeast cells have to be selected due to the low efficiency of gene knock-in through fluorescence-based flow-cytometry for example.

  2. While a well-designed gRNA and donor template will minimize indels, off-target edits and maximize the chances of successful gene knock-in, statistically speaking, the odds of a cell being successfully edited are low. Hence, care needs to be taken in selecting for edited cells, which can then be expanded to counteract the low efficiency of knock-in

Week 3 HW: Lab Automation

Part 1

Find and describe a published paper that utilizes the Opentrons or an automation tool to achieve novel biological applications.

The paper I’ll be analyzing is titled “Development of a high-throughput minimum inhibitory concentration (HT-MIC) testing workflow” published in Frontiers in Microbiology.

In summary, the researchers used an Opentrons OT-2 robot to automate an assay used to test the safety-efficacy profile of an antibiotic. They accomplished this by programmatically preparing a serial dilution of the antibiotic candidate across multiple 96-well plates with replicates, innoculating the wells with the test bacteria, then measuring the optical density of each well with a plate reader to determine bacterial viability after the antibiotic challenge.

The method outlined in the paper minimizes human error, standardizes the innoculation pattern used for each plate well and allows for a massive range of antibiotic concentrations, as well as antibiotics to be tested in parallel. This allows for massive improvements in thoroughput, accuracy and replicability of results.

Part 2

Write a description about what you intend to do with automation tools for your final project. You may include example pseudocode, Python scripts, 3D printed holders, a plan for how to use Ginkgo Nebula, and more. You may reference this week’s recitation slide deck for lab automation details.

Considering my main plan, SoilBuddy, lab automation serves primarily to augment the speed at which my experiments may be run, and allow for overlapping scheduling to optimize lab time.

There are a few key steps where lab automation will come in handy:

  • Building: plasmid digestion, transformation, and selection of bacteria
  • Testing: Testing the performance of the reporter system against multiplexed stimulus conditions

Building

Roughly, here are the steps I’ll be following along with the corresponding pieces of lab equipment required for each:

  • (if the plasmid isn’t ordered with gene construct and genetic switch incorporated) ATC Thermal cycler for PCR amplification of casette, Plate incubator for plasmid digestion
  • Plate incubator for heat shock transformation
  • Plate incubator for bacterial recovery, expansion and selection

Testing

Roughly, here are the steps I’ll be following along with the corresponding pieces of lab equipment required for each:

  • Opentrons OT-2 for preparing serial dilutions of N2 agent and pH
  • Opentrons OT-2 for preparing different innoculations of culture and replicate plates
  • Spark plate reader for reading out reporter results

Week 4 HW: Protein Design Part I

Part A

  1. Number of amino acids = 500g/(100 Da) = 5 mol = 3.0 x 10^24 molecules of amino acids (approx).
  2. Over the course of digestion, the polynucleotides are broken down into constituent nucleobases prior to absorption.
  3. Considering the degeneracy of codons, these 20 amino acids were sufficient to produce a diversity of proteins, and were evolutionarily conserved due to a lack of strong selection pressure against them (ie. they were “good enough”).
  4. .
  5. They could’ve formed abiotically given the presence of organic precursors such as carboxylic acids, amines and small molecule side groups, catalyzed by zeolites, and triggered by lightning and heat on the primordial earth or extraterrestrial asteroids respectively.
  6. Left-handed spirals.
  7. Yes, some examples are $\pi$ helices and $3_{10}$ helices.
  8. It’s more energetically stable given L-amino acids and D-saccharides predominate natural protein helices and the sugar-phosphate backbone of polynucleotides respectively.
  9. In aqueous environments, the hydrophobic portions of beta sheets are driven together by steric interactions while the hydrophilic groups facilitate relatively strong intermolecular hydrogen bonding.
  10. Beta sheets allow for strong intermolecular bonding, in hydrophobic zippers, that renders misfolded proteins more stable than their functional conformations and facilitates the addition of more proteins to the aggregate fibril - the biochemical basis of amyloid pathogenesis. Yes, you could make materials out of amyloid beta sheets but they’d only be stable under aqueous conditions and would be potential biotoxins.
  11. .

Part B

  1. I chose to investigate an antifreeze protein from an arctic bacterium as a potential solution for winter snow-clearing.

  2. The sequence, as obtained from UniProt is as follows:

>sp|H7FWB6|IBP_FLAFP Ice-binding protein OS=Flavobacterium frigoris (strain PS1) OX=1086011 GN=HJ01_03463 PE=1 SV=1
MKILKRIPVLAVLLVGLMTNCSNDSDSSSLSVANSTYETTALNSQKSSTDQPNSGSKSGQ
TLDLVNLGVAANFAILSKTGITDVYKSAITGDVGASPITGAAILLKCDEVTGTIFSVDAA
GPACKITDASRLTTAVGDMQIAYDNAAGRLNPDFLNLGAGTIGGKTLTPGLYKWTSTLNI
PTDITISGSSTDVWIFQVAGNLNMSSAVRITLAGGAQAKNIFWQTAGAVTLGSTSHFEGN
ILSQTGINMKTAASINGRMMAQTAVTLQMNTVTIPQ
  • It is 280 residues long. Threonine is the most common AA residue, appearing a cumulative 33 times.
  • There are 250 homologs from across the tree of life.
  • It belongs to the ice-binding protein superfamily.
  1. The structure was modelled in Apr 2014. The model is high-resolution, providing details down to 2.10Å. There are no non-protein components in the final protein structure. It belongs to the ice-binding protein superfamily

  2. Cartoon View Cartoon View of IBP_FLAFP Cartoon View of IBP_FLAFP

Ribbon View Ribbon View of IBP_FLAFP Ribbon View of IBP_FLAFP

Ball-and-Stick View Ball-and-stick View of IBP_FLAFP Ball-and-stick View of IBP_FLAFP

Labelling by Secondary structure Secondary Structure-Labelled View of IBP_FLAFP Secondary Structure-Labelled View of IBP_FLAFP

The protein has more sheets than helices, though the helices are substantially larger.

Labelling by residue hydropathy.

Blue represents hydrophilicity while red represents hydrophobicity Hydropathic View of IBP_FLAFP Hydropathic View of IBP_FLAFP

Hydrophobic residues are encountered sparingly, on outward-oriented branches, while hydrophilic residues are found on the main beta sheets accessible to the protein’s surroundings.

Surface View Surface Energy View of IBP_FLAFP Surface Energy View of IBP_FLAFP

There are a few pockets for water to bind to.

Part C

C1

Deep Mutational Scans

  1. Mutational Heat Map Mutational Heat Map Mutational Heat Map

  2. I think the bright bands which occur at regular intervals signify residues involved in linking helices together since they offer some flexibility in binding nucleation sites.

Latent Space Analysis

  1. Yes, they tend to be homologs

C2

Folding Protein Folding Protein Folding

  1. It largely matches the original structure including the spiral linking several beta sheets and a large alpha helix. However, it fails to model the hydrophobic side branches of the protein separately and instead connects them using a polypeptide chain.
  2. No, it is quite sensitive to missense mutations. This comports with the earlier heatmap of mutational scans.

C3

Inverse Folding

Inverse Folding Inverse Folding

Comparison of Structures

Original: Protein Folding Protein Folding

Modified Sequence: Modified Protein Modified Protein

In comparison to the original, the predicted structure of the modified protein retains the broad helix and beta sheet spiral structure but its beta sheet spiral is misshapen and the hydrophobic branches are overlarge. Given the difference between experimentally-derived structure and computational folding prediction for the original protein, I would believe that this new sequence would fail to demonstrate ice-binding behavior in a biological environment.

