Homework

Weekly homework submissions:

  • Week 1 HW: Principles and Practices

    9th February 2026

  • Week 2 HW: DNA Read, Write, & Edit

    Part 1: Benchling & In-silico Gel Art Part 3: DNA Design Challenge 3.1. Choose your protein. I chose the PETase enzyme protein from the bacterium species Ideonella sakaiensis (strain 201-F6). I chose this protein as it was discovered to be important in plastic degradation. Its plastic degradation capabilities means that it allows bioremediation by reducing plastic pollution and promoting a circular economy.

  • Week 3 HW: Lab Automation

    Assignment: Python Script for Opentrons Artwork — DUE BY YOUR LAB TIME! A Blooming Daisy Flower PINK, PURPLE & BLUE DESIGN! :) INITIAL DESIGN: Python documentation from opentrons import types metadata = { 'author': 'Tammy Sisodiya', 'protocolName': ' HTGAA Dazzling Daisy', 'description': 'A blooming Daisy flower in Purple, Pink, and Blue.', 'source': 'HTGAA 2026 Opentrons Lab', 'apiLevel': '2.20' } ############################################################################## ### Robot deck setup constants ############################################################################## TIP_RACK_DECK_SLOT = 9 COLORS_DECK_SLOT = 6 AGAR_DECK_SLOT = 5 PIPETTE_STARTING_TIP_WELL = 'A1' # UPDATED: Mapping the new lab colors to source wells well_colors = { 'A1' : 'Purple', 'B1' : 'Pink', 'C1' : 'Blue' } def run(protocol): # Tips tips_20ul = protocol.load_labware('opentrons_96_tiprack_20ul', TIP_RACK_DECK_SLOT, 'Opentrons 20uL Tips') # Pipettes pipette_20ul = protocol.load_instrument("p20_single_gen2", "right", [tips_20ul]) # Modules temperature_module = protocol.load_module('temperature module gen2', COLORS_DECK_SLOT) temperature_plate = temperature_module.load_labware('opentrons_96_aluminumblock_generic_pcr_strip_200ul', 'Cold Plate') color_plate = temperature_plate # Agar Plate agar_plate = protocol.load_labware('htgaa_agar_plate', AGAR_DECK_SLOT, 'Agar Plate') center_location = agar_plate['A1'].top() pipette_20ul.starting_tip = tips_20ul.well(PIPETTE_STARTING_TIP_WELL) # Helper Functions def location_of_color(color_string): for well,color in well_colors.items(): if color.lower() == color_string.lower(): return color_plate[well] raise ValueError(f"No well found with color {color_string}") def dispense_and_detach(pipette, volume, location): assert(isinstance(volume, (int, float))) above_location = location.move(types.Point(z=location.point.z + 