First, describe a biological engineering application or tool you want to develop and why. This could be inspired by an idea for your HTGAA class project and/or something for which you are already doing in your research, or something you are just curious about. I have worked with the concept of CA before within design and 3d space generative making through creating tools for generating patterns and environments, so it was really fascinating to see it being brought up during class. So, for my idea I’d like to merge my previous digital experience with CA and synthetic biology tooling in a form of a computer aided design tool for spatial synthetic biology
Post-Lab Questions Find and describe a published paper that utilizes the Opentrons or an automation tool to achieve novel biological applications.
https://www.nature.com/articles/s41598-024-64938-0
This study by Norton-Baker et al. (2024) used an Opentrons OT-2 liquid-handling tool to efficiently characterise a large number of proteins. They also described a generalizable pipeline for high-throughput protein purification using small-scale expression in E. coli and an affordable liquid-handling robot. As a result, the automation significantly increased throughput, reduced manual labour, and improved consistency across samples, demonstrating how accessible robotics can accelerate biological research workflows. It also allowed to confirm the validity of previous findings.
Subsections of Homework
Week 1 HW: Principles and Practices
First, describe a biological engineering application or tool you want to develop and why. This could be inspired by an idea for your HTGAA class project and/or something for which you are already doing in your research, or something you are just curious about.
I have worked with the concept of CA before within design and 3d space generative making through creating tools for generating patterns and environments, so it was really fascinating to see it being brought up during class. So, for my idea I’d like to merge my previous digital experience with CA and synthetic biology tooling in a form of a computer aided design tool for spatial synthetic biology
Next, describe one or more governance/policy goals related to ensuring that this application or tool contributes to an “ethical” future, like ensuring non-malfeasance (preventing harm). Break big goals down into two or more specific sub-goals.
Ensuring biosafety:
a) Possibility of the prediction of biological behaviour
b) Testable behaviour (not just false confidence in whatever is happening, both for a and b!)
c) safety protocols built in within the ux/ui of the software
d) training provided
Transparency whilst preventing harm:
a) Maintenance of accountability over the created projects (as in not fully automated)
b) Responsible use
c) (Ideally!) some sort of encouragement of socially beneficial applications
Next, describe at least three different potential governance “actions” by considering the four aspects below (Purpose, Design, Assumptions, Risks of Failure & “Success”). Try to outline a mix of actions (e.g. a new requirement/rule, incentive, or technical strategy) pursued by different “actors” (e.g. academic researchers, companies, federal regulators, law enforcement, etc). Draw upon your existing knowledge and a little additional digging, and feel free to use analogies to other domains (e.g. 3D printing, drones, financial systems, etc.).
Purpose: What is done now and what changes are you proposing?
Design: What is needed to make it “work”? (including the actor(s) involved - who must opt-in, fund, approve, or implement, etc)
Assumptions: What could you have wrong (incorrect assumptions, uncertainties)?
Risks of Failure & “Success”: How might this fail, including any unintended consequences of the “success” of your proposed actions?
Next, score (from 1-3 with, 1 as the best, or n/a) each of your governance actions against your rubric of policy goals. The following is one framework but feel free to make your own:
sp|P42212|GFP_AEQVI Green fluorescent protein OS=Aequorea victoria OX=6100 GN=GFP PE=1 SV=1
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPT
LVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDT
LVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQ
LADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
3.2 Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.
reverse translation of sp|P42212|GFP_AEQVI Green fluorescent protein OS=Aequorea victoria OX=6100 GN=GFP PE=1 SV=1 to a 714 base sequence of consensus codons.
atgwsnaarggngargarytnttyacnggngtngtnccnathytngtngarytngayggn
gaygtnaayggncayaarttywsngtnwsnggngarggngarggngaygcnacntayggn
aarytnacnytnaarttyathtgyacnacnggnaarytnccngtnccntggccnacnytn
gtnacnacnttywsntayggngtncartgyttywsnmgntayccngaycayatgaarcar
caygayttyttyaarwsngcnatgccngarggntaygtncargarmgnacnathttytty
aargaygayggnaaytayaaracnmgngcngargtnaarttygarggngayacnytngtn
aaymgnathgarytnaarggnathgayttyaargargayggnaayathytnggncayaar
ytngartayaaytayaaywsncayaaygtntayathatggcngayaarcaraaraayggn
athaargtnaayttyaarathmgncayaayathgargayggnwsngtncarytngcngay
caytaycarcaraayacnccnathggngayggnccngtnytnytnccngayaaycaytay
ytnwsnacncarwsngcnytnwsnaargayccnaaygaraarmgngaycayatggtnytn
ytngarttygtnacngcngcnggnathacncayggnatggaygarytntayaar
ATGAGCAAAGGCGAAGAACTGTTTACCGGCGTGGTGCCGATTCTGGTGGAACTGGATGGCGATGTGAATGGCCATAAATTTAGCGTGAGCGGCGAAGGTGAAGGCGATGCGACCTATGGCAAACTGACCCTGAAATTTATCTGCACCACCGGTAAACTGCCGGTGCCGTGGCCGACCCTGGTGACCACCTTCAGCTACGGCGTGCAGTGTTTTAGCCGCTACCCGGATCATATGAAACAGCATGATTTTTTTAAAAGCGCGATGCCGGAAGGCTATGTGCAGGAACGCACCATTTTTTTCAAAGATGATGGCAATTACAAAACCCGTGCCGAAGTGAAATTCGAAGGCGATACCCTGGTGAATCGCATTGAACTGAAAGGCATTGATTTTAAAGAAGATGGTAACATTCTGGGCCACAAACTGGAATACAACTATAACAGCCATAACGTGTACATTATGGCGGATAAACAGAAAAATGGCATTAAAGTGAACTTTAAAATTCGCCATAACATTGAAGATGGCTCAGTGCAGCTGGCGGATCACTATCAGCAGAACACCCCGATTGGCGATGGCCCGGTTCTGCTGCCGGATAACCACTATCTGAGCACCCAGAGCGCGCTGTCGAAAGATCCGAACGAAAAACGCGATCACATGGTGCTGCTGGAATTTGTGACCGCCGCGGGCATCACCCATGGTATGGATGAACTGTATAAA
Avoid cleavage sites of restriction enzymes:
BbsI BsaI
It’s done to get a more reliable and consistent protein expression!