D

Protein Engineering Goals

  1. Enhance the thermal stability of MS2-L peptide derived from the ssRNA Leviviridae phage

Protein Engineering Workflow

  1. Use Protein Language Models to conduct high-thoroughput in silico mutation of the protein
  2. Grade mutants’ thermal stability using Rosetta
  3. Carrying forward the top quintile of mutants as seeds for the next iteration, repeat the process till increments in stability are minimal

Week 5: HW Protein Design Part II

Part A

Part 1: Generate Binders with PepMLM

Binder SequencePerplexity Score
WRYYATVARHKE15.38014901
WLYYVVVLRHGE32.45105037
WRYYAAGARLKE11.75101427
WRYYATAVELKG10.44080960

Part 2: Evaluate Binders with AlphaFold3

Peptide IDBinder SequenceipTM ScoreLocation
Peptide 0WRYYATVARHKE0.35Approaches the $\beta$ barrel; surface-bound
Peptide 1WLYYVVVLRHGE0.33Approaches the $\beta$ barrel; surface-bound
Peptide 2WRYYAAGARLKE0.35Approaches the $\beta$ barrel; surface-bound
Peptide 3WRYYATAVELKG0.22Conforms to the dimer interface; binds to a pocket
ControlFLYRWLPSRRGG0.31Surrounding the $\beta$ barrel; surface-bound

While peptides 0-2 exceed the control (known binder)’s ipTM scores, indicating stronger protein-protein interaction, they still represent low confidence values. I would not conclude that they produce stronger protein-protein interactions for use as potential molecular glues.

Part 3: Evaluate Properties of Generated Peptides in the PeptiVerse

Peptide IDBinder SequencePredicted Binding AffinitySolubilityHemolysis ProbabilityNet Charge (pH 7)Molecular Weight
Peptide 0WRYYATVARHKE5.659 pKd/pKi1.0000.0341.851579.8 Da
Peptide 1WLYYVVVLRHGE6.562 pKd/pKi1.0000.158-0.151533.8 Da
Peptide 2WRYYAAGARLKE5.878 pKd/pKi1.0000.0421.771483.7 Da
Peptide 3WRYYATAVELKG5.785 pKd/pKi1.0000.0608.501456.6 Da

While there isn’t enough of an ipTM range to draw meaningful conclusions regarding binding affinity, I would think that structural conformation lends itself, by necessity, to the strength of protein-protein interactions. Peptide 1 actually had the highest hemolysis probability and the lower pH; on that note, peptide 3 makes for the best therapeutic candidate considering its net charge at pH 7 and solubility assists in drug delivery while its binding affinity renders it efficacious as a therapeutic target.

Part 4

KKCGKQFKQKQE

This is vastly different in terms of conformation and osmolarity as compared to the other peptides. I would request representative lab samples of the protein and conduct initially binding efficiency assays using MS before advancing either as a candidate.

Part B

Part C

Protein Design Process Overview

We’ll be utilizing random mutagenesis to generate variants of L-protein optimized for both (1) Lysis Activity and (2) Expression Levels. We begin with the ground truth of the experimental data provided, generate combinations of mutations and test them usign Af2-multimer.

Mutation Set

We filter mutations by excluding nonsense mutations and prioritizing missense mutations which enhance both lytic activity and expression levels. Frankly, the synergistic effects of different mutations is not a straightforward problem to solve, so we resort to a brute force attack on different possible combinations of mutations in L protein that affect its binding to DNAJ. In an ideal world, we would create a performance score that assessed its lytic activity and expression as well, but existing models wouldn’t encode these properties especially for a small transmembrane protein.

Mut #Amino Acid PositionAmino Acid Change
013P->L
115S->A
218R->G
318R->I
430R->Q
530R->L
631R->I
744L->P
845A->P
946I->F

Mathematically, there are 26*32=576 possible sets of mutations that can be made.

Evaluation

In the absence of reliable lysis and expression level metrics, we resort to DNAJ:L Protein binding affinity as predicted by Af2-Multimer instead.

Results

Mutationsiptm value
0_10.152 $\pm$ 0.02
0_20.16 $\pm$ 0.02
0_30.148 $\pm$ 0.02
0_40.152 $\pm$ 0.02
0_50.144 $\pm$ 0.02
0_60.168 $\pm$ 0.02
0_70.17 $\pm$ 0.02
0_80.178 $\pm$ 0.02
0_90.208 $\pm$ 0.04
1_20.15 $\pm$ 0.02
1_30.152 $\pm$ 0.02
1_40.154 $\pm$ 0.03
1_50.146 $\pm$ 0.01
1_60.168 $\pm$ 0.03
1_70.178 $\pm$ 0.03
1_80.172 $\pm$ 0.02
1_90.178 $\pm$ 0.02
2_40.146 $\pm$ 0.02
2_50.146 $\pm$ 0.02
2_60.156 $\pm$ 0.02
2_70.164 $\pm$ 0.03
2_80.174 $\pm$ 0.03
2_90.196 $\pm$ 0.04
3_40.136 $\pm$ 0.02
3_50.144 $\pm$ 0.02
3_60.156 $\pm$ 0.03
3_70.136 $\pm$ 0.02
3_80.142 $\pm$ 0.02
3_90.144 $\pm$ 0.02
4_60.146 $\pm$ 0.03
4_70.14 $\pm$ 0.02
4_80.144 $\pm$ 0.02
4_90.14 $\pm$ 0.02
5_60.146 $\pm$ 0.03
5_70.14 $\pm$ 0.02
5_80.144 $\pm$ 0.02
5_90.14 $\pm$ 0.02
6_70.142 $\pm$ 0.01
6_80.142 $\pm$ 0.02
6_90.14 $\pm$ 0.02
7_80.14 $\pm$ 0.02
7_90.14 $\pm$ 0.02
8_90.152 $\pm$ 0.02

Thus, METRFPQQSQQTLASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAFFLSKFTNQLLLSLLEAVIRTVTTLQQLLT (mut #0 and #9) is identified to be the “best” L-protein

Week 6 HW: Genetic Circuits Part I

Assignment: DNA Assembly

  1. What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose? The NEB 2X master mix includes engineered thermostable DNApol to synthesize complimentary strands during the extension phase of PCR, with low error rate and high expressivity to enable faster, more accurate DNA replication.

It includes a buffer to maintain optimum pH for enzymatic catalysis and prevent the denaturation of enzyme or nucleic acids, as well as ${Mg}{Cl}_{2}$ to provide $Mg^{2+}$ as a cofactor for DNApol.

  1. What are some factors that determine primer annealing temperature during PCR? Primer sequence (specifically, the number of complimentary base pairs and how many are C-G as opposed to A-T): If a primer sequence contains more complimentary base pairs (eg because the forward primer is longer, say, or has higher sequence homology with the sense strand) the annealing temperature will be higher. If the primer contains more CG as opposed to AT content, the annealing temperature will be higher.

Buffer: A higher concentration of salt can lead to elevated ion levels, favoring the salting out of proteins and DNA which might, to some extent, facilitate annealing at a lower temperature.

  1. There are two methods from this class that create linear fragments of DNA: PCR, and restriction enzyme digests. Compare and contrast these two methods, both in terms of protocol as well as when one may be preferable to use over the other.

Both PCR and Restriction Enzyme Digests produce linear dsDNA and can be highly specific for the target region if designed properly.

However, while PCR aims to amplify a target sequence, restriction enzyme digests aim to isolate a target sequence from a given amount of DNA sample. PCR involves thermocycling while restriction enzyme digests are conducted at a constant optimum temperature. PCR requires DNA primers while restriction enzyme digests do not require additional DNA material on top of the sample itself.

  1. How can you ensure that the DNA sequences that you have digested and PCR-ed will be appropriate for Gibson cloning?

Firstly, we can check their purity using a 260/280 absorbimetry assay, and verify the predominant fragment length using gel electrophoresis.

Secondly, we can use Sanger sequencing the verify the sequence of linear DNA produced.