5)) pipette.move_to(above_location) pipette.dispense(volume, location) pipette.move_to(above_location) ### YOUR DESIGN DATA ### sfgfp_points = [(-4.4, 26.4),(1.1, 26.4),(2.2, 26.4),(3.3, 26.4),(4.4, 26.4),(-6.6, 25.3),(-5.5, 25.3),(-4.4, 25.3),(-3.3, 25.3),(1.1, 25.3),(4.4, 25.3),(-12.1, 24.2),(-11, 24.2),(-9.9, 24.2),(-8.8, 24.2),(-7.7, 24.2),(-6.6, 24.2),(-2.2, 24.2),(0, 24.2),(4.4, 24.2),(-13.2, 23.1),(-12.1, 23.1),(-7.7, 23.1),(-6.6, 23.1),(-2.2, 23.1),(4.4, 23.1),(6.6, 23.1),(7.7, 23.1),(8.8, 23.1),(-13.2, 22),(-7.7, 22),(-6.6, 22),(-2.2, 22),(0, 22),(4.4, 22),(5.5, 22),(6.6, 22),(8.8, 22),(-13.2, 20.9),(-7.7, 20.9),(-2.2, 20.9),(3.3, 20.9),(4.4, 20.9),(9.9, 20.9),(-13.2, 19.8),(-7.7, 19.8),(-2.2, 19.8),(3.3, 19.8),(9.9, 19.8),(-13.2, 18.7),(-2.2, 18.7),(8.8, 18.7),(9.9, 18.7),(-13.2, 17.6),(-2.2, 17.6),(-1.1, 17.6),(8.8, 17.6),(-18.7, 16.5),(-17.6, 16.5),(-16.5, 16.5),(-15.4, 16.5),(-14.3, 16.5),(-12.1, 16.5),(-2.2, 16.5),(7.7, 16.5),(8.8, 16.5),(-20.9, 15.4),(-19.8, 15.4),(-18.7, 15.4),(-14.3, 15.4),(-13.2, 15.4),(-12.1, 15.4),(-2.2, 15.4),(-1.1, 15.4),(7.7, 15.4),(-20.9, 14.3),(-13.2, 14.3),(-12.1, 14.3),(-11, 14.3),(-3.3, 14.3),(-2.2, 14.3),(5.5, 14.3),(6.6, 14.3),(-20.9, 13.2),(-9.9, 13.2),(-8.8, 13.2),(-3.3, 13.2),(4.4, 13.2),(5.5, 13.2),(-20.9, 12.1),(-8.8, 12.1),(-7.7, 12.1),(-3.3, 12.1),(-2.2, 12.1),(2.2, 12.1),(3.3, 12.1),(5.5, 12.1),(6.6, 12.1),(7.7, 12.1),(8.8, 12.1),(9.9, 12.1),(11, 12.1),(-20.9, 11),(-19.8, 11),(-6.6, 11),(-5.5, 11),(-4.4, 11),(0, 11),(1.1, 11),(2.2, 11),(3.3, 11),(4.4, 11),(11, 11),(-19.8, 9.9),(-4.4, 9.9),(-3.3, 9.9),(-2.2, 9.9),(-1.1, 9.9),(0, 9.9),(11, 9.9),(-23.1, 8.8),(-22, 8.8),(-20.9, 8.8),(-19.8, 8.8),(-18.7, 8.8),(-17.6, 8.8),(-5.5, 8.8),(-4.4, 8.8),(-3.3, 8.8),(-2.2, 8.8),(-1.1, 8.8),(0, 8.8),(9.9, 8.8),(11, 8.8),(15.4, 8.8),(16.5, 8.8),(17.6, 8.8),(18.7, 8.8),(19.8, 8.8),(20.9, 8.8),(22, 8.8),(23.1, 8.8),(24.2, 8.8),(-23.1, 7.7),(-3.3, 7.7),(-1.1, 7.7),(0, 7.7),(1.1, 7.7),(2.2, 7.7),(8.8, 7.7),(9.9, 7.7),(14.3, 7.7),(15.4, 7.7),(16.5, 7.7),(20.9, 7.7),(22, 7.7),(24.2, 7.7),(-24.2, 6.6),(-23.1, 6.6),(-5.5, 6.6),(-4.4, 6.6),(-3.3, 6.6),(-2.2, 6.6),(1.1, 6.6),(2.2, 6.6),(7.7, 6.6),(8.8, 6.6),(9.9, 6.6),(11, 6.6),(12.1, 6.6),(13.2, 6.6),(14.3, 6.6),(16.5, 6.6),(19.8, 6.6),(20.9, 6.6),(23.1, 6.6),(-22, 5.5),(-9.9, 5.5),(-7.7, 5.5),(-6.6, 5.5),(-5.5, 5.5),(-4.4, 5.5),(-2.2, 5.5),(3.3, 5.5),(4.4, 5.5),(13.2, 5.5),(16.5, 5.5),(18.7, 5.5),(19.8, 5.5),(23.1, 5.5),(-20.9, 4.4),(-19.8, 4.4),(-18.7, 4.4),(-17.6, 4.4),(-16.5, 4.4),(-15.4, 4.4),(-14.3, 4.4),(-13.2, 4.4),(-12.1, 4.4),(-9.9, 