Week 1 HW: Principles and Practices

• Living Modified Organism(LMO) Cotton Textiles That Maintain Hygiene and Emit Pleasant Scents

  This application envisions a cotton-based textile integrated with genetically engineered microorganisms that are designed to function stably on the fabric surface. These microorganisms would metabolize organic compounds derived from human sweat and skin debris—such as fatty acids, ammonia, and keratin degradation byproducts—thereby maintaining hygiene and reducing odor formation.

  Unlike conventional approaches that rely on antimicrobial chemicals or synthetic fragrances, this system would operate as an engineered living material, in which biological activity is deliberately programmed to occur only within a non-natural environment (the textile itself). Conventional perfumes and detergents repeatedly introduce chemically stable, exogenous compounds that may unintentionally interfere with human endocrine systems or disrupt the skin microbiome through persistent and non-selective exposure.

  In contrast, genetically engineered microorganisms can be designed to activate only in specific physiological contexts and to simultaneously regulate both the production and degradation of fragrance-related compounds, thereby reducing the structural risks associated with continuous, indiscriminate chemical exposure. However, this approach also introduces ethical, safety, and governance challenges related to long-term human contact, environmental release, and biological containment.

• Governance and Policy Goals for Living Cotton Textiles in KR :: “To Ensure Biosafety and Biosecurity”

  a) Prevent disruption of the human skin microbiome

  b) Minimize risks of unintended environmental dissemination

  c) Ensure users are fully informed that the product contains living, engineered organisms

{ref.} *ref1. https://www.nifs.go.kr/portal/pcon0000260/systa/actionConts.do

{ref.} *ref2. https://www.kdca.go.kr/kdca/3469/subview.do

option 1) Technical Containment via Textile-Dependent Microbial Design

Purpose:

Biosafety guidance tends to be general (prevent acute harm, prevent release), without microbiome-specific containment requirements for long-duration skin contact consumer products. Thus, require microbiome-protective technical containment for living textiles. Engineered microbes must be textile-restricted in survival, localization, and activity, and demonstrably non-colonizing to skin.

Design:

Self-limiting activity circuit

1. Fail-safe kill switch triggered off-textile
2. Localization constraint (stay on fiber, not on skin)

Actors:

1. Developers (design + testing)
2. Independent labs/IRB-like review bodies (protocol audit)
3. Regulators/standards bodies

Risks of Failure and “Success”:

1. Failure could result in unintended persistence or adaptation
2. Even successful containment may create long-term, poorly understood human–microbe interactions

{ref.}The Skin Microbiome: Current Techniques, Challenges, and Future Directions *https://pmc.ncbi.nlm.nih.gov/articles/PMC10223452/

option 2) Mandatory Environmental Impact Assessment for Synthetic Biology Applications (LMOs)

Purpose:

In addition to general biosafety guidelines(합성생물학 육성 방안, 2025. 3. 11.), require application-specific assessment of impacts on the realease of living cotton textiles products intended for prolonged skin contact.

Introduce a mandatory, application-specific Environmental Impact Assessment (EIA) for LMOs, to proactively evaluate environmental risks unique to engineered biological systems, in addition to compliance with existing chemical regulations.

{ref.} 합성생물학 육성 방안 (Ministry of Science and ICT 회부 2024. 9. 11. 상정 2024. 11. 20. 처리 2025. 3. 11.) *https://opinion.lawmaking.go.kr/gcom/nsmLmSts/out/2203884/detailRP

Design:

Require an Environmental Impact Assessment prior to deployment for synthetic biology applications with potential environmental exposure

1. Environmental persistence and degradation pathways
2. Potential spread beyond intended containment
3. Interaction with natural ecosystems and microbial communities

Actors:

1. Developers in Academia/Industry (conduct and submit EIA)
2. Korea Disease Control and Prevention Agency (KDCA) / Ministry of Science and ICT (MSIT)
3. Environmental and chemical safety authorities

Risks of Failure and “Success”:

1. EIA may become a procedural formality without capturing dynamic biological risks
2. Increased compliance burden may disadvantage smaller research groups or startups
3. Insufficient data to assess long-term ecological effects

option 3) User-Centered Governance Through Labeling and Disclosure

Purpose:

Consumers are often unaware of the biological mechanisms underlying novel products (esp. GMO/LMO). This option prioritizes transparency and informed consent.