  1. How does the plasmid DNA enter the E. coli cells during transformation?

Either through chemical means in heat shock treatment, or electrical means in electroporation, the bacterial cell membrane and cell wall are modified to grant plasmid DNA greater permeability - whether through the alteration of membrane thickness, structure and charge in chemical competence, or the electrical stress-induced poration of the bacterial cell membrane in electroporation.

  1. Describe another assembly method in detail (such as Golden Gate Assembly)

Golden Gate Assembly relies on Type IIS as opposed to Type IIP restriction enzymes to enable one-step syntheses of multipart constructs. In Golden Gate Assembly, the specific type of restriction enzymes used doesn’t depend on palindromic recognition sequences, allowing greater versatility in engineering restriction sites, and doesn’t leave parts of the restriction site in the final construct.

In Golden Gate Assembly, the respective genetic components are first checked to ensure they don’t contain any internal Type IIS recognition sites, and a unique 4-base overhang is engineered to dictate the correct order of assembly. Afterwards, the genetic components are added to a one pot reaction mixture containing the specific Type IIS restriction enzyme used, DNA ligase and buffer solution.

  1. Explain the other method in 5 - 7 sentences plus diagrams (either handmade or online).

^ See above

  1. Model this assembly method with Benchling or Asimov Kernel!

Sure thing!

Assignment: Asimov Kernel

Refer to this notebook for the constructs and repressilator

Lab Homework

I’m a remote committed listener so don’t have access to a physical lab

Week 7 HW: Genetic Circuits Part II

Intracellular Artificial Neural Networks (IANNs)

1. What advantages do IANNs have over traditional genetic circuits, whose input/output behaviors are Boolean functions?

IANNs more easily provides for graded responses and can scale intelligent responses; they can approximate every mathematical function and not just step functions.

2. Describe a useful application for an IANN; include a detailed description of input/output behavior, as well as any limitations an IANN might face to achieve your goal.

IANNs could classify the cell surface of tumor cells and initiate the secretion of the best paracrine messengers to recruit NK and Tc cells. The input would be the MHC of the target cell and the IANN would be a classifier whose output would be one of various preprogrammed cellular responses. The IANN would need to select a particular cellular response robustly without being modified.

3. Below is a diagram depicting an intracellular single-layer perceptron where the X1 input is DNA encoding for the Csy4 endoribonuclease and the X2 input is DNA encoding for a fluorescent protein output whose mRNA is regulated by Csy4. Tx: transcription; Tl: translation.

Fungal Materials

1. What are some examples of existing fungal materials and what are they used for? What are their advantages and disadvantages over traditional counterparts?

Mycelium-based styrofoam, myco-bricks and myco-leather: that’s better than existing styrofoam, bricks and leather because it’s biodegradable, carbon-lighter and cruelty-free.

2. What might you want to genetically engineer fungi to do and why? What are the advantages of doing synthetic biology in fungi as opposed to bacteria?

I’d like to engineer them as an alternative protein source and biofoundry. Fungi are eukaryotic, enabling native eukaryotic gene regulation and post-translational modification, can be grown off of waste material and fungi have much higher translational efficiency.

First DNA Twist Order

lux operon engineered to function as an AND genetic circuit

Week 9 HW: Cell-Free Systems

Homework Part A

Assignment

1. Explain the main advantages of cell-free protein synthesis over traditional in vivo methods, specifically in terms of flexibility and control over experimental variables. Name at least two cases where cell free expression is more beneficial than cell production.

It lacks the stress response, proteostasis and detoxification of an in vivo environment, allowing for much higher expression of protein including toxic varieties or those incorporating xenobiotic compounds, as in bio-orthogonal experiments. Reaction conditions are standard and can be externally controlled/varied (eg temperature) more precisely than in in vivo systems. The progress of reaction is more easily followed using imaging techniques, allowing for rapid optimization and sequential syntheses. Two cases where cell-free expression is better than cell production are the expression of protein toxic to bacterial/fungal chassis (eg antibacterial/antifungal compounds) as well as proteins intended for use in human medicine (free of endotoxins).

2. Describe the main components of a cell-free expression system and explain the role of each component.

  • Cell Extract (specifically, transcription and translation machinery): Allow for the transcription and translation of DNA input
  • ATP/GTP as well as phosphorylative regeneration system: Energy carrier drives the expression of protein
  • Nucleotide bases (ie NTPs): For transcription of DNA to form mRNA
  • Nucleic acid template: Encode protein/construct to be expressed
  • Buffer solution: Provide necessary salts, cofactors and buffers in an isosmotic system for optimal protein expression

3. Why is energy provision regeneration critical in cell-free systems? Describe a method you could use to ensure continuous ATP supply in your cell-free experiment.

Cell-Free systems do not natively provide for substrate-level or oxidative phosphorylation required for ATP/GTP regeneration. ATP/GTP in turn is required for the endergonic processes involved in expression (eg GTP-driven ribosomal translation of primary transcript; ATP-driven tRNA aminoacetylation). I would include excess creatine phosphate to function as a Pi donor and creatine kinase to catalyze the phosphorylation of ATP/GTP in the cell-free system buffer solution.

4. Compare prokaryotic versus eukaryotic cell-free expression systems. Choose a protein to produce in each system and explain why.

Prokaryotic cell-free expression systems have higher yields of final product, are faster and less complex than eukaryotic cell-free expression systems, though the latter enable the production of larger, more complex proteins complexed with cofactors and coenzymes.

Consider the production of GFP in a prokaryotic system: simultaneous transcription and translation means multiple GFP polypeptides may be synthesized in parallel, while the autocatalytic folding of the protein removes the need for post-translational modification or energetically costly chaperonins.

Now consider, alternatively, the production of selectin in a eukaryotic system: given the glycoprotein nature of selectin, after translation yields the primary structure of selectin, it undergoes post-translational modification to have a glycosidic component linked chemically.

5. How would you design a cell-free experiment to optimize the expression of a membrane protein? Discuss the challenges and how you would address them in your setup.

After identifying the key components of the reaction mix and how they might impact expression (eg the relative concentrations of ions in the buffer, buffer pH, relative concentrations of GTP/ATP and components of the phosphorylative regeneration system), I would vary these conditions across a 96-well plate in triplicate and incubate the plate under constant conditions. At a fixed endpoint, I would quench the reaction and use spectrophotometry to determine the respective expression efficiency in each well, and thus the reaction conditions which produced the highest protein expression levels.

One challenge could be the imprecision of reaction mix formulation. I would use lab automation to reduce variation in reaction mix preparation and minimize error.

Another challenge could be a lack of standard lysate. I would prepare a large enough stock of lysate prior to experimentation.

6. Imagine you observe a low yield of your target protein in a cell-free system. Describe three possible reasons for this and suggest a troubleshooting strategy for each.

  1. Poor Quality of DNA template: Unoptimized codons and endonuclease contamination could reduce the efficiency of transcription and translation. Troubleshooting: Using the same preparation and reaction mix, substitute a known optimized plasmid for the DNA template provided.

  2. Insufficient ATP/GTP regeneration: ATP/GTP are rate-limiting due to the slow rate/insufficient regeneration Troubleshooting: Repeat the experiment with an excess of creatine phosphatase and kinase

  3. Insufficient cofactors: cofactors such as ${Mg}{2+}$ are rate-limiting due to a low concentration in reaction buffer which reduces the rate of formation of holoenzymes required for transcription and translation Troubleshooting: Repeat the experiment with an excess of cofactors (eg. ${Mg}{2+}$) added to the reaction mix.

Homework question from Peter

Freeze-dried cell free systems can be incorporated into all kinds of materials as biological sensors or as inducible enzymes to modify the material itself or the surrounding environment. Choose one application field - Architecture, Textiles/Fashion, or Robotics, and propose an application using cell-free systems that are functionally integrated into the material. Answer each of these key questions for your proposal pitch:

* Write a one-sentence summary pitch sentence describing your concept.