4.4),(-8.8, 4.4),(-7.7, 4.4),(-2.2, 4.4),(4.4, 4.4),(5.5, 4.4),(6.6, 4.4),(13.2, 4.4),(16.5, 4.4),(17.6, 4.4),(18.7, 4.4),(23.1, 4.4),(-12.1, 3.3),(-11, 3.3),(-2.2, 3.3),(5.5, 3.3),(7.7, 3.3),(8.8, 3.3),(9.9, 3.3),(11, 3.3),(12.1, 3.3),(13.2, 3.3),(16.5, 3.3),(17.6, 3.3),(23.1, 3.3),(-13.2, 2.2),(-12.1, 2.2),(-2.2, 2.2),(6.6, 2.2),(9.9, 2.2),(16.5, 2.2),(17.6, 2.2),(18.7, 2.2),(19.8, 2.2),(20.9, 2.2),(22, 2.2),(-14.3, 1.1),(-2.2, 1.1),(7.7, 1.1),(9.9, 1.1),(11, 1.1),(15.4, 1.1),(16.5, 1.1),(22, 1.1),(-15.4, 0),(-14.3, 0),(-2.2, 0),(7.7, 0),(11, 0),(14.3, 0),(15.4, 0),(22, 0),(-15.4, -1.1),(-2.2, -1.1),(3.3, -1.1),(8.8, -1.1),(13.2, -1.1),(14.3, -1.1),(20.9, -1.1),(-15.4, -2.2),(-14.3, -2.2),(-13.2, -2.2),(-12.1, -2.2),(-8.8, -2.2),(-7.7, -2.2),(-6.6, -2.2),(-2.2, -2.2),(3.3, -2.2),(8.8, -2.2),(11, -2.2),(12.1, -2.2),(13.2, -2.2),(20.9, -2.2),(-14.3, -3.3),(-11, -3.3),(-8.8, -3.3),(-7.7, -3.3),(-6.6, -3.3),(-3.3, -3.3),(-2.2, -3.3),(3.3, -3.3),(4.4, -3.3),(8.8, -3.3),(11, -3.3),(19.8, -3.3),(20.9, -3.3),(-13.2, -4.4),(-12.1, -4.4),(-11, -4.4),(-8.8, -4.4),(-3.3, -4.4),(-2.2, -4.4),(4.4, -4.4),(5.5, -4.4),(6.6, -4.4),(7.7, -4.4),(8.8, -4.4),(13.2, -4.4),(19.8, -4.4),(-16.5, -5.5),(-15.4, -5.5),(-14.3, -5.5),(-13.2, -5.5),(-8.8, -5.5),(-4.4, -5.5),(-3.3, -5.5),(-2.2, -5.5),(4.4, -5.5),(14.3, -5.5),(15.4, -5.5),(16.5, -5.5),(18.7, -5.5),(19.8, -5.5),(-19.8, -6.6),(-18.7, -6.6),(-17.6, -6.6),(-16.5, -6.6),(-8.8, -6.6),(-4.4, -6.6),(-1.1, -6.6),(3.3, -6.6),(4.4, -6.6),(17.6, -6.6),(18.7, -6.6),(-23.1, -7.7),(-22, -7.7),(-20.9, -7.7),(-19.8, -7.7),(-17.6, -7.7),(-16.5, -7.7),(-15.4, -7.7),(-8.8, -7.7),(-7.7, -7.7),(-6.6, -7.7),(-5.5, -7.7),(-4.4, -7.7),(-3.3, -7.7),(-2.2, -7.7),(-1.1, -7.7),(0, -7.7),(2.2, -7.7),(3.3, -7.7),(16.5, -7.7),(17.6, -7.7),(-24.2, -8.8),(-23.1, -8.8),(-14.3, -8.8),(-13.2, -8.8),(-8.8, -8.8),(-7.7, -8.8),(-3.3, -8.8),(-2.2, -8.8),(0, -8.8),(1.1, -8.8),(2.2, -8.8),(3.3, -8.8),(5.5, -8.8),(14.3, -8.8),(15.4, -8.8),(16.5, -8.8),(-26.4, -9.9),(-25.3, -9.9),(-24.2, -9.9),(-12.1, -9.9),(-11, -9.9),(-9.9, -9.9),(-8.8, -9.9),(-3.3, -9.9),(0, -9.9),(7.7, -9.9),(8.8, -9.9),(11, -9.9),(12.1, -9.9),(13.2, -9.9),(-27.5, -11),(-26.4, -11),(-25.3, -11),(-24.2, -11),(-23.1, -11),(-22, -11),(-20.9, -11),(-19.8, -11),(-18.7, -11),(-17.6, -11),(-16.5, -11),(-15.4, -11),(-14.3, -11),(-13.2, -11),(-12.1, -11),(-11, -11),(-3.3, -11),(0, -11),(-28.6, -12.1),(-27.5, -12.1),(-19.8, -12.1),(-18.7, -12.1),(-17.6, -12.1),(-15.4, -12.1),(-12.1, -12.1),(-4.4, -12.1),(-3.3, -12.1),(-2.2, -12.1),(0, -12.1),(-28.6, -13.2),(-27.5, -13.2),(-20.9, -13.2),(-19.8, -13.2),(-12.1, -13.2),(-4.4, -13.2),(0, -13.2),(-26.4, -14.3),(-25.3, -14.3),(-13.2, -14.3),(-12.1, -14.3),(-5.5, -14.3),(-2.2, -14.3),(0, -14.3),(-23.1, -15.4),(-20.9, -15.4),(-19.8, -15.4),(-13.2, -15.4),(-8.8, -15.4),(-7.7, -15.4),(-6.6, -15.4),(-1.1, -15.4),(0, -15.4),(-18.7, -16.5),(-16.5, -16.5),(-15.4, -16.5),(-14.3, -16.5),(-13.2, -16.5),(-12.1, -16.5),(-9.9, -16.5),(-8.8, -16.5),(-2.2, -16.5),(0, -16.5),(-2.2, -17.6),(0, -17.6),(0, -18.7),(-1.1, -19.8),(1.1, -19.8),(-1.1, -20.9),(1.1, -20.9),(2.2, -20.9),(0, -22),(3.3, -22),(12.1, -22),(13.2, -22),(14.3, -22),(15.4, -22),(0, -23.1),(4.4, -23.1),(5.5, -23.1),(9.9, -23.1),(11, -23.1),(12.1, -23.1),(13.2, -23.1),(1.1, -24.2),(2.2, -24.2),(5.5, -24.2),(6.6, -24.2),(7.7, -24.2),(8.8, -24.2),(9.9, -24.2),(11, -24.2),(12.1, -24.2),(2.2, -25.3),(3.3, -25.3),(4.4, -25.3),(9.9, -25.3),(11, -25.3),(5.5, -26.4),(6.6, -26.4),(7.7, -26.4),(8.8, -26.4)] mrfp1_points = [(-15.4, 12.1),(-14.3, 12.1),(-14.3, 11),(-13.2, 11),(-12.1, 11)] mscarlet_i_points = [(-11, 20.9),(-9.9, 20.9),(-11, 19.8),(-9.9, 19.8),(-9.9, 18.7)] mko2_points = [(3.3, 18.7),(4.4, 18.7),(5.5, 18.7),(6.6, 18.7),(4.4, 17.6)] mjuniper_points = [(6.6, 9.9),(7.7, 9.9),(4.4, 8.8),(5.5, 8.8),(6.6, 8.8),(7.7, 8.8),(-6.6, 2.2),(-9.9, 1.1),(-8.8, 1.1),(-7.7, 1.1),(-6.6, 1.1)] electra2_points = [(1.1, 4.4),(1.1, 3.3),(1.1, 2.2),(1.1, 1.1)] # 2. UPDATED Design Mapping # Purple for the large petals, Pink for highlights, Blue for details. layers = [ ('Purple', sfgfp_points), ('Pink', mrfp1_points), ('Pink', mscarlet_i_points), ('Pink', mko2_points), ('Blue', mjuniper_points), ('Blue', electra2_points) ] # 3. Execution Loop drop_vol = 1.0 for color_name, points in layers: if not points: continue source_well = location_of_color(color_name) for i in range(0, len(points), 15): chunk = points[i:i + 15] pipette_20ul.pick_up_tip() aspirate_vol = (len(chunk) * drop_vol) + 2.0 if aspirate_vol > 20.0: aspirate_vol = 20.0 pipette_20ul.aspirate(aspirate_vol, source_well) for x, y in chunk: if (x2 + y2) < 1600: target_point = center_location.point + types.Point(x=x, y=y, z=0) target_loc = types.Location(target_point, None) dispense_and_detach(pipette_20ul, drop_vol, target_loc) # Return residual to source well top to avoid contamination if pipette_20ul.current_volume > 0: pipette_20ul.dispense(pipette_20ul.current_volume, source_well.top()) pipette_20ul.drop_tip() Post-Lab Questions — DUE BY START OF FEB 24 LECTURE