Design:

Clear labeling would indicate the presence of engineered microorganisms, describe their function, and provide guidance for use and disposal.

Actors:

1. Manufacturers
2. Consumer protection authorities

Assumptions:

Users will engage with and understand disclosed information

Risks of Failure and “Success”:

1. Information overload may lead to disregard
2. Transparency may unintentionally provoke public anxiety or resistance

Drawing on the scoring results, Option 1—technical containment through precisely engineered microbial circuits—emerges as the most feasible and effective governance priority.

It consistently scores highest in preventing biosecurity, laboratory, and environmental incidents while minimizing costs and avoiding unnecessary constraints on research. By embedding safety directly into genetic and circuit-level design, this approach addresses risks at their source rather than relying on external oversight or post hoc responses.

Although it offers limited capacity for incident response, this reflects a deliberate and ethically preferable trade-off; systems designed to fail safely reduce the need for downstream intervention. While this strategy assumes long-term stability of engineered circuits and involves uncertainty around evolutionary dynamics, it provides a practical foundation that can later be complemented by regulatory review and transparency measures, making it the most realistic starting point for governing synthetic biology applications with close human and environmental interfaces.

…ethical concerns that arose: GMO라는 용어나 개념은 음식과 관련이 있어서인지 매우 친숙하게 느껴졌는데, 미생물을 유전적으로 변형한 LMO라는 개념은 처음 알게 되었다. 또한, 유전자변형미생물의 환경에 대한 영향은 더욱 판단하기 어려울 것으로 보여져서, 앞으로 합성생물학 제품들이 개발됨에 따라 많은 규제와 이슈들이 있을 것으로 생각된다.

Week 2 HW: DNA Read, Write and Edit

Part 0: Basics of Gel Electrophoresis

#S.S: 부트캠프와 Wk2 수업을 들은 후, 과제를 확인했지만 정확한 개념 정리가 안되어 있어서 뭘 진행하는지 이해하기 어려웠다. 따라서 ChatGPT를 활용, it became clearer once I understood the concept of restriction enzyme(molecular scissors) and gel electrophoresis(DNA size filter).

  Prompt: "restriction enzyme biology 와 gel electrophoresis에 대해서 아주 간단히 설명해줘"
  를 통해 다음과 같은 답변을 얻었다.
  
  1. Restriction enzyme (제한효소) biology
  
  제한효소는 특정한 DNA 염기서열을 인식해서 그 지점을 자르는 효소입니다.
  원래는 박테리아의 방어 시스템으로, 침입한 바이러스 DNA를 잘라 파괴합니다.
  각 효소는 고유한 인식 서열(예: GAATTC)을 가지며, 그 위치에서 DNA를 정확히 절단합니다.
  이 특성 덕분에 분자생물학에서는 DNA를 원하는 조각으로 자르는 도구로 사용됩니다.
  
  2. Gel electrophoresis (겔 전기영동)
  겔 전기영동은 DNA 조각을 크기별로 분리하는 실험 방법입니다.
  DNA는 음전하를 띠므로 전기를 걸면 양극 방향으로 이동합니다.
  작은 DNA 조각일수록 겔 속을 더 빨리, 더 멀리 이동합니다.
  결과적으로 DNA 조각들이 밴드 형태로 나타나며, 크기를 비교·확인할 수 있습니다.
  
  One-line summary
  -Restriction enzymes: molecular scissors that cut DNA at specific sequences
  -Gel electrophoresis: a method to separate DNA fragments by size

Part 1: Benchling & In-silico Gel Art

#S.S: Benchling is such a cool platform that we can edit DNA in-silico. I uploaded ‘Lambda DNA.txt’ and managed digest by choosing each enzyme that cuts DNA strand. My initial thought was to see the ladder that each enzyme makes to decide which figure/shape I’d like on my artwork, but the shown result were not a single bar but of multiple layers. — at this stage, I have no idea how to compose an gel art.

===

#S.S: Little update on my Gel Art, after attending a session from Designer Cells lab in Songdo, S. Korea.

Ana, one of our TAs, printed out the Gel Electrophoresis result for us, using an instant photo printer. The photo on the right bottom. It also is a sticker !!!

