<Yanchen Shen> — HTGAA Spring 2026

cover image cover image

About me

Contact info

Homework

Labs

Projects

Subsections of <Yanchen Shen> — HTGAA Spring 2026

Homework

Weekly homework submissions:

  • Week 1 HW: Principles and Practices

    Governance and Ethical Framework for Astro-Moss and Bio-textiles.

  • Week 10 HW: ADVANCED IMAGING & MEASUREMENT TECHNOLOGY

    1. Final Project I will measure whether DNA stored on paper can be recovered and remain readable after storage. In Aim 0.5, the main measured output is the presence or absence of expected PCR bands from recovered DNA fragments. Fragment A is expected to produce a ~94 bp payload PCR product, and Fragment B is expected to produce a ~166 bp product. I measured this using endpoint PCR followed by 2% E-Gel EX agarose gel electrophoresis.
  • Week 11 HW: BIOPRODUCTION & CLOUD LABS

    A. Master Mix Component Analysis E. coli Lysate BL21 (DE3) Star Lysate: Provides the cellular machinery for transcription and translation, including ribosomes and T7 RNA polymerase. The “Star” mutation helps reduce mRNA degradation. Salts / Buffer Potassium Glutamate: Maintains ionic strength and supports ribosome activity. HEPES-KOH pH 7.5: Keeps the reaction at a stable pH. Magnesium Glutamate: Supplies magnesium ions needed for ribosomes and enzymes. Potassium Phosphate: Acts as a buffer and supports ATP regeneration.

  • Week 2: DNA Read, Write, & Edit

    DNA Design Challenge 3.1 Protein Choice I chose pHluorin (superecliptic pHluorin, SEP) because it makes pH changes visible as a clear signal. pH is a broadly meaningful indicator across scales: it can reflect cellular and bodily conditions (e.g., local acidity in compartments or stress-related microenvironments) and also environmental conditions (e.g., water/soil toxicity or chemical shifts). This makes SEP useful not only as a biosensing concept, but also as an interaction metaphor. Even small changes in conditions can switch what becomes visible.

  • Week 4 HW: PROTEIN DESIGN PART I

    Deinococcus radiodurans. Credit USU/Michael Daly Part B: Protein Analysis and Visualization 1. Briefly describe the protein you selected and why you selected it. I selected the protein from RCSB PDB: 4NOE, which is DdrB, a single-stranded DNA-binding protein from Deinococcus radiodurans (this entry is a protein–ssDNA complex). I chose it because D. radiodurans is well known for extreme radiation tolerance, and DdrB is directly connected to DNA damage response/repair, making it a relevant example for studying UV/radiation-associated protein function with an available 3D structure.

  • Week 6 HW: Genetic Circuits Part I

  • Week 7 HW: Genetic Circuits Part II

  • Week 9 HW: Cell Free Systems

Subsections of Homework

Week 1 HW: Principles and Practices

cover image cover image

Image credit: John Game via Wikimedia Commons

1. Bio-Engineering Application: Astro-Moss

Project Vision

I propose the development of Astro-Moss, a engineered strain of Physcomitrium patens designed for extreme environmental resilience. By leveraging the high genomic editability of moss, this project aims to create varieties capable of surviving extreme diurnal temperature fluctuations, high ionizing radiation, and desiccation.

Applications

  • Extraterrestrial Foundation: Serving as a primary “pioneer” vegetation for Martian habitats to build organic substrate for future crops.
  • Functional Bio-textiles: Extracting engineered cells or fibers to create “living” textiles for astronaut apparel that offer self-repairing properties and radiation shielding, contributing to long-term sustainability in space exploration.

2. Governance and Policy Goals

To ensure this application contributes to an ethical future, I have defined the following goals based on the framework of promoting constructive use while minimizing harm:

  • Goal 1: Ensure Biosafety and Security. Preventing the unintended release of engineered extremophiles into Earth’s ecosystems or the misuse of resilience genes.
    • Sub-goal 1.1: Biocontainment. Implement failsafes to ensure Astro-Moss cannot survive outside controlled habitats.
    • Sub-goal 1.2: Dual-use Oversight. Screen genetic sequences related to extreme resistance to prevent their use in enhancing harmful pathogens.
  • Goal 2: Promote Equity and Global Autonomy. Ensuring that the foundational tools for space colonization are not monopolized by a single entity.
    • Sub-goal 2.1: Open Standards. Establish international protocols for safety data sharing.
    • Sub-goal 2.2: Technology Access. Ensure community biolabs and international researchers can contribute to and benefit from the project.

3. Governance Actions Matrix

AspectAction 1: Technical BiocontainmentAction 2: DNA Synthesis ScreeningAction 3: Open-Source Safety Alliance
PurposeEngineering “kill-switches” or auxotrophy, dependency on lab-only nutrients.Mandatory screening of synthetic DNA orders.Voluntary international consortium to share safety protocols and risk assessments.
DesignActors: Academic researchers and firms. Must be integrated into the R&D phase.Actors: Commercial providers and federal regulators.Actors: International firms, NGOs, and UN.
AssumptionsAssumes mutation will not bypass the switch.Assumes use of regulated synthesis channels.Assumes safety over proprietary advantages.
RisksFailure: Evolution of bypass mechanisms. Success: May limit moss adaptability in genuine emergencies.Failure: Use of benchtop synthesizers. Success: Increases cost and time for R&D.Failure: Soft law without enforcement may be ignored. Success: Establishes a global culture of responsibility.