  • Week 4 HW: Protein Design Part I

    Part A. Conceptual Questions How many molecules of amino acids do you take with a piece of 500 grams of meat? (on average an amino acid is ~100 Daltons) 6.022 x10^23 molecules of amino acids. Why do humans eat beef but do not become a cow, eat fish but do not become fish? Humans obtain amino acids from the food they eat, it gets broken down and digested by the human, incorporated into human tissues and used for energy consuming, and leftover parts are excreted as normal.

  • Week 5 HW: Protein Design Part II

    Part 1: Generate Binders with PepMLM Changed 5th character from A to V. >sp|P00441|SOD1_HUMAN_A4V Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2 MATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTS AGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVV HEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ 2. Sequence 5 TKGNAGSRLACG WRGDDSVDFEGR 18.929941 Part 2: Evaluate Binders with AlphaFold3 Record the ipTM score and briefly describe where the peptide appears to bind. Does it localize near the N-terminus where A4V sits? Does it engage the β-barrel region or approach the dimer interface? Does it appear surface-bound or partially buried? Protein-peptide sequence 1: SSTLRLFAQLRR, ipTM = 0.55, pTM = 0.67 The low ipTM of 0.3 suggests the peptide is surface-bound, and is roughly associated with the outer beta barrel part. It is not buried and is situated on the exterior surface of the Alphafold model, and does not situate near the N-terminus where the A4V mutation sits.

  • Week 6 HW: Genetic Circuits Part I: Assembly Technologies

    Q1 What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose? Phusion DNA Polymerase which synthesises new DNA strands by adding nucleotides using the template during replication. It ensures high precision copying, editing and proofreading. Deoxynucleotides - dNTP consists of a deoxyribose sugar, a nitrogenous base (A, T, C, or G), and three phosphate groups. The DNA polymerase adds them to a growing DNA chain to form the new complementary strand. Reaction Buffer - creates a suitable chemical environment for the Phusion High-Fidelity DNA Polymerase for DNA synthesis. Regulates a stable pH, provides magnesium ions as a cofactor for catalytic activity, and contains important components to increase specificity, yield and high-fidelity performance. Magnesium Chloride - DNA polymerase which synthesises DNA, requires Mg2+ for DNA synthesis, as it is required for enzyme Catalytic Activity, in the active site to catalyze the formation of phosphodiester bonds between the 3′-OH of a primer and the phosphate group of a nucleotide. DMSO to increase G/C rich targets - additive which boosts denaturation of difficult or GC-rich targets. Q2 What are some factors that determine primer annealing temperature during PCR?

  • Week 7 HW: Genetic Circuits Part II: Neuromorphic Circuits

    Q1) What advantages do IANNs have over traditional genetic circuits, whose input/output behaviors are Boolean functions? IANNs can be rearranged, remodelled, or changed into a new form, layout, or function after their initial creation in comparison to boolean genetic circuits which are rigid/fixed, and its reconfiguring ability means it can be used for analytical devices integrating biological recognition elements (enzymes, microorganisms, antibodies) with transducers to detect bioavailable pollutants (microplastics, heavy metals) to check biotoxicity Less metabolic stress in cells with IANNs compared to boolean genetic circuits IANNs can do Complex pattern recognition and analog computation - IANNs can look at many variables like temperature, Wind Direction, Traffic Speed and Humidity and the logic derived from this is relationships and biological signatures for example, it is context aware and gives a probability based result (risk in percentage or category). This is the opposite for traditional genetic circuits, the same processing step is a conditional if/then statement, as Boolean circuits are limited to 2^n states. For example, if a city sensor receives an input that is “partly true” (e.g., moderate congestion but high humidity), a Boolean circuit may fail to trigger / provide an incorrect binary output.

  • Week 9 HW: Cell-free Systems

    Homework Part A: General and Lecturer-Specific Questions General homework questions [1] Explain the main advantages of cell-free protein synthesis over traditional in vivo methods, specifically in terms of flexibility and control over experimental variables. Name at least two cases where cell free expression is more beneficial than cell production. If we wanted to produce a toxic protein / protein deposits which are misfolded, non-functional, and often highly stable multi-molecular structures - restriction enzymes which cut and edit DNA, cytotoxic proteins (e.g. immune cell related molecules such as perforins which puncture cell membranes and granzymes which trigger cell apoptosis, both produced by NK cells), the cell free expression allows production without affecting cell viability in comparison to in vivo methods. Due to the barrier of cell membranes being removed in cell-free systems, labeled or unnatural amino acids can be put in the mix (of organelles like ribosomes) for targeted, specialised protein synthesis: for example in in vivo labeling for NMR or fluorescence studies. In in vivo methods, the cell system’s energy and resources can be divided between different organelles, whereas in CFS the energy and resources can solely be focused on making the target protein. You can do real time tracking of protein synthesis using spectrophotometry or other analytical methods in CFS due to the large, uncomplicated system comparatively to in vivo methods where the cell has many organelles. Conditions of the reaction can be controlled; variables such as temperature, redox potential and pH can be changed and finetuned without worrying about causing host death. Cloning and transformation steps are skipped, as we can use linear DNA or circular plasmid DNA directly. Two cases where CFS is beneficial over in vivo methods;

  • Week 10 HW: Advanced Imaging & Measurement Technology

    Homework: Final Project For your final project: Please identify at least one (ideally many) aspect(s) of your project that you will measure. It could be the mass or sequence of a protein, the presence, absence, or quantity of a biomarker, etc. I will use methods to check how effective a protein’s physical and chemical properties (stability, folding, binding) is of my redesigned receptor-binding domains across multiple key metrics: (1) I will measure binding affinity: the thermodynamic strength of the binding between my redesigned T7 tail fiber and the target P. aeruginosa surface receptors (e.g., OprF, PilA). (2) I will measure structural stability using the Root Mean Square Deviation (RMSD) of the polypeptide chain over time to ensure the redesign hasn’t introduced metastability and failure to adopt their native, functional conformation. (3) I will measure solubility and aggregation propensity - this will measure the likelihood of the protein remains soluble versus forming insoluble inclusion bodies during recombinant expression. (4) To ensure functional efficiency and biosafety/biosecurity compliance, I will measure Codon Adaptation Index (CAI) to ensure the elimination of regulated DNA sequences from restricted, highly pathogenic agents (e.g. Ebola, SARS-CoV-2, Anthrax).

  • Week 11 HW: Bioproduction & Cloud Labs

    Part A: The 1,536 Pixel Artwork Canvas | Collective Artwork (1) I didn’t manage to contribute to the artwork. (2) I liked the fact that every pixel removed / or placed directly influences a cell-free protein synthesis optimisation experiment, it makes the art feel alive and purposeful. A couple of suggestions and ideas I thought, instead of removing pixels to end the experiment, perhaps next year could feature a growth versus decay mechanic where different biological inputs (represented by different colours) compete for dominance on the plate. It would be interesting to have a secondary window showing a live feed or a time-lapse of the actual laboratory plate being manipulated by the cloud lab robots as we click, although the slider showing the bioart over time is incredible. To prevent griefing or to encourage rapid collaboration during peak hours, the cooldown could scale based on the complexity of the protein being synthesised in that specific quadrant.

  • Week 12 HW: Building Genomes

    Post Lab Questions | Mandatory for All Students (1) Which genes when transferred into E. coli will induce the production of lycopene and beta-carotene, respectively? While E. coli naturally possesses the MEP pathway to produce the precursors IPP and DMAPP, it lacks the downstream enzymes required to synthesize lycopene. To enable lycopene production, the following three genes are required: crtE: Encodes geranylgeranyl pyrophosphate (GGPP) synthase, crtB: Encodes phytoene synthase, crtI: Encodes phytoene desaturase