Imagine a smart layer you could add to windows to filter out UV rays in sunlight but which self-healed and wasn’t subject to photo-degradation.

* How will the idea work, in more detail? Write 3-4 sentences or more.

A cell-free system incorporated in a hydrogel will express photoprotective protein (eg. lycopene) under the regulation of a microfluidic logic chip. The logic chip could be hard-wired for a particular region’s climate, or incorporate a microprocessor to allow real-time updates from a photosensor. The lycopene itself will be degraded in the sunlight, but offer bespoke UV protection which compared to traditional UV films will be regenerable, allow vitamin D-promoting wavelengths and the natural warmth of sunlight through, and allow fine customization of which wavelengths of sunlight get filtered out.

* What societal challenge or market need will this address?

This would help minimize energy used for cooling as the world becomes more urbanized and meet the need for window conditioning in construction.

* How do you envision addressing the limitation of cell-free reactions (e.g., activation with water, stability, one-time use)?

Within the hydrogel film, the raw materials (eg rainwater) will be collected from the environment itself and stored in reservoirs which the microfluidic logic then transports to a well-protected reaction core housing the cell-free system proper.

Homework question from Ally

Freeze-dried cell-free reactions have great potential in space, where resources are constrained. As described in my talk, the Genes in Space competition challenges students to consider how biotechnology, including cell-free reactions, can be used to solve biological problems encountered in space. While the competition is limited to only high school students, your assignment will be to develop your own mock Genes in Space proposal to practice thinking about biotech applications in space!

For this particular assignment, your proposal is required to incorporate the BioBits® cell-free protein expression system, but you may also use the other tools in the Genes in Space toolkit (the miniPCR® thermal cycler and the P51 Molecular Fluorescence Viewer). For more inspiration, check out https://www.genesinspace.org/

Provide background information that describes the space biology question or challenge you propose to address. Explain why this topic is significant for humanity, relevant for space exploration, and scientifically interesting. (Maximum 100 words)

The risk of illness in long-duration human spaceflight is unconscionable; not being able to diagnose and consequently treat mystery illnesses only more so. I aim to provide a low-cost battery of diagnostics to rapidly identify pathogens, with strong translational potential for rural healthcare delivery on Earth.

Name the molecular or genetic target that you propose to study. Examples of molecular targets include individual genes and proteins, DNA and RNA sequences, or broader -omics approaches. (Maximum 30 words)

Metabolomics.

Describe how your molecular or genetic target relates to the space biology question or challenge your proposal addresses. (Maximum 100 words)

Clearly state your hypothesis or research goal and explain the reasoning behind it (Maximum 150 words) All pathogens carry metabolomic signatures which specifically identify strains, types and serotypes. My approach allows for a broad-range of pathogens to be identified without heavy, high-maintenance laboratory equipment.

Outline your experimental plan - identify the sample(s) you will test in your experiment, including any necessary controls, the type of data or measurements that will be collected, etc. (Maximum 100 words)

I’ll use 3 samples of E. coli, T4 Phage and C. elegans to simulate bacterial, viral and nematodic pathogens in a BSL-2 environment. DI will be a -ve control. My experiment will involve the multi-repeat testing of a cell-free metabolomic screening system across serial dilutions of pathogen titers to establish diagnostic specificity and sensitivity.

Homework Part B

https://docs.google.com/document/d/1lCuoHWFwwyRXwhZk5J6fBLDnvC8MFbETRV1QUFZBLPo/edit?tab=t.0

Week 10 HW: Imaging and Measurement

Waters Lab Part I

  1. 28006.60Da

  2. z=32 based on consecutive m/z’s (875.4421, 848.9162); MW = 27982Da; Accuracy = 99.9%

  3. No, its amplitude above background could mean it’s not reliably distinguished from background noise.

Waters Lab Part II

  1. When a protein unfolds, several more ionizable sites on the polypeptide are exposed. As such, the denatured protein will exhibit several more m/z peaKs, and typically at higher m/z values than the native protein conformation.

  2. The charge state is +0 based on the maximal abundance of the protein.

Waters Lab Part III

  1. MVSKGEELFTG VVPILVELDG DVNGHKFSVS GEGEGDATYG K**LTL**KFICTT GK**LPVPWPTL VTTLTYGVQC FSRYPDHMKQ HDFFKSAMPE GYVQERTIFF KDDGNYKTRA EVKFEGDTLV NRIEL**KGIDF KEDGNILGHK LEYNYNSHNV YIMADKQKNG IKVNFKIRHN IEDGSVQLAD HYQQNTPIGD GPVL**LPDNHY LSTQSALSKD PNEKRDHMVL LEFVTAAGIT LGMDELYK**LE HHHHHH

20 K residues; 22 L residues

  1. Trypsin digestion yields 19 fragments

  2. 21 peaks

  3. There are more peaks in the chromatogram than expected

Waters Lab Part IV

7FU Decamer – Blue 3.4MDa peak 8FU Didecamer – Pink 8.33MDa peak 8FU 3-Decamer – Pink 12.67MDa peak 8FU 4-Decamer – Blue 16MDa peak cluster

Waters Lab Part V

Theoretical Observed/measured on the Intact LC-MS: 28006 PPM Mass Error: 857ppm Molecular weight (kDa): 28

Week 11 HW: Building Genomes

Part A

I enjoyed the sense of oneness and how it spoke to the power of science to transcend divisions of identity and geography

Part B: Cell-Free Protein Synthesis | Cell-Free Reagents

E. coli Lysate: Provides biological medium and machinery (eg ribosomes) Salts/Buffer: Optimal pH, ionic atmosphere and osmolarity Energy / Nucleotide System: Power transcription/translation Translation Mix (Amino Acids): Allow for translation to produce mRNA from DNA Additives: Nicotinamide in particular allows for the regeneration of NAD Backfill: Maintain appropriate volume for manipulation of the biological systems

Part C: Planning the Global Experiment | Cell-Free Master Mix Design

sfGFP: Maturation time - 13.6min mRFP1: Maturation time - 60.0min mKO2: Maturation time - 108.0min mTurquoise2: Maturation time - 33.5min mScarlet_I: Maturation time - 174.0min Electra2: Lifetime - 3.4ns

Increasing the concentrations of AMP, UMP, CMP and GMP across all the proteins will enhance the total fluorescence over the incubation period by increasing the rate of reaction at the rate-limiting-step of translation.

Week 12 HW: Bioproduction

Week 13 HW: Biodesign of Living Materials

Week 14 HW: Biofabrication

Labs

Lab writeups:

  • Week 1 Lab: Pipetting

    Lab As a remote committed listener, I don’t have lab access to practise pipetting

  • Week 2 Lab: DNA Gel Art

    Disclaimer As a remote committed listener, I don’t have access to equipment to carry the DNA digest and electrophoresis out.

  • Week 3 Lab Opentrons Art

    Disclaimer I submitted my Opentrons .ipynb in fulfilment of the lab component. https://colab.research.google.com/drive/12QWy9XQPNYZR-H8hs9YzWnw9YsxsSDH3?usp=sharing from opentrons import types metadata = { # see https://docs.opentrons.com/v2/tutorial.html#tutorial-metadata 'author': 'shrimay_saikia', 'protocolName': 'green_red_diamonds', 'description': 'Creates a criss-crossed diamond pattern', 'source': 'HTGAA 2026 Opentrons Lab', 'apiLevel': '2.20' } ############################################################################## ### Robot deck setup constants - don't change these ############################################################################## TIP_RACK_DECK_SLOT = 9 COLORS_DECK_SLOT = 6 AGAR_DECK_SLOT = 5 PIPETTE_STARTING_TIP_WELL = 'A1' well_colors = { 'A1' : 'Red', 'B1' : 'Green', 'C1' : 'Orange' } def run(protocol): ############################################################################## ### Load labware, modules and pipettes ############################################################################## # Tips tips_20ul = protocol.load_labware('opentrons_96_tiprack_20ul', TIP_RACK_DECK_SLOT, 'Opentrons 20uL Tips') # Pipettes pipette_20ul = protocol.load_instrument("p20_single_gen2", "right", [tips_20ul]) # Modules temperature_module = protocol.load_module('temperature module gen2', COLORS_DECK_SLOT) # Temperature Module Plate temperature_plate = temperature_module.load_labware('opentrons_96_aluminumblock_generic_pcr_strip_200ul', 'Cold Plate') # Choose where to take the colors from color_plate = temperature_plate # Agar Plate agar_plate = protocol.load_labware('htgaa_agar_plate', AGAR_DECK_SLOT, 'Agar Plate') ## TA MUST CALIBRATE EACH PLATE! # Get the top-center of the plate, make sure the plate was calibrated before running this center_location = agar_plate['A1'].top() pipette_20ul.starting_tip = tips_20ul.well(PIPETTE_STARTING_TIP_WELL) ############################################################################## ### Patterning ############################################################################## ### ### Helper functions for this lab ### # pass this e.g. 'Red' and get back a Location which can be passed to aspirate() def location_of_color(color_string): for well,color in well_colors.items(): if color.lower() == color_string.lower(): return color_plate[well] raise ValueError(f"No well found with color {color_string}") # For this lab, instead of calling pipette.dispense(1, loc) use this: dispense_and_detach(pipette, 1, loc) def dispense_and_detach(pipette, volume, location): """ Move laterally 5mm above the plate (to avoid smearing a drop); then drop down to the plate, dispense, move back up 5mm to detach drop, and stay high to be ready for next lateral move. 5mm because a 4uL drop is 2mm diameter; and a 2deg tilt in the agar pour is >3mm difference across a plate. """ assert(isinstance(volume, (int, float))) above_location = location.move(types.Point(z=location.point.z + 5)) # 5mm above pipette.move_to(above_location) # Go to 5mm above the dispensing location pipette.dispense(volume, location) # Go straight downwards and dispense pipette.move_to(above_location) # Go straight up to detach drop and stay high ### ### YOUR CODE HERE to create your design ### '''Algorithm Design: I use lazy logic instead of optimizing the travel path or doing streaks since I prioritize reliability over efficiency. With greater familiarity, I'll be more confident in optimizing for pattern art print times. ''' #Pre-generated coordinate arrays sfgfp_points = [(-2.2, 39.6),(0, 39.6),(2.2, 39.6),(-4.4, 37.4),(0, 37.4),(4.4, 37.4),(-6.6, 35.2),(0, 35.2),(6.6, 35.2),(-8.8, 33),(0, 33),(8.8, 33),(-11, 30.8),(0, 30.8),(11, 30.8),(-13.2, 28.6),(0, 28.6),(13.2, 28.6),(-15.4, 26.4),(0, 26.4),(15.4, 26.4),(-17.6, 24.2),(0, 24.2),(17.6, 24.2),(-19.8, 22),(0, 22),(19.8, 22),(-22, 19.8),(0, 19.8),(22, 19.8),(-24.2, 17.6),(0, 17.6),(24.2, 17.6),(-26.4, 15.4),(0, 15.4),(26.4, 15.4),(-28.6, 13.2),(0, 13.2),(28.6, 13.2),(-30.8, 11),(0, 11),(30.8, 11),(-33, 8.8),(0, 8.8),(33, 8.8),(-35.2, 6.6),(0, 6.6),(35.2, 6.6),(-37.4, 4.4),(0, 4.4),(37.4, 4.4),(-39.6, 2.2),(0, 2.2),(39.6, 2.2),(-39.6, 0),(-37.4, 0),(-35.2, 0),(-33, 0),(-30.8, 0),(-28.6, 0),(-26.4, 0),(-24.2, 0),(-22, 0),(-19.8, 0),(-17.6, 0),(-15.4, 0),(-13.2, 0),(-11, 0),(-8.8, 0),(-6.6, 0),(-4.4, 0),(-2.2, 0),(0, 0),(2.2, 0),(4.4, 0),(6.6, 0),(8.8, 0),(11, 0),(13.2, 0),(15.4, 0),(17.6, 0),(19.8, 0),(22, 0),(24.2, 0),(26.4, 0),(28.6, 0),(30.8, 0),(33, 0),(35.2, 0),(37.4, 0),(39.6, 0),(-39.6, -2.2),(0, -2.2),(39.6, -2.2),(-37.4, -4.4),(0, -4.4),(37.4, -4.4),(-35.2, -6.6),(0, -6.6),(35.2, -6.6),(-33, -8.8),(0, -8.8),(33, -8.8),(-30.8, -11),(0, -11),(30.8, -11),(-28.6, -13.2),(0, -13.2),(28.6, -13.2),(-26.4, -15.4),(0, -15.4),(26.4, -15.4),(-24.2, -17.6),(0, -17.6),(24.2, -17.6),(-22, -19.8),(0, -19.8),(22, -19.8),(-19.8, -22),(0, -22),(19.8, -22),(-17.6, -24.2),(0, -24.2),(17.6, -24.2),(-15.4, -26.4),(0, -26.4),(15.4, -26.4),(-13.2, -28.6),(0, -28.6),(13.2, -28.6),(-11, -30.8),(0, -30.8),(11, -30.8),(-8.8, -33),(0, -33),(8.8, -33),(-6.6, -35.2),(0, -35.2),(6.6, -35.2),(-4.4, -37.4),(0, -37.4),(4.4, -37.4),(-2.2, -39.6),(0, -39.6),(2.2, -39.6)] mrfp1_points = [(-26.4, 26.4),(-24.2, 26.4),(-22, 26.4),(-19.8, 26.4),(-17.6, 26.4),(-13.2, 26.4),(-11, 26.4),(-8.8, 26.4),(-6.6, 26.4),(-4.4, 26.4),(-2.2, 26.4),(2.2, 26.4),(4.4, 26.4),(6.6, 26.4),(8.8, 26.4),(11, 26.4),(13.2, 26.4),(17.6, 26.4),(19.8, 26.4),(22, 26.4),(24.2, 26.4),(26.4, 26.4),(-26.4, 24.2),(-24.2, 24.2),(24.2, 24.2),(26.4, 24.2),(-26.4, 22),(-22, 22),(22, 22),(26.4, 22),(-26.4, 19.8),(-19.8, 19.8),(19.8, 19.8),(26.4, 19.8),(-26.4, 17.6),(-17.6, 17.6),(17.6, 17.6),(26.4, 17.6),(-15.4, 15.4),(15.4, 15.4),(-26.4, 13.2),(-13.2, 13.2),(13.2, 13.2),(26.4, 13.2),(-26.4, 11),(-11, 11),(11, 11),(26.4, 11),(-26.4, 8.8),(-8.8, 8.8),(8.8, 8.8),(26.4, 8.8),(-26.4, 6.6),(-6.6, 6.6),(6.6, 6.6),(26.4, 6.6),(-26.4, 4.4),(-4.4, 4.4),(4.4, 4.4),(26.4, 4.4),(-26.4, 2.2),(-2.2, 2.2),(2.2, 2.2),(26.4, 2.2),(-26.4, -2.2),(-2.2, -2.2),(2.2, -2.2),(26.4, -2.2),(-26.4, -4.4),(-4.4, -4.4),(4.4, -4.4),(26.4, -4.4),(-26.4, -6.6),(-6.6, -6.6),(6.6, -6.6),(26.4, -6.6),(-26.4, -8.8),(-8.8, -8.8),(8.8, -8.8),(26.4, -8.8),(-26.4, -11),(-11, -11),(11, -11),(26.4, -11),(-26.4, -13.2),(-13.2, -13.2),(13.2, -13.2),(26.4, -13.2),(-15.4, -15.4),(15.4, -15.4),(-26.4, -17.6),(-17.6, -17.6),(17.6, -17.6),(26.4, -17.6),(-26.4, -19.8),(-19.8, -19.8),(19.8, -19.8),(26.4, -19.8),(-26.4, -22),(-22, -22),(22, -22),(26.4, -22),(-26.4, -24.2),(-24.2, -24.2),(24.2, -24.2),(26.4, -24.2),(-26.4, -26.4),(-24.2, -26.4),(-22, -26.4),(-19.8, -26.4),(-17.6, -26.4),(-13.2, -26.4),(-11, -26.4),(-8.8, -26.4),(-6.6, -26.4),(-4.4, -26.4),(-2.2, -26.4),(2.2, -26.4),(4.4, -26.4),(6.6, -26.4),(8.8, -26.4),(11, -26.4),(13.2, -26.4),(17.6, -26.4),(19.8, -26.4),(22, -26.4),(24.2, -26.4),(26.4, -26.4)] #Process lists into a single dictionary for code modularity sfgfp_points.sort() mrfp1_points.sort() all_dots = { 'Green': sfgfp_points, 'Red': mrfp1_points } #For each color, pick up tip once for color in all_dots: pipette_20ul.pick_up_tip() for i in range(len(all_dots[color])): if i%15==0: pipette_20ul.aspirate(min(15, len(all_dots[color])-i), location_of_color(color)) dispense_and_detach(pipette_20ul, 1, center_location.move(types.Point(x=all_dots[color][i][0], y=all_dots[color][i][1]))) pipette_20ul.drop_tip()

  • Week 4 Lab Protein Design Part I

    Disclaimer There was no lab component for week 4’s homework.

  • Week 5 Lab Protein Design Part II

    Disclaimer There was no lab component in week 5

  • Week 6 Lab: Gibson Assembly

    Disclaimer Please find my labwork under the homework submission for Week 6

  • Week 7 Lab: Neuromorphic Circuits

    Please find my lab submission under my homework entry for week 7

  • Week 9 Lab: Cell-Free Systems

  • Week 10 Lab: Mass Spectrometry

  • Week 11 Lab: Cloud Lab

  • Week 12 Lab: Bioproduction

Subsections of Labs

Week 1 Lab: Pipetting

Lab

As a remote committed listener, I don’t have lab access to practise pipetting

Week 2 Lab: DNA Gel Art

Disclaimer

As a remote committed listener, I don’t have access to equipment to carry the DNA digest and electrophoresis out.

Week 3 Lab Opentrons Art

Disclaimer

I submitted my Opentrons .ipynb in fulfilment of the lab component.

https://colab.research.google.com/drive/12QWy9XQPNYZR-H8hs9YzWnw9YsxsSDH3?usp=sharing

from opentrons import types

metadata = {    # see https://docs.opentrons.com/v2/tutorial.html#tutorial-metadata
    'author': 'shrimay_saikia',
    'protocolName': 'green_red_diamonds',
    'description': 'Creates a criss-crossed diamond pattern',
    'source': 'HTGAA 2026 Opentrons Lab',
    'apiLevel': '2.20'
}

##############################################################################
###   Robot deck setup constants - don't change these
##############################################################################

TIP_RACK_DECK_SLOT = 9
COLORS_DECK_SLOT = 6
AGAR_DECK_SLOT = 5
PIPETTE_STARTING_TIP_WELL = 'A1'

well_colors = {
    'A1' : 'Red',
    'B1' : 'Green',
    'C1' : 'Orange'
}


def run(protocol):
  ##############################################################################
  ###   Load labware, modules and pipettes
  ##############################################################################

  # Tips
  tips_20ul = protocol.load_labware('opentrons_96_tiprack_20ul', TIP_RACK_DECK_SLOT, 'Opentrons 20uL Tips')

  # Pipettes
  pipette_20ul = protocol.load_instrument("p20_single_gen2", "right", [tips_20ul])

  # Modules
  temperature_module = protocol.load_module('temperature module gen2', COLORS_DECK_SLOT)

  # Temperature Module Plate
  temperature_plate = temperature_module.load_labware('opentrons_96_aluminumblock_generic_pcr_strip_200ul',
                                                      'Cold Plate')
  # Choose where to take the colors from
  color_plate = temperature_plate

  # Agar Plate
  agar_plate = protocol.load_labware('htgaa_agar_plate', AGAR_DECK_SLOT, 'Agar Plate')  ## TA MUST CALIBRATE EACH PLATE!
  # Get the top-center of the plate, make sure the plate was calibrated before running this
  center_location = agar_plate['A1'].top()

  pipette_20ul.starting_tip = tips_20ul.well(PIPETTE_STARTING_TIP_WELL)

  ##############################################################################
  ###   Patterning
  ##############################################################################

  ###
  ### Helper functions for this lab
  ###

  # pass this e.g. 'Red' and get back a Location which can be passed to aspirate()
  def location_of_color(color_string):
    for well,color in well_colors.items():
      if color.lower() == color_string.lower():
        return color_plate[well]
    raise ValueError(f"No well found with color {color_string}")

  # For this lab, instead of calling pipette.dispense(1, loc) use this: dispense_and_detach(pipette, 1, loc)
  def dispense_and_detach(pipette, volume, location):
      """
      Move laterally 5mm above the plate (to avoid smearing a drop); then drop down to the plate,
      dispense, move back up 5mm to detach drop, and stay high to be ready for next lateral move.
      5mm because a 4uL drop is 2mm diameter; and a 2deg tilt in the agar pour is >3mm difference across a plate.
      """
      assert(isinstance(volume, (int, float)))
      above_location = location.move(types.Point(z=location.point.z + 5))  # 5mm above
      pipette.move_to(above_location)       # Go to 5mm above the dispensing location
      pipette.dispense(volume, location)    # Go straight downwards and dispense
      pipette.move_to(above_location)       # Go straight up to detach drop and stay high

  ###
  ### YOUR CODE HERE to create your design
  ###

  '''Algorithm Design: I use lazy logic instead of optimizing the travel path
  or doing streaks since I prioritize reliability over efficiency. With greater
  familiarity, I'll be more confident in optimizing for pattern art print times.
  '''

  #Pre-generated coordinate arrays
  sfgfp_points = [(-2.2, 39.6),(0, 39.6),(2.2, 39.6),(-4.4, 37.4),(0, 37.4),(4.4, 37.4),(-6.6, 35.2),(0, 35.2),(6.6, 35.2),(-8.8, 33),(0, 33),(8.8, 33),(-11, 30.8),(0, 30.8),(11, 30.8),(-13.2, 28.6),(0, 28.6),(13.2, 28.6),(-15.4, 26.4),(0, 26.4),(15.4, 26.4),(-17.6, 24.2),(0, 24.2),(17.6, 24.2),(-19.8, 22),(0, 22),(19.8, 22),(-22, 19.8),(0, 19.8),(22, 19.8),(-24.2, 17.6),(0, 17.6),(24.2, 17.6),(-26.4, 15.4),(0, 15.4),(26.4, 15.4),(-28.6, 13.2),(0, 13.2),(28.6, 13.2),(-30.8, 11),(0, 11),(30.8, 11),(-33, 8.8),(0, 8.8),(33, 8.8),(-35.2, 6.6),(0, 6.6),(35.2, 6.6),(-37.4, 4.4),(0, 4.4),(37.4, 4.4),(-39.6, 2.2),(0, 2.2),(39.6, 2.2),(-39.6, 0),(-37.4, 0),(-35.2, 0),(-33, 0),(-30.8, 0),(-28.6, 0),(-26.4, 0),(-24.2, 0),(-22, 0),(-19.8, 0),(-17.6, 0),(-15.4, 0),(-13.2, 0),(-11, 0),(-8.8, 0),(-6.6, 0),(-4.4, 0),(-2.2, 0),(0, 0),(2.2, 0),(4.4, 0),(6.6, 0),(8.8, 0),(11, 0),(13.2, 0),(15.4, 0),(17.6, 0),(19.8, 0),(22, 0),(24.2, 0),(26.4, 0),(28.6, 0),(30.8, 0),(33, 0),(35.2, 0),(37.4, 0),(39.6, 0),(-39.6, -2.2),(0, -2.2),(39.6, -2.2),(-37.4, -4.4),(0, -4.4),(37.4, -4.4),(-35.2, -6.6),(0, -6.6),(35.2, -6.6),(-33, -8.8),(0, -8.8),(33, -8.8),(-30.8, -11),(0, -11),(30.8, -11),(-28.6, -13.2),(0, -13.2),(28.6, -13.2),(-26.4, -15.4),(0, -15.4),(26.4, -15.4),(-24.2, -17.6),(0, -17.6),(24.2, -17.6),(-22, -19.8),(0, -19.8),(22, -19.8),(-19.8, -22),(0, -22),(19.8, -22),(-17.6, -24.2),(0, -24.2),(17.6, -24.2),(-15.4, -26.4),(0, -26.4),(15.4, -26.4),(-13.2, -28.6),(0, -28.6),(13.2, -28.6),(-11, -30.8),(0, -30.8),(11, -30.8),(-8.8, -33),(0, -33),(8.8, -33),(-6.6, -35.2),(0, -35.2),(6.6, -35.2),(-4.4, -37.4),(0, -37.4),(4.4, -37.4),(-2.2, -39.6),(0, -39.6),(2.2, -39.6)]
  mrfp1_points = [(-26.4, 26.4),(-24.2, 26.4),(-22, 26.4),(-19.8, 26.4),(-17.6, 26.4),(-13.2, 26.4),(-11, 26.4),(-8.8, 26.4),(-6.6, 26.4),(-4.4, 26.4),(-2.2, 26.4),(2.2, 26.4),(4.4, 26.4),(6.6, 26.4),(8.8, 26.4),(11, 26.4),(13.2, 26.4),(17.6, 26.4),(19.8, 26.4),(22, 26.4),(24.2, 26.4),(26.4, 26.4),(-26.4, 24.2),(-24.2, 24.2),(24.2, 24.2),(26.4, 24.2),(-26.4, 22),(-22, 22),(22, 22),(26.4, 22),(-26.4, 19.8),(-19.8, 19.8),(19.8, 19.8),(26.4, 19.8),(-26.4, 17.6),(-17.6, 17.6),(17.6, 17.6),(26.4, 17.6),(-15.4, 15.4),(15.4, 15.4),(-26.4, 13.2),(-13.2, 13.2),(13.2, 13.2),(26.4, 13.2),(-26.4, 11),(-11, 11),(11, 11),(26.4, 11),(-26.4, 8.8),(-8.8, 8.8),(8.8, 8.8),(26.4, 8.8),(-26.4, 6.6),(-6.6, 6.6),(6.6, 6.6),(26.4, 6.6),(-26.4, 4.4),(-4.4, 4.4),(4.4, 4.4),(26.4, 4.4),(-26.4, 2.2),(-2.2, 2.2),(2.2, 2.2),(26.4, 2.2),(-26.4, -2.2),(-2.2, -2.2),(2.2, -2.2),(26.4, -2.2),(-26.4, -4.4),(-4.4, -4.4),(4.4, -4.4),(26.4, -4.4),(-26.4, -6.6),(-6.6, -6.6),(6.6, -6.6),(26.4, -6.6),(-26.4, -8.8),(-8.8, -8.8),(8.8, -8.8),(26.4, -8.8),(-26.4, -11),(-11, -11),(11, -11),(26.4, -11),(-26.4, -13.2),(-13.2, -13.2),(13.2, -13.2),(26.4, -13.2),(-15.4, -15.4),(15.4, -15.4),(-26.4, -17.6),(-17.6, -17.6),(17.6, -17.6),(26.4, -17.6),(-26.4, -19.8),(-19.8, -19.8),(19.8, -19.8),(26.4, -19.8),(-26.4, -22),(-22, -22),(22, -22),(26.4, -22),(-26.4, -24.2),(-24.2, -24.2),(24.2, -24.2),(26.4, -24.2),(-26.4, -26.4),(-24.2, -26.4),(-22, -26.4),(-19.8, -26.4),(-17.6, -26.4),(-13.2, -26.4),(-11, -26.4),(-8.8, -26.4),(-6.6, -26.4),(-4.4, -26.4),(-2.2, -26.4),(2.2, -26.4),(4.4, -26.4),(6.6, -26.4),(8.8, -26.4),(11, -26.4),(13.2, -26.4),(17.6, -26.4),(19.8, -26.4),(22, -26.4),(24.2, -26.4),(26.4, -26.4)]

  #Process lists into a single dictionary for code modularity
  sfgfp_points.sort()
  mrfp1_points.sort()
  all_dots = {
      'Green': sfgfp_points,
      'Red': mrfp1_points
  }

  #For each color, pick up tip once
  for color in all_dots:
    pipette_20ul.pick_up_tip()
    for i in range(len(all_dots[color])):
      if i%15==0:
        pipette_20ul.aspirate(min(15, len(all_dots[color])-i), location_of_color(color))
      dispense_and_detach(pipette_20ul, 1, center_location.move(types.Point(x=all_dots[color][i][0], y=all_dots[color][i][1])))
    pipette_20ul.drop_tip()

Week 4 Lab Protein Design Part I

Disclaimer

There was no lab component for week 4’s homework.

Week 5 Lab Protein Design Part II

Disclaimer

There was no lab component in week 5

Week 6 Lab: Gibson Assembly

Disclaimer

Please find my labwork under the homework submission for Week 6

Week 7 Lab: Neuromorphic Circuits

Please find my lab submission under my homework entry for week 7

Week 9 Lab: Cell-Free Systems

Week 10 Lab: Mass Spectrometry

Week 11 Lab: Cloud Lab

Week 12 Lab: Bioproduction

Projects

Final projects:

  • SoilBuddy Gemini AI-Generated in response to prompt [1] 1 Abstract As an expansive substitute to manual geochemical sampling, and cheap complement to existing agritech workflows, SoilBuddy is synbio’s answer to the need for real-time soil health monitoring in humanity’s quest to end world hunger. SoilBuddy captures key metrics such as oxygenation, pH and macronutrient levels through an authentically biological chassis, and conveys actionable insights through naturally-occurring reporter systems. SoilBuddy scales naturally over the space of a farm while implementing safety switches which prevent ecological leakage and facilitate regulatory compliance.

Subsections of Projects

Group Final Project

cover image cover image

Individual Final Project

SoilBuddy

Gemini AI-Generated in response to prompt [1] Gemini AI-Generated in response to prompt [1] Gemini AI-Generated in response to prompt [1]

1 Abstract

As an expansive substitute to manual geochemical sampling, and cheap complement to existing agritech workflows, SoilBuddy is synbio’s answer to the need for real-time soil health monitoring in humanity’s quest to end world hunger. SoilBuddy captures key metrics such as oxygenation, pH and macronutrient levels through an authentically biological chassis, and conveys actionable insights through naturally-occurring reporter systems. SoilBuddy scales naturally over the space of a farm while implementing safety switches which prevent ecological leakage and facilitate regulatory compliance.

The key contribution of the project is a demonstration of safety-first persistent microbiome monitoring and regulation. Specifically, within the confines of HTGAA, I will be designing and verifying the function of an AND genetic circuit in E. coli to express GFP if and only if local bacterial cell density is high (~chemiluminescence threshold) and external pH is excessively high (>pH 7).

In broad strokes, this will be achieved through Genetic circuit design and simulation on Asimov Kernel; Cassette design on Benchling; Heat-shock transformation; and ultimately triplicate verification of fluorescence against -ve controls using OpenTrons.

Due to my limitations as a remote committed listener, I will be focusing on the first segment of the project: the design and verification of my gene cassette.

2 Project Aims

The first aim of my final project is to design and verify the function of an AND genetic circuit in E. coli to express GFP if and only if local bacterial cell density is high (~chemiluminescence threshold) and external pH is excessively high (>pH 7). This will be achieved through the utilization of Asimov Kernel for genetic circuit design and simulation; Cassette design on Benchling; Heat-shock transformation in competent E. coli, and ultimately triplicate verification of fluorescence in response to the AND condition and AND condition only using OpenTrons.

The next steps in the development of SoilBuddy will be the incorporation of several more reporter systems orthogonal to the GFP to test for different soil conditions such as oxygenation and macronutrient levels, as well as optimization studies to calibrate the quorum sensing bioswitch. A stretch goal would be the incorporation of signaling pathways which indicate microbiome health, and the secretion of prebiotics / phages which regulate biotic diversity and abundance.

In the long term, we hope to replace harmful chemical fertilizers in commercial agriculture and insure the supply of food against fluctuations in fertilizer supply through a solution that scales naturally over the space of a farm while implementing safety switches which prevent ecological leakage and facilitate regulatory compliance.

3 Background

The first publication by Zhang et. al., 2025 describes the realization of a multi-channel bioelectronic E. coli-based sensor that utilizes multiplexing to sense multiple heavy metals and ions in soil solution. However, a key limitation is that the research group’s biosensor relies on microelectronic readout to generate human-interpretable signals, which can’t scale cheaply over the area of a commercial farm.

The second publication by Jansson et. al, 2023 describes current approaches towards soil microbiome curation and explores the possibility of community gene editing and isolate application on large scales to supplant or enhance the action of conventional chemical fertilizers. However, this solution is neither safe from a biocontainment perspective, nor sustainable since constant reapplications of isolate would be required.

Crucially SoilBuddy addresses both of these issues. Firstly, it utilizes an all-biological chassis that is reproducible, allowing it to scale organically without the reapplication of SoilBuddy treatment and in a cost-efficient manner. Secondly, the biosafety switch within SoilBuddy, together with its encapsulation within a single bacterium cell, allows for a higher degree of biocontainment and protection from ecological contamination.

In 2026, commercial agriculture produces enough food to meet the caloric needs of all humans on Earth, yet, frictions in production and trade limit the geographies in which food can be grown, and subsequently where it is distributed. At the same time, the vendor lock-in of commercial fertilizer suppliers both chains commercial farmers to inefficient modes of food distribution and introduces supply chain risks especially in a time of global trade uncertainty (Eg uncertain petroleum supplies driving up the price of nitrogenous fertilizer). Existing bioremediation options don’t scale well to commercial farms and across biomes. SoilBuddy solves all this and more using the power of bioengineering: it replicates in the soil, thus solving issues with the flows of power and money in the global agriculture industry; it supplants commercial fertilizers that have to be constantly reapplied, and provides inherent biocontainment through its AND switch.

While I was inspired by the four tenets of biomedical ethics, I reckoned the most important goals relevant to SoilBuddy are Non-Maleficence and Justice. Given the echoes of the GMO debate from earlier in the century, and the proliferative capacity of bacterial systems, prioritizing safeguards against ecological contamination are crucial for governing our bacteria-based platform. At the same time, given the long history of agricultural intervention being wielded as a political tool to harm access to food and development, it’s crucial that we prioritize justice in the administration of SoilBuddy to ensure its applications prove to be a tool for good.

Goal 1: Non-Maleficence

In the context of SoilBuddy, a commitment to non-maleficence - articulated in the credos “first, do no harm” - involves a rejection of utilitarian logic to instead foreground safeguards against proliferation and mitigation of unintended consequences before the launch of SoilBuddy.

1.1: Counter-Proliferation

SoilBuddy must be governed to prevent runaway proliferation in wild ecosystems and spillover events should be minimized as far as possible.

1.2: Mitigation

Before applying SoilBuddy, practitioners in the SoilBuddy ecosystem must enact measures that mitigate the harm caused by both foreseen unintended consequences (ie. known risks of biotech in agriculture per se, such as gene contamination) as well as unforeseen unintended consequences (ie. put in place inherent safeguards or plans of action to manage unknown unknowns).

Goal 2: Justice

In the context of SoilBuddy, our construction of justice pertains to its distribution and development into perpetuity – I mean to open-source soil health.

2.1: Material Equity

Governance should focus on ensuring geographic and socioeconomic equity in access to the materiel of SoilBuddy, administering its distribution on the basis that food ought to be a human right, in line with the UN’s SDGs.

2.2: IP Equity

Governance should guard against the privatization of developments on SoilBuddy as a platform, recognizing that, again, access to food as a human right contributes to the common good of the species. Insomuch as SoilBuddy will start off open-source, its derivative art should also be accessible to all.

4 Experimental Design

Designing DNA relevant to your final project + Code Include specific methods/tools/technologies/biological concepts for each part of the final project and analysis This section will be used to determine whether the experiments are well designed, feasible, and likely to succeed in testing your hypothesis Often this section is broken into discrete tasks/sub-aims For each experiment and/or analysis, include a description of your expected results If possible, include figure(s) that visually shows a broad workflow of your project or a specific aspect of your experimental plan Reminder: All HTGAA projects must include some DNA design! Make sure this form is submitted.

5 Results & Quantitative Expectations

As a remote committed listener, I decided to focus on the in silico portions of my project: designing the genetic circuit using Asimov Kernel and implementing the gene cassette using Benchling.

Write down a detailed protocol of how you validated this aspect of your final project. (Numbered list or paragraph is fine)

I used Asimov Kernel (ie. in silico gene circuit simulation), Benchling (ie. in silico DNA design), OpenTrons (ie. lab automation technologies) and heat shock treatment (ie. heat-shock based bacterial transformation)

Asimov Kernel Gene Casette

Challenge 1 Challenge 2 Challenge 3 Challenge 4

6 Additional Information

  1. List all references cited in this assignment
  • [1] As an expansive substitute to manual geochemical sampling, and cheap complement to existing agritech workflows, SoilBuddy is synthetic biology’s answer to the need for real-time soil health monitoring in humanity’s quest to end world hunger. SoilBuddy captures key metrics such as oxygenation, pH and macronutrient levels through an authentically biological chassis, and conveys actionable insights through naturally-occurring reporter systems. SoilBuddy scales naturally over the space of a farm while implementing safety switches which prevent ecological leakage and facilitate regulatory compliance.

The key contribution of the project is a demonstration of safety-first persistent microbiome monitoring and regulation. Specifically, within the confines of HTGAA, I will be designing and verifying the function of an AND genetic circuit in E. coli to express GFP if and only if local bacterial cell density is high (~chemiluminescence threshold) and external pH is excessively high (>pH 7).

  1. Create a supply list and budget for your project
  • Benchling Genetic Cassette Order - $400
  • OpenTrons Flex Robot Timeslot - $25 equivalent (assuming ~10,000hr Minimum Mean Time Between Failures)
  • Competent E. coli (eg O157:H7 E. coli) - $200
  • Heat-shock treatment reagents and labware (eg recovery medium, bain marie, stopwatch, micropipette, LB medium w/ kanamycin, elliptical shaker) - $200
  • 0.1M HCl (aq), DI water, LB Broth - $50 equivalent
  • OD Spectrophotometer, Cuvettes - Included with OpenTron Flex

$875 Total