4. Detailed Scoring Matrix

Score: 1 (Best/Most effective) to 3 (Least effective/Most problematic)

Does the option:Option 1Option 2Option 3
Enhance Biosecurity
• By preventing incidents212
• By helping respond131
Foster Lab Safety
• By preventing incident121
• By helping respond1N/A1
Protect the environment
• By preventing incidents122
• By helping respond131
Other considerations
• Minimizing costs and burdens to stakeholders321
• Feasibility?213
• Not impede research321
• Promote constructive applications221

5. Prioritization, Recommendation, and Ethical Reflections

Target Audience: The United Nations Office for Outer Space Affairs (UNOOSA) and the International Space Exploration Coordination Group (ISECG).

Recommendation Strategy: I prioritize a Hybrid Governance Model that mandates Technical Biocontainment (Action 1) as a prerequisite for mission approval, supported by an International Open-Source Safety Alliance (Action 3) to manage global compliance, safety standards, and equity.

Justification based on Scoring: While DNA Screening (Action 2) provides an immediate defensive layer, our scoring matrix reveals its significant failure in Response and Equity. For a frontier technology like Astro-Moss, we cannot rely on blocking orders alone.

  • Action 1 is prioritized because it offers intrinsic safety; a biological kill-switch ensures that even if a containment breach occurs on Earth or a target planet, the organism’s impact is self-limiting.
  • Action 3 is essential to prevent the safety requirements of Action 1 from becoming a proprietary wall. By open-sourcing safety modules, we ensure that the Right to Explore remains equitable across all nations.

Ethical Trade-offs Considered:

  1. Safety vs. Adaptability: The most robust kill-switch inherently limits the moss’s ability to evolve and survive in truly unknown extraterrestrial variables. I am consciously trading off mission success probability for guaranteed planetary protection.
  2. Innovation Speed vs. Regulation: Mandatory international oversight through an Alliance will slow the deployment of Bio-textiles. However, the risk of a Forward Contamination event (accidentally destroying potential Martian microbial life) would set the entire field of synthetic biology back by decades due to the resulting ethical crisis and public outcry.

Assumptions and Uncertainties:

  • Assumption of Genetic Stability: This strategy assumes that the complex kill-switch will not be silenced by the high-radiation environments of space. If the mutation rate exceeds our containment design, the technical strategy fails.
  • Uncertainty of Extraterrestrial Interaction: We lack data on how engineered genes might interact with potential Martian life. This unknown unknown makes the Biological Footprint Audit (drawing from the DIYBio expert model) a critical necessity to ensure independent, peer-reviewed validation of every mission’s biocontainment integrity.

Week 2 Lecture Prep

Homework Questions from Professor Jacobson

Q1: Nature’s machinery for copying DNA is called polymerase. What is the error rate of polymerase? How does this compare to the length of the human genome. How does biology deal with that discrepancy?

Native DNA polymerase has a baseline error rate of approximately 10-7 to 10-8 per base pair. When combined with biological proofreading and mismatch repair mechanisms, the final error rate is reduced to about 10^-10. Given the human genome consists of 3.2 billion base pairs, these high fidelity repair systems ensure that fewer than one error occurs per replication cycle. Biology utilizes these multi layered verification systems to bridge the gap between high data volume and required synthesis accuracy.

Q2: How many different ways are there to code (DNA nucleotide code) for an average human protein? In practice what are some of the reasons that all of these different codes don’t work to code for the protein of interest?

For a protein of average length, the redundancy of the genetic code allows for over 10^190 different DNA sequence combinations. In practice, the vast majority of these sequences are non functional. Major constraints include codon usage bias leading to translation stalls, the formation of complex mRNA secondary structures that block ribosomal movement, and the accidental creation of regulatory motifs or splice signals that interfere with proper expression.


Homework Questions from Dr. LeProust

Q1: What’s the most commonly used method for oligo synthesis currently?

The most widely utilized method currently is phosphoramidite chemical synthesis.

Q2: Why is it difficult to make oligos longer than 200nt via direct synthesis?

The primary barrier is that the coupling efficiency of each synthesis step never reaches 100 percent. As the nucleotide chain grows, cumulative errors cause the final product yield to drop exponentially. This results in an accumulation of truncated sequences that make the target full length sequence extremely difficult to isolate.

Q3: Why can’t you make a 2000bp gene via direct oligo synthesis?

Direct chemical synthesis of a 2000bp gene results in a yield that is effectively zero. The standard industry approach involves synthesizing multiple shorter oligonucleotide fragments and then using enzymatic assembly techniques to stitch them into a complete gene.


Homework Questions from George Church

Q1: What are the 10 essential amino acids in all animals and how does this affect your view of the “Lysine Contingency”?