So, my first ever wetlab experience started with how to use pipettes. Next, we moved on to the main dish, how to perform gel electrophoresis.

1. mix TAE and agarose(powder) and the solution would be microwaved until it is clear, which means it is completely dissolved.
2. I missed the reasons- to add 1uL of SYBR Safe DNA stain, and ChatGPT explains as below:
3. Place the comb(or we can put them later-it depends your way of doing it-just avoid forming bubbles) and pour the agarose gel.
4. When the gel is solidified enough, remove the comb(which generated wells) and start loading the wells with your DNA stands.

There were 4 different sized DNA strands (200bp, 700bp, 2.3kb, 5kb) ready for us, thanks to one of our TAs, Hyunseo.

I designed my gel art saying “Hi”, but the result is shown rather like “HI”, which still, luckily conveys the intended meaning ;D Hyunseo guessed 5kb and 2.3kb might gone bad? and failed to show on our Gel.

I am presenting my artwork again below just to show off.

The most challenging part of wet lab was actually doing the math and figuring out volumn units. I would refer the summary from ChatGPT for my future references.

Basic Units and Calculations in Biology

1️⃣ Volume Units (Metric System)

All volume units are based on powers of 10.

• 1 L (liter) = base unit
• 1 mL = 10⁻³ L
• 1 µL = 10⁻⁶ L
• 1 nL = 10⁻⁹ L

Key rule: Each step (milli → micro → nano) differs by 1000×.

Examples:

• 1 mL = 1000 µL
• 1 µL = 1000 nL

2️⃣ Mole (mol)

A mole measures the amount of substance.

1 mol = 6.022 × 10²³ molecules (Avogadro’s number)

It is simply a very large counting unit for atoms or molecules.

3️⃣ Molarity (M)

Molarity is concentration.

[ M = \frac{\text{moles}}{\text{liters}} ]

Example: 1 M solution = 1 mole dissolved in 1 liter.

Important:

• mol = amount
• M = concentration

4️⃣ Dilution Formula

[ C_1 V_1 = C_2 V_2 ]

Used to prepare diluted solutions from a concentrated stock.

Example: To make 100 mL of 1 M solution from 10 M stock:

[ (10M)V_1 = (1M)(100mL) ]

V₁ = 10 mL

5️⃣ Key Takeaways

• milli, micro, nano differ by 1000× each step
• M means mol/L
• Most lab work uses µL volumes
• DNA amounts are often measured in ng (10⁻⁹ g)

Part 3: DNA Design Challenge

#S.S: now, this is going to be a fun exercise!

  3.1. Choose your protein : Fibronectin type III domain-containing protein 10
  3.2. Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.
  '>sp|F2Z333|FND10_HUMAN Fibronectin type III domain-containing protein 10 OS=Homo sapiens OX=9606 GN=FNDC10 PE=1 SV=1 MRAPPLLLLLAACAPPPCAAAAPTPPGWEPTPDAPWCPYKVLPEGPEAGGGRLCFRSPARGFRCQAPGCVLHAPAGRSLRASVLRNRSVLLQWRLAPAAARRVRAFALNCSWRGAYTRFPCERVLLGASCRDYLLPDVHDSVLYRLCLQPLPLRAGPAAAAPETPEPAECVEFTAEPAGMQDIVVAMTAVGGSICVMLVVICLLVAYITENLMRPALARPGLRRHP'

  '>reverse translation of sp|F2Z333|FND10_HUMAN Fibronectin type III domain-containing protein 10 OS=Homo sapiens OX=9606 GN=FNDC10 PE=1 SV=1  to a 678 base sequence of consensus codons.
    atgmgngcnccnccnytnytnytnytnytngcngcntgygcnccnccnccntgygcngcn
  gcngcnccnacnccnccnggntgggarccnacnccngaygcnccntggtgyccntayaar
  gtnytnccngarggnccngargcnggnggnggnmgnytntgyttymgnwsnccngcnmgn
  ggnttymgntgycargcnccnggntgygtnytncaygcnccngcnggnmgnwsnytnmgn
  gcnwsngtnytnmgnaaymgnwsngtnytnytncartggmgnytngcnccngcngcngcn
  mgnmgngtnmgngcnttygcnytnaaytgywsntggmgnggngcntayacnmgnttyccn
  tgygarmgngtnytnytnggngcnwsntgymgngaytayytnytnccngaygtncaygay
  wsngtnytntaymgnytntgyytncarccnytnccnytnmgngcnggnccngcngcngcn
  gcnccngaracnccngarccngcngartgygtngarttyacngcngarccngcnggnatg
  cargayathgtngtngcnatgacngcngtnggnggnwsnathtgygtnatgytngtngtn
  athtgyytnytngtngcntayathacngaraayytnatgmgnccngcnytngcnmgnccn
  ggnytnmgnmgncayccn'

  3.3. Codon optimization.
  The purpose of codon optimisation is to improve expression efficiency. It would not alter the encoded protein but it will redesign the DNA sequence to match a host organism.

  '>Improved DNA:
  ATGGGCCCCCTGTTCGCCCTGGCCCCCCCCGGCGCCCGCCCCCCCCCCGT     
  GGGCCCCCCCGAGCCCTGGTGCCTGAAGTTCCGCGGCCGCGCCGGCGGCC     
  TGCTGCCCCGCGTGGTGCAGCCCGGCGGCAGCGCCCGCGGCTGGCGCTAA     
  CGCTTCCACGGCTGCCCCCGCGCCGGCGGCCTGCTGATGTGGGGCGCCAA     
  CGTGCCCGGCGGCCTGGGCTGGGACATCCCCAGCCAGAGCCTGGTGGTGA     
  CCAGCTGGCGCCCCCGCGCCCCCGAGCCCGACCGCGACGGCGACTACGCC     
  ACCGCCGACGCCGAGTGCGTGCACGACGCCTGGGGCCTGGTGTGCGTGTA     
  CTGCTGCGCCAACACCAAGTACGGCCGCTGCGCCGGCGGCACC'

  {ref.} https://www.jcat.de/ --- codon optimisation tool, free online access

  
  3.4. You have a sequence! Now what?
  Using plasmid? The DNA could be used to produce protein.

  3.5. How does it work in nature/biological systems?

#S.S(3.1.): Firstly, I had to recognise the differences between ‘gene vs. protein’. From my understanding, the central dogma goes like this : DNA(gene) -> RNA(transcription) -> Protein(translation) The problem is I am not familiar with names of proteins, thus come up with a gene that I’d encountered in the past! – such as, PCSK9

* PCSK9 - proprotein convertase subtilisin/kexin type 9
{ref. NCBI} https://www.ncbi.nlm.nih.gov/datasets/gene/255738/#transcripts-and-proteins

There are PCSK9 inhibitors in the market that are precsribed to regulated high LDL-C level of Dyslipidemia or FH(Familial Hyperlipidemia). But, I wasn’t happy with the NCBI lists of protein accession (NP_777596.2, etc.) since I don’t understand what they mean. In UniProtKB, however, I came across an interesting name, ‘Adnectin’ - I was curious, why does it have a special name on it? It is a protein therapeutics, according to below resources, and naturally I decided to look into Human Fibronectin deeper.

{UniProt} {google} {PubMed. NCBI}

Part 5: DNA Read/Write/Edit

5.1 DNA Read

(i) What DNA would you want to sequence (e.g., read) and why? This could be DNA related to human health (e.g. genes related to disease research), environmental monitoring (e.g., sewage waste water, biodiversity analysis), and beyond (e.g. DNA data storage, biobank). I would like to sequence my own DNA, and especially check on the currently available cancer gene test.

(ii) In lecture, a variety of sequencing technologies were mentioned. What technology or technologies would you use to perform sequencing on your DNA and why?
Also answer the following questions:

1. Is your method first-, second- or third-generation or other? How so?

    NGS(second) method would fit for my own DNA read, since  it's fast enough and relatively cheaper that the third-gen method.
   

5.2 DNA Write

(i) What DNA would you want to synthesize (e.g., write) and why? These could be individual genes, clusters of genes or genetic circuits, whole genomes, and beyond. As described in class thus far, applications could range from therapeutics and drug discovery (e.g., mRNA vaccines and therapies) to novel biomaterials (e.g. structural proteins), to sensors (e.g., genetic circuits for sensing and responding to inflammation, environmental stimuli, etc.), to art (DNA origamis). If possible, include the specific genetic sequence(s) of what you would like to synthesize! You will have the opportunity to actually have Twist synthesize these DNA constructs! :)

I remember writing DNA of a bateriophage to used it as a therapeutic.

(ii) What technology or technologies would you use to perform this DNA synthesis and why?
Also answer the following questions:

1. What are the essential steps of your chosen sequencing methods?
2. What are the limitations of your sequencing method (if any) in terms of speed, accuracy, scalability?

5.3 DNA Edit

(i) What DNA would you want to edit and why? In class, George shared a variety of ways to edit the genes and genomes of humans and other organisms. Such DNA editing technologies have profound implications for human health, development, and even human longevity and human augmentation. DNA editing is also already commonly leveraged for flora and fauna, for example in nature conservation efforts, (animal/plant restoration, de-extinction), or in agriculture (e.g. plant breeding, nitrogen fixation). What kinds of edits might you want to make to DNA (e.g., human genomes and beyond) and why?

  I'm more interested in utilizing RNA than editing DNA form.

(ii) What technology or technologies would you use to perform these DNA edits and why?
Also answer the following questions:

1. How does your technology of choice edit DNA? What are the essential steps?
2. What preparation do you need to do (e.g. design steps) and what is the input (e.g. DNA template, enzymes, plasmids, primers, guides, cells) for the editing?
3. What are the limitations of your editing methods (if any) in terms of efficiency or precision?

Week 3 HW: Lab Automation

A group HW: Design cell-free RNA biosensors

RNA toehold switch가 작동하는 원리를 recitation에서 Ana가 설명해 주었는데, 나는 우선 mRNA가 단백질로 translation되는 기전을 이해하고나서 이런 biosensor의 기능을 이해할 수 있었다.

1. mRNA에 ribosome이 와서 결합한다. 찾아다닌다기 보다는 cell내에서 자유롭게 떠다니던 ribosome이 충돌하여 결합하는 것에 가깝다고. Eukaryotes의 경우는 rough endoplasmic reticulum(RER, 세포소기관organelle)에 거칠어 보이도록 ribosome들이 붙어있어서 단백질을 생산, 반면에 Prokaryotes, 즉, bacteria의 경우 ribosome은 free-floating 상태로만 cytoplasm(세포질)에 존재.

   • 요새 기본개념 학습에 도움을 받고 있는 biology podcast(https://podcasts.apple.com/kr/podcast/teach-me-biology/id1525760514?l=en-GB&i=1000486622621)의 기억을 떠올리면, Eukaryotes/animal cell에서 RER은 protein을 생산하고, smooth ER(w/o ribosome)은 lipid를 생산한다. free ribosome은 세포 내부에서 사용할 단백질을 생산한다고 한다. 추가로, mitochondria는 release energy & produce ATP. 그리고 risosome은 pathogen이나 dead cell, etc를 없애는 역할을 하는 것 같다.

2. mRNA에는 RBS(ribosome binding site)가 있어서 ribosome이 부착되고 번역을 시작할 수 있다. 이 RBS는 bacteria에서는 Shine–Dalgarno sequence라고 불린다고. 시작코돈 AUG 앞에 위치한다.

3. 하나 더 몰랐던 개념, RNA는 folding landscape, 동적으로 접혔다 풀렸다 하는 구조집합을 보이는데, toehold switch에 나온 hairpin 구조는 rna 염기 가닥이 서로 연결되지 않은 loop, 그리고 일부가 상보적으로 연결된 stem으로 구성된 loop-stem 구조이다. 모든 RNA가 이렇게 모양이 생긴건 아니고 염기서열에 따라서 동적인듯 하다. 그렇지만 박테리아는 비교적 mRNA 구조가 단순하므로 의도적으로 hairpin구조로 만들어서 활용하는 듯 하다.

4. Finally, toehold switch에서 hairpin구조의 RNA switch는 평소(off status) RBS(is hidden within stem)와 AUG를 가림으로써 ribosome의 접근을 막아서 protein translation을 막는다. When switched-on(target RNA가 접근 시, it will bind and zip-open the stem followed by strand displacement(헤어핀 붕괴), in the end, ribosome can start translation process.

   약간 이해가 안되었던 부분은 RNA가 지금 2종이 나온다는 거였는데, chatGPT에게 질문하려고 개념을 써보다 보니 얼추 아래와 같이 이해가 되었다.

   toehold switch는 bacteria의 RNA가 표현되기를 hairpin 구조를 취하도록 re-engineered it. hairpin 상태에 있다가, target RNA(외부의 phage같은 것들의 input 등)가 들어오면 protein을 만들도록 설계.

   ChapGPT의 도움을 받아 재정리해보면, Bacterial mRNA의 5’UTR (AUG가 붙은 앞쪽 부분으로 예상.)을 hairpin 구조로 합성한 것! (자연적으로 형성된 switch로 Riboswitch라는게 존재함)

#s.s: At this stage, I wondered what it means to be ‘cell-free’ and why it matters. Below is an examplary table from ChatGPT to help my understanding. It seems cell-free system could partially avoid GMO-regulatory risks or make things easier! (Which helps me narrow down the desired setting for my final project, i guess)

Brainstorming on RNA Biosensor, assisted by ChatGPT

1. Target AMR(Antimicrobial Resistance) gene

Development of resistance for antibiotics seemed like a major issue in the medical field. It is routinely tested in hospital already with AST (antimicrobial susceptibility testing). Also, molecular testing for AMR gene is performed as an early guidance. Thus, RNA biosensor have potential to be the fastest detection tool replacing the current molecular test in urgent scenarios, although it might lack precision compared to AST.

2. Microneedle patch for Vaccination

Could a biosensor detect humoral immunity after vaccine innoculation?
It is possible to check interstitial fluid (ISF) on one’s skin, but immunity is proved mostly by protein(as an antibody) and RNA sensor is not the best option to detect a vaccination result… so, I would dump this idea.

3. Virus RNA biosensor

   Back to the familiar idea that I was introduced from the class, which is the detection of RNA viruses. RNA is THE genetic material of a pathogene and the sensor have potential to complement or partially replace PCR. In addition, it would have significant societal value - high impact on public health.

So, I’m thinking “broad coronavirus biosensor” as a front-line detector.

#GPT: “Detecting viral RNA directly is important because The presence of viral RNA typically indicates an active infection, rather than past exposure or residual immunity.

In regarding Coronaviruses, related viruses such as SARS-CoV (2003) and MERS-CoV (2012) had already caused outbreaks and the coronavirus family was already known. However, SARS-CoV-2(COVID-19) was a newly emerged zoonotic virus that humans had not previously encountered at population scale. So COVID-19 was not created “from nothing,” but it represented a new spillover event of a genetically distinct virus within a known viral family.

Coronaviruses belong to the family Coronaviridae.

Within it are multiple genera:

• Alphacoronavirus
• Betacoronavirus (includes SARS-CoV, MERS-CoV, SARS-CoV-2)

If you design a biosensor targeting highly conserved regions (e.g., RdRp gene)

You could potentially detect:

• SARS-like coronaviruses
• MERS-like coronaviruses
• Related zoonotic betacoronaviruses

This is because the RNA-dependent RNA polymerase (RdRp) region is relatively conserved across coronaviruses.

So in principle:

A conserved-region RNA biosensor could detect the presence of a coronavirus even before it is classified as a new human pathogen.

Would it detect a completely new zoonotic spillover?

Scenario 1: Spillover from a closely related SARS-like bat CoV

• Likely detectable with a conserved-region sensor.

Scenario 2: Spillover from a distantly related coronavirus lineage

• Detection depends on how conserved the target region is.

Scenario 3: Spillover from a completely different viral family

• ❌ A coronavirus-targeted sensor would not detect it.

Technical Considerations to design a broad CoV biosensor,

Multi-sequence alignment across:

• Bat SARS-like CoVs
• Pangolin CoVs
• Human SARS-CoV
• SARS-CoV-2
• MERS-CoV

Identification of:

• Highly conserved 25–35 nt regions
• Structurally accessible regions
• Minimal mutation hotspots

Possibly:

• Degenerate base tolerance in design
• Multiplexed switches covering multiple conserved motifs

   — A biosensor targeting conserved coronavirus regions could potentially detect certain future zoonotic spillovers within the CoV family.

But:

  It would not detect unrelated viral families.
  It would not replace sequencing.
  It must be part of an integrated surveillance system.

Week 1 Lab: Pipetting

Individual Final Project

Group Final Project