I chose Escherichia coli K-12 substr. MG1655 because it’s standard and saf to work with + GFP expression is well established within it
3.4
If it’s a cell-dependent method the DNA sequence can be transcribed and translated into my protein through these steps: 1. Transformation 2.Transcription 3.Translation 4.Protein Folding 5.Fluorescence
Afterwards in Twist I got a bunch of errors when importing as when I was making a sequence a copy pasted an article “a"into it as it was a part of it. It is also visible here as 931 is not divisible by 3
fixed version!>
how it works>
(i) What DNA would you want to sequence (e.g., read) and why?
So far some sort of plasmids encoding CA-based pattern formation circuits in bacterial populations to be able to design patterns with them for the final project tool
(ii) In lecture, a variety of sequencing technologies were mentioned. What technology or technologies would you use to perform sequencing on your DNA and why?
Probably something like Illumina as it is pretty commonly used which means it will be easier to find
5.2 DNA Write
(i) What DNA would you want to synthesize (e.g., write) and why?
GFP-based circuits so I could prototype programmable living pattern systems
(ii) What technology or technologies would you use to perform this DNA synthesis and why?
PCR or Gibson assembly to do precise construction of my custom genetic circuit
And then in terms of computer based tech Benchling and Twist
5.3 DNA Edit
(i) What DNA would you want to edit and why?
So far based on my research for this project E. coli K-12 MG1655as it is safe, well-documented, accessible and also works amazing with my project
(ii) What technology or technologies would you use to perform these DNA edits and why?
I’m not fully sure what’s possible to use for the projects yet but if I can CRISPR-Cas9 as it can precisely edit genetic circuits
Week 3 HW: Principles and Practices
Post-Lab Questions
Find and describe a published paper that utilizes the Opentrons or an automation tool to achieve novel biological applications.
This study by Norton-Baker et al. (2024) used an Opentrons OT-2 liquid-handling tool to efficiently characterise a large number of proteins. They also described a generalizable pipeline for high-throughput protein purification using small-scale expression in E. coli and an affordable liquid-handling robot. As a result, the automation significantly increased throughput, reduced manual labour, and improved consistency across samples, demonstrating how accessible robotics can accelerate biological research workflows. It also allowed to confirm the validity of previous findings.
On a separate note, I really enjoyed their explanation for using the tool :
“Therefore, we aimed to develop a protocol using the OT-2 to provide a low-cost option for the purification and analysis of enzymes, or other proteins, making high-throughput studies more accessible to a broader range of research laboratories. Beyond increasing efficiency, this automation-assisted approach reduces the labor burden on researchers and lowers the risk of repetitive use injuries.”"
Write a description about what you intend to do with automation tools for your final project. You may include example pseudocode, Python scripts, 3D printed holders, a plan for how to use Ginkgo Nebula, and more. You may reference this week’s recitation slide deck for lab automation details.
For my final project, I plan on using Opentrons to support a design, then build, test and learn pipeline for programmable living CA.
Things to do:
build libraries of sender receiver circuits with a range of parameters (I’ve done a similar thing with chi.bio before so should be straightforward). I’d also like to see how I can integrate it within the pre existing lab environment (Airtable) to get more transparent data for the future
Go through the process of general screening of spatial rule variants in plates to test pattern formation under different genetic and environmental conditions, depending on available options
In the later stages. use Cloud lab integration (e.g., Ginkgo Nebula) to scale, run large combinatorial libraries, and feed results back into the CA simulation engine for model fine tunning
All in all, this automation will increase reproducibility, enable systematic exploration of rule space, and accelerate the feedback loop between digital design and wet-lab experimentation.
I would also like to explore more of the idea using Ginkgo’s cloud lab (Nebula) to run large combinatorial libraries of CA rule variants. That would allow me to test hundreds of spatial rule configurations and feed experimental results back into the simulation engine!