The ten essential amino acids for animals are phenylalanine, valine, threonine, tryptophan, isoleucine, methionine, histidine, arginine, leucine, and lysine.

Lysine contingency as a biological safety measure is fundamentally fragile. Since lysine is already a naturally essential amino acid for animals, engineering an organism to be unable to synthesize it merely replicates a natural state rather than adding a secure safeguard. In real world environments, engineered organisms can easily bypass this restraint by consuming lysine from common plants or animal tissues. Effective biocontainment should instead rely on synthetic dependencies not found in nature. An example is semantic containment where organisms require non canonical amino acids provided only in a controlled lab setting to ensure they cannot survive in the wild.

Week 10 HW: ADVANCED IMAGING & MEASUREMENT TECHNOLOGY

1. Final Project

I will measure whether DNA stored on paper can be recovered and remain readable after storage. In Aim 0.5, the main measured output is the presence or absence of expected PCR bands from recovered DNA fragments. Fragment A is expected to produce a ~94 bp payload PCR product, and Fragment B is expected to produce a ~166 bp product. I measured this using endpoint PCR followed by 2% E-Gel EX agarose gel electrophoresis.

I will also compare DNA recovered from APTMS-treated paper and untreated paper. In the current pilot, this comparison is qualitative: whether each condition produces the expected band. In future work, I would measure recovery more quantitatively using qPCR Ct values, digital PCR copy number, or fluorometric DNA quantification.

For the next stage of the project, I would measure whether recovered SspCA-encoding DNA can drive functional protein production in a cell-free expression system. This would include measuring SspCA protein expression, expected protein size, and carbonic anhydrase activity. Possible technologies include SDS-PAGE or Western blot for protein size and expression, fluorescence or colorimetric assays for enzyme activity, and DNA sequencing to confirm that recovered DNA remains sequence-correct.

Technologies used or proposed:

  • Endpoint PCR: tests whether recovered DNA remains amplifiable.
  • E-Gel EX agarose gel electrophoresis: visualizes expected DNA bands and confirms approximate amplicon size.
  • qPCR or digital PCR: future quantitative measurement of DNA recovery.
  • DNA sequencing: future verification of sequence integrity and encoded data.
  • Cell-free protein expression: tests whether recovered DNA can produce SspCA.
  • SDS-PAGE / Western blot: verifies protein expression and approximate size.
  • Carbonic anhydrase activity assay: measures whether produced SspCA remains functional.

2. Waters Part I

Q1:The sequence provided includes the eGFP core, an LE linker and a 6x-His purification tag. Calculated Molecular Weight: 27,988.97 Da

Q2:

  • Peak 1 (m/z_n): 875.4421

  • Peak 2 (m/z_n+1): 903.7148

  • z for each adjacent pair of peaks: the charge state for the 903.7 peak is 31+, and the 875.4 peak is 32+.

  • MW of the protein: 27,981.90 Da

  • Accuracy of the measurement: 252.6 ppm

Q3: No.

3. Waters Part II

Q1:

Denatured state: The protein unfolds because of heat or chemicals. More amino acids become exposed, so the protein gains more charges and shows lower m/z values.

Native state: The protein stays folded in its normal shape. Fewer amino acids are exposed, so the protein gains fewer charges and shows higher m/z values.

Q2:

Yes. The charge state is 10+. The isotope peaks are spaced by 0.1 m/z, and since spacing = 1/z, 0.1 means z = 10.

Week 11 HW: BIOPRODUCTION & CLOUD LABS

A. Master Mix Component Analysis

  1. E. coli Lysate

BL21 (DE3) Star Lysate: Provides the cellular machinery for transcription and translation, including ribosomes and T7 RNA polymerase. The “Star” mutation helps reduce mRNA degradation.

  1. Salts / Buffer

Potassium Glutamate: Maintains ionic strength and supports ribosome activity. HEPES-KOH pH 7.5: Keeps the reaction at a stable pH. Magnesium Glutamate: Supplies magnesium ions needed for ribosomes and enzymes. Potassium Phosphate: Acts as a buffer and supports ATP regeneration.

  1. Energy / Nucleotide System

Ribose & Glucose: Provide energy for ATP and GTP regeneration. AMP, CMP, GMP, UMP: Building blocks used to make RNA nucleotides for transcription. Guanine: Helps regenerate GTP through the salvage pathway.

  1. Translation Mix (Amino Acids)

17 Amino Acid Mix: Supplies amino acids for protein synthesis. Tyrosine: Added separately because it dissolves poorly. Cysteine: Added separately because it is reactive and easily oxidized.

  1. Additives & Backfill

Nicotinamide: Supports metabolic reactions by helping maintain NAD+/NADH cofactors. Nuclease Free Water: Brings the reaction to the correct volume without introducing nucleases.

B. Master Mix Component Analysis

The 1-hour PEP-NTP mix is designed for fast protein production using high-energy PEP and ready-made NTPs. The 20-hour NMP-Ribose-Glucose mix is designed for long-term production, using cheaper precursors and the lysate’s metabolism to slowly regenerate energy and nucleotides over time.

C. Planning the Global Experiment | Cell-Free Master Mix Design

Fluorescent Protein Properties

  • sfGFP: Folds quickly and reliably, so it gives strong fluorescence in many cell-free conditions.

  • mRFP1: Matures slowly, so fluorescence appears later than protein production.

  • mKO2: Very bright orange protein, but repeated reads may reduce signal through photobleaching.

  • mTurquoise2: Has high brightness, so it can be detected even at low protein yield.

  • mScarlet_I: Very bright red protein, but needs oxygen for chromophore maturation.

  • Electra2: Designed for fast maturation and stability, so it can track protein production quickly.

Hypothesis

  • Protein: mRFP1
  • Reagent adjustment: Increase magnesium glutamate slightly.
  • Hypothesis: Increasing magnesium glutamate will improve ribosome activity and translation efficiency, producing more mRFP1 over the 36-hour incubation. Because mRFP1 matures slowly, higher total protein production should lead to stronger final fluorescence after enough maturation time.

Week 2: DNA Read, Write, & Edit

DNA Design Challenge

3.1 Protein Choice

I chose pHluorin (superecliptic pHluorin, SEP) because it makes pH changes visible as a clear signal. pH is a broadly meaningful indicator across scales: it can reflect cellular and bodily conditions (e.g., local acidity in compartments or stress-related microenvironments) and also environmental conditions (e.g., water/soil toxicity or chemical shifts). This makes SEP useful not only as a biosensing concept, but also as an interaction metaphor. Even small changes in conditions can switch what becomes visible.

>AAS66682.1 superecliptic pHluorin [synthetic construct]
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQC
FSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHK
LEYNYNDHQVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLFTTSTLSKD
PNEKRDHMVLLEFVTAAGITHGMDELYK

3.2 Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.

To obtain the precise nucleotide sequence for superecliptic pHluorin (SEP), I performed a targeted search and retrieval process using the NCBI:

  1. Protein Identification: I accessed the official NCBI Protein record for superecliptic pHluorin (SEP) under accession number AAS66682.1.
  2. Nucleotide Record Location: On the protein record page, I utilized the “Nucleotide sequence from coding region” link found under the Related information sidebar. This link redirected me to the NCBI Nucleotide (nuccore) entry AY533296.1, titled “Synthetic construct superecliptic pHluorin mRNA, complete cds”.
  3. CDS Feature Selection: Within the nuccore page, I specifically identified the CDS (coding region) segment to isolate the exact sequence responsible for protein translation.
  4. FASTA Retrieval: I displayed the sequence in FASTA format (ensuring the header line starts with >) to maintain compatibility with downstream design tools.
  5. Sequence Capture: I copied the nucleotide CDS sequence (bases 1..717) as the foundational DNA template for the SEP protein.
>lcl|AY533296.1_cds_AAS66682.1_1 [protein=superecliptic pHluorin] [protein_id=AAS66682.1] [location=1..717] [gbkey=CDS]
ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATG
GGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAAACTTACCCTTAAATTTAT
TTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTTTAACTTATGGTGTTCAATGC
TTTTCAAGATACCCAGATCATATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTAC
AGGAAAGAACTATATTTTTCAAAGATGACGGGAACTACAAGACACGTGCTGAAGTCAAGTTTGAAGGTGA
TACCCTTGTTAATAGAATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACACAAA
TTGGAATACAACTATAACGATCACCAGGTGTACATCATGGCAGACAAACAAAAGAATGGAATCAAAGCTA
ACTTCAAAATTAGACACAACATTGAAGATGGAGGCGTTCAACTAGCAGACCATTATCAACAAAATACTCC
AATTGGCGATGGGCCCGTCCTTTTACCAGACAACCATTACCTGTTTACAACTTCTACTCTTTCGAAAGAT
CCCAACGAAAAGAGAGACCACATGGTCCTTCTTGAGTTTGTAACAGCTGCTGGGATTACACATGGCATGG
ATGAACTATACAAATAA
  • 3.2 & 3.3 Reverse Translation & Optimization: The sequence was reverse-translated and codon-optimized for E. coli expression to ensure high yield while avoiding Type IIs restriction sites (BsaI, BsmBI, BbsI).
  • DNA Sequence:

Prepare a Twist DNA Synthesis Order

I designed an expression cassette to be synthesized as a clonal gene.

  • Design Components: J23106 Promoter, B0034 RBS, Optimized sfGFP, 7xHis Tag, and B0015 Terminator.
  • Vector Selection: pTwist Amp High Copy. This circular backbone allows for direct transformation into E. coli, speeding up the experimental cycle by 1-2 weeks.
Benchling Design Benchling Design

Figure 1: Annotated sfGFP expression cassette designed in Benchling.


Part 5: DNA Read/Write/Edit

Inspired by Marina Otero Verzier’s theory, this documentation explores a move away from the Cartesian enclosure of traditional data centers. I propose using Engineered Moss as a living fabric and information archive for extraterrestrial exploration.

5.1 DNA Read: Material Entanglement

  • Technology: Nanopore Sequencing.
  • Vision: Reading the Moss. This transcends binary retrieval; it is an act of “touching a leaf” to listen to the archive. Nanopore allows us to decode how cosmic radiation and human interaction have “co-written” the DNA, creating a material entanglement where the building, the document, and the environment are one.

5.2 DNA Write: The Breathing Library

  • Technology: Enzymatic DNA Synthesis.
  • Vision: Encoding human collective memory into moss spores.
  • Theory: This breaks the “myth of endless growth.” Moss archives are non-hierarchical; as they flourish on alien regolith, they capture CO2 and produce oxygen. It is an architecture that “makes breath possible”—an archive that is both alive and gives life.

5.3 DNA Edit: Ontological Freedom

  • Technology: CRISPR/Cas9.
  • Vision: Editing moss for extreme desiccation and radiation tolerance.
  • Ethics: This edit is not an extractive tool for profit. We grant the moss ontological freedom to express its agency in a new world. It is an act of solidarity and cohabitation between species, allowing the “Data Forest” to germinate in the inconceivable futures of space.

Week 4 HW: PROTEIN DESIGN PART I

cover image cover image

Deinococcus radiodurans. Credit USU/Michael Daly


Part B: Protein Analysis and Visualization


1. Briefly describe the protein you selected and why you selected it.

I selected the protein from RCSB PDB: 4NOE, which is DdrB, a single-stranded DNA-binding protein from Deinococcus radiodurans (this entry is a protein–ssDNA complex). I chose it because D. radiodurans is well known for extreme radiation tolerance, and DdrB is directly connected to DNA damage response/repair, making it a relevant example for studying UV/radiation-associated protein function with an available 3D structure.

4noe 4noe 4noe 4noe


2. Identify the amino acid sequence of your protein.

FASTA Sequence

>4NOE_1|Chains A, B, C, D, E|Single-stranded DNA-binding protein DdrB|Deinococcus radiodurans (1299)
DPFTMLQIEFITDLGARVTVNVEHESRLLDVQRHYGRLGWTSGEIPSGGYQFPIENEADFDWSLIGARKWKSPEGEELVIHRGHAYRRRELEAVDSRKLKLPAAIKYSRGAKVSDPQHVREKADGDIEYVSLAIFRGGKRQERYAVPG
>4NOE_2|Chain F|5'-D(*TP*TP*GP*CP*GP*CP*TP*TP*GP*CP*GP*CP*TP*TP*GP*CP*GP*CP*TP*TP*GP*CP*GP*CP*TP*TP*GP*CP*GP*CP)-3'|
TTGCGCTTGCGCTTGCGCTTGCGCTTGCGC

2.1. How long is it? What is the most frequent amino acid?

Sequence Length(DdrB): 148 aa

2.2. How many protein sequence homologs are there for your protein?

BLAST Input:

>4NOE_1|Chains A, B, C, D, E|Single-stranded DNA-binding protein DdrB|Deinococcus radiodurans (1299)
DPFTMLQIEFITDLGARVTVNVEHESRLLDVQRHYGRLGWTSGEIPSGGYQFPIENEADFDWSLIGARKWKSPEGEELVIHRGHAYRRRELEAVDSRKLKLPAAIKYSRGAKVSDPQHVREKADGDIEYVSLAIFRGGKRQERYAVPG

I used UniProt BLAST with default settings and reported the number of hits as an estimate of sequence homologs (based on BLAST similarity/E-value criteria). 112 hits BLAST BLAST BLAST BLAST

2.3. Does your protein belong to any protein family?

PF12747 — DdrB-like protein (DdrB)


3. Identify the structure page of your protein in RCSB

3.1. When was the structure solved? Is it a good quality structure?

Deposited: 2013-11-19 

Released: 2015-05-20 

Resolution: 2.20 Å (2.20 Å < 2.70 Å, good quality)

3.2. Are there any other molecules in the solved structure apart from protein?

Yes.

Nucleic acid: 30-nt ssDNA (Crystal structure of DdrB bound to 30b ssDNA)

CALCIUM ION (CA)

3.3 Does your protein belong to any structure classification family?

RCSB Classification: DNA BINDING PROTEIN/DNA

ECOD family: DdrB

ECOD architecture: beta barrels


4. 3D molecule visualization

PyMOL-4NOE PyMOL-4NOE

4.1. Visualize the protein as “cartoon”, “ribbon” and “ball and stick”.

PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE

4.2.Color the protein by secondary structure. Does it have more helices or sheets?

helix: 189

sheet: 242

It has more β-sheets than α-helices.

PyMOL-4NOE PyMOL-4NOE

4.3. Color the protein by residue type. What can you tell about the distribution of hydrophobic vs hydrophilic residues?

Across the different views, hydrophilic residues (cyan) dominate and appear broadly distributed over the outer surface, especially along loops and exposed regions. Hydrophobic residues (orange) are more patchy and discontinuous, showing up as scattered stripes/spots across β-strands and some helical segments rather than forming one continuous hydrophobic face. Overall, the protein looks like a typical soluble complex: a largely hydrophilic exterior with localized hydrophobic patches that likely contribute to core stabilization and/or subunit–subunit interfaces.

PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE

4.4. Visualize the surface of the protein. Does it have any “holes” (aka binding pockets)?

Yes. The surface rendering shows a clear pore-like hole near the center that remains visible across angles. There are also multiple smaller grooves and depressions on the surface, which could be potential binding pockets.

PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE PyMOL-4NOE


Part C: Using ML-Based Protein Design Tools


C1. Protein Language Modeling

1. Deep Mutational Scans

a. Use ESM2 to generate an unsupervised deep mutational scan of your protein based on language model likelihoods.

Using ESM2’s unsupervised likelihood-based scan on DdrB, most single–amino-acid substitutions have relatively modest effects, but a few positions show strong outliers, suggesting that some residues are much more constrained than others.

ESM ESM ESM ESM ESM ESM

b. Can you explain any particular pattern? (choose a residue and a mutation that stands out)

One mutation that stands out is G74→C, which has the most unfavorable score (-3.74), indicating that position 74 is highly constrained and likely important for maintaining the protein’s stability/assembly. A strongly favorable outlier is Y34→L (+2.88).

2. Latent Space Analysis

In the latent space analysis section, the run failed with the error “ValueError: perplexity must be less than n_samples.”At that point the embedding array had shape (2, 320) (only two sequences were embedded), while the t-SNE settings used perplexity = 30, which requires a larger number of samples. As a result, the projection step did not complete and neighborhood interpretation was not possible in this run. Latent Space Analysis Latent Space Analysis

2. Protein Folding Folding a protein

1. Fold your protein with ESMFold. Do the predicted coordinates match your original structure?

I folded the DdrB sequence (length 148 aa) with ESMFold. The run completed with pTM = 0.204 and mean pLDDT = 34.332. These confidence metrics are low, so the predicted coordinates are not expected to reliably match the experimental PDB structure (4NOE), and any apparent similarity should be treated as uncertain.

3. Protein Generation Inverse-Folding a protein

Week 6 HW: Genetic Circuits Part I

cover image cover image

Image credit: Phase Genomics

Part 1. DNA Assembly

Q1. What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose?

Components in Phusion High-Fidelity PCR Master Mix:

  • DNA polymerase: a high-fidelity enzyme that synthesizes new DNA strands based on the template sequence.
  • dNTPs: the molecular building blocks used to make the new DNA strands.
  • Buffer: provides the proper chemical environment, such as pH and ionic strength, to maintain polymerase activity and stability.
  • MgCl₂ (Mg²⁺): an essential cofactor for DNA polymerase and is required for its catalytic activity.

Q2. What are some factors that determine primer annealing temperature during PCR?

In PCR, primer annealing temperature (Ta) is primarily determined by the primer melting temperature (Tm), usually 2-5°C below the lowest Tm of the pair.

Key factors influencing this include:

  • primer length
  • guanine-cytosine (GC) content
  • base sequence (nearest-neighbor interactions)
  • salt concentration (e.g., Na⁺)

Q3. There are two methods from this class that create linear fragments of DNA: PCR, and restriction enzyme digests. Compare and contrast these two methods, both in terms of protocol as well as when one may be preferable to use over the other.

PCR amplifies a specific DNA sequence from a template using heat-stable polymerase and primers, while restriction enzymes (endonucleases) cut double-stranded DNA at specific recognition sites. PCR is ideal for generating large quantities of DNA from small amounts of starting material, while restriction digests are often used for cutting out known fragments from existing plasmids or genomic DNA.

Restriction Cloning Overview Restriction Cloning Overview Restriction Cloning Overview

PCR Overview PCR Overview Polymerase Chain Reaction (PCR) Overview

Q4. How can you ensure that the DNA sequences that you have digested and PCR-ed will be appropriate for Gibson cloning?

  • The vector is properly linearized.
  • Each digested or PCR-amplified fragment has the correct 20–40 bp overlapping homology with the adjacent fragment.
  • All DNA fragments are clean and of the expected size.
  • After assembly, confirm the final construct by sequencing.

Q5. How does the plasmid DNA enter the E. coli cells during transformation?

Plasmid DNA enters E. coli when the cells are shocked by heat shock or electrical shock, which temporarily opens the cell membrane and allows the plasmid to enter by diffusion.

Q6. Describe another assembly method in detail (such as Golden Gate Assembly)

  • Explain the other method in 5 - 7 sentences plus diagrams (either handmade or online).

    Golden Gate Assembly is a one-step cloning method that uses a Type IIS restriction enzyme and DNA ligase in the same reaction tube. Unlike standard restriction enzymes, Type IIS enzymes cut outside of their recognition sites, which allows researchers to design custom overhangs that determine the order of assembly. DNA fragments and the destination vector are designed with matching overhangs, so the pieces ligate together in a predefined sequence. Because the recognition sites are removed during the reaction, the correctly assembled product is typically scarless and is not re-cut by the enzyme. This also helps reduce the background from empty vector, since unassembled or re-ligated vector can be cut again during the cycling reaction. Golden Gate Assembly is especially useful for efficient multi-fragment and modular DNA assembly.

Golden Gate Assembly Golden Gate Assembly Golden Gate Assembly is a Restriction Enzyme Cloning Method. Golden Gate Assembly vs. Traditional Cloning.

Golden Gate Assembly Golden Gate Assembly Type IIS Restriction Enzymes Enable the Unique Features of Golden Gate Assembly Type IIP vs. Type IIS Restriction Enzymes

  • Model this assembly method with Benchling or Asimov Kernel!

Part 2. Asimov Kernel

Methodology & Logic Implementation

In this practice, I manually selected individual components from the Characterized Bacterial Parts repository to construct a functional Repressilator. The core logic was implemented by cross-linking three inhibitory units in a cyclic negative feedback loop: pTetLambdaCI, pLambdaCILacI, and pLacITetR.

My primary focus was to explore how specific biological factors impact the simulation outcome, including:"

  • RNAP & Ribosome Flux: Assessing the transcriptional and translational efficiency at each junction.

  • RNA & Protein Concentrations: Monitoring the temporal dynamics of gene expression.

  • Component Strength: Evaluating if the specific Characterized Parts selected (such as the B3 RBS) are kinetically compatible with the desired oscillatory behavior.

Kernel Kernel Construct 1: Promoter mismatch.

Kernel Kernel Construct 2: Ribosome binding site (B3 RBS). Initial simulations showed no oscillations; this is likely due to the B3 RBS being too potent, which leads to an excessive accumulation of repressor proteins that the system cannot degrade quickly enough to maintain a periodic rhythm.

Kernel Kernel Construct 3: Change Ribosome binding site (B3 RBS) to A1 RBS.

Results & Analysis

The simulation initially resulted in stable, non-oscillatory steady states. Through this exercise, I identified that using standard Characterized Parts requires more than just correct logic; it requires kinetic tuning. Specifically, the B3 RBS proved to be too potent, leading to a protein synthesis rate that overwhelmed the system’s degradation capacity. This ’locked’ the Protein and RNA concentrations at a high-level equilibrium, preventing the periodic ‘dip’ necessary for oscillation.

Week 7 HW: Genetic Circuits Part II

Part 1. Intracellular Artificial Neural Networks (IANNs)

Q1. What advantages do IANNs have over traditional genetic circuits, whose input/output behaviors are Boolean functions?

IANNs can process inputs in a more continuous and analog way. This allows them to respond to gradual changes in input levels and produce more complex behaviors, such as weighted integration, thresholding, and pattern classification. Because of this, IANNs are better for tasks where biological signals are noisy and not strictly binary. They can also represent more complicated decision boundaries than traditional logic-gate-based circuits.

Q2. Describe a useful application for an IANN; include a detailed description of input/output behavior, as well as any limitations an IANN might face to achieve your goal.

An IANN can be used for disease sensing in mammalian cells. It could integrate multiple signals, such as inflammation, hypoxia, and cancer-related RNAs, and produce an output only when the overall pattern matches a disease state. The output could be a fluorescent reporter or a therapeutic protein. A key limitation is that IANNs can be difficult to design and tune because of noise, cell-to-cell variability, and unpredictable interactions between components.

Q3. Draw a diagram for an intracellular multilayer perceptron where layer 1 outputs an endoribonuclease that regulates a fluorescent protein output in layer 2.


Part 2. Fungal Materials

1. What are some examples of existing fungal materials and what are they used for? What are their advantages and disadvantages over traditional counterparts?

Existing fungal materials include mycelium packaging, insulation, leather-like materials, and mycelium composites for products or building panels. They are used as alternatives to plastic foam, synthetic leather, and some lightweight construction materials. Their advantages are that they are renewable, biodegradable, lightweight, and can be grown from waste. Their disadvantages are that they may have lower durability, lower water resistance, and less consistent mechanical properties than traditional materials.

2. What might you want to genetically engineer fungi to do and why? What are the advantages of doing synthetic biology in fungi as opposed to bacteria?

I would want to genetically engineer fungi to create a higher-performance biofilament for 3D printing. For example, fungi could be engineered to improve the filament’s mechanical strength, flexibility, printability, and stability. This would be useful because it could make fungal materials more practical for fabrication while still being sustainable. Fungi are advantageous over bacteria because they naturally grow as filamentous networks, which makes them more suitable for forming continuous material structures. They are therefore a promising platform for developing stronger and more functional bio-based materials for 3D printing.

Week 9 HW: Cell Free Systems

Part A: General and Lecturer-Specific Questions

General Homework Questions

Q1. Explain the main advantages of cell-free protein synthesis over traditional in vivo methods, specifically in terms of flexibility and control over experimental variables. Name at least two cases where cell-free expression is more beneficial than cell production.

Cell-free protein synthesis (CFPS) is more flexible than in vivo expression because it removes cell growth and viability constraints and allows the reaction environment to be adjusted directly. In a cell-free system, researchers can independently tune DNA template concentration, salts, cofactors, energy substrates, pH, redox conditions, crowding agents, and added folding or membrane-assisting components. This makes it easier to study protein production as a controllable biochemical process.

CFPS is especially beneficial when:

  • (1) Producing toxic proteins or peptides, because the product does not need to accumulate inside a living host.

  • (2) When producing complex proteins such as membrane proteins or post-translationally modified proteins, because the reaction can be supplemented with vesicles, microsomes, chaperones or glycosylation machinery.

Q2. Describe the main components of a cell-free expression system and explain the role of each component.

A cell-free expression system usually contains:

  • (1) Cell extract or purified translation/transcription machinery: this provides ribosomes, translation factors, tRNAs, enzymes, and sometimes endogenous metabolic activities needed for protein synthesis.
  • (2) DNA or RNA template: this encodes the target protein and includes the regulatory elements required for transcription and/or translation.
  • (3) RNA polymerase and nucleotides: RNA polymerase transcribes DNA into mRNA, and nucleotides supply the building blocks for RNA synthesis.
  • (4) Amino acids, tRNAs, and translation factors: these are required to decode mRNA and assemble the protein chain.
  • (5) Energy system: substrates such as PEP, creatine phosphate, pyruvate, glucose, or maltodextrin support ATP regeneration for sustained transcription and translation.
  • (6) Salts, buffer, and cofactors: magnesium, potassium, ammonium, NAD, CoA, and buffering agents maintain ionic balance, enzyme activity, and pH stability.
  • (7) Optional additives such as chaperones, redox agents, detergents, liposomes, nanodiscs, or microsomes can be added for difficult proteins.

Q3. Why is energy provision regeneration critical in cell-free systems? Describe a method you could use to ensure continuous ATP supply in your cell-free experiment.

Energy regeneration is critical because transcription and translation consume large amounts of ATP and GTP, and a batch cell-free reaction quickly loses productivity if energy is depleted or inhibitory byproducts accumulate. Without regeneration, protein yield drops because the system can no longer support RNA synthesis, amino acid activation, and ribosome function. One practical method is to use a continuous-exchange or fed-batch setup together with an ATP-regenerating substrate such as PEP or maltodextrin. In this design, the reaction chamber is supplied with fresh small molecules from a feeding solution while waste products diffuse away, which prolongs reaction lifetime and maintains ATP production.

Q4. Compare prokaryotic versus eukaryotic cell-free expression systems. Choose a protein to produce in each system and explain why.

A prokaryotic cell-free system, especially E. coli-based CFPS, is usually cheaper, faster, and higher-yielding, but it has limited native capacity for complex eukaryotic post-translational modifications. I would choose sfGFP or a simple bacterial enzyme for an E. coli system because these proteins do not require glycosylation and are ideal for rapid, low-cost, high-yield expression.

A eukaryotic cell-free system, such as CHO, wheat germ, or tobacco BY-2 extract, is more suitable for proteins that need more complex folding or post-translational processing. I would choose a full-length IgG antibody for a CHO-based system because CHO extracts can support production of functional antibodies and are better suited for proteins that benefit from eukaryotic folding and glycosylation-related machinery.

Q5. How would you design a cell-free experiment to optimize the expression of a membrane protein? Discuss the challenges and how you would address them in your setup.

To optimize a membrane protein, I would set up a screening experiment in parallel conditions using the same DNA template but different membrane-mimicking environments. For example, I would compare nanodiscs, liposomes, mild detergents, and, if available, microsome-containing extracts. I would also vary temperature, magnesium concentration, and lipid composition, then measure both total yield and functional activity.

The main challenges are aggregation of hydrophobic transmembrane domains, incorrect insertion or orientation, and loss of activity due to the absence of a natural membrane environment. I would address these by adding membrane mimics during expression, choosing lipid compositions that better match the protein’s hydrophobic thickness, and using chaperones or lower-temperature conditions to improve folding. For activity testing, I would use ligand binding or transport assays rather than relying only on total protein yield, because a membrane protein can be expressed but still be nonfunctional.

Q6. Imagine you observe a low yield of your target protein in a cell-free system. Describe three possible reasons for this and suggest a troubleshooting strategy for each.

  • Reason 1: Poor template quality or template degradation. Linear DNA can be degraded by nucleases, and low-quality DNA can reduce transcription efficiency. A good troubleshooting strategy is to switch to a plasmid template, improve template purification, or protect linear DNA with strategies such as GamS-like inhibition or terminal protection.

  • Reason 2: Energy limitation or inhibitory byproduct accumulation. If ATP regeneration is insufficient, or if phosphate and acidic byproducts accumulate, transcription and translation will slow down. I would troubleshoot this by optimizing the energy substrate, adjusting magnesium and buffer conditions, or moving from a simple batch reaction to fed-batch or continuous exchange.

  • Reason 3: Protein-specific folding or solubility problems. Some proteins misfold, aggregate, or require special environments such as oxidizing conditions, chaperones, or membranes. I would troubleshoot this by lowering the reaction temperature, adding folding chaperones, adjusting redox conditions, or supplementing membrane mimics if the target is membrane-associated. If the protein is highly complex, I would also consider switching from a prokaryotic to a eukaryotic cell-free system.

Homework question from Peter Nguyen

Freeze-dried cell-free systems can be incorporated into all kinds of materials as biological sensors or as inducible enzymes to modify the material itself or the surrounding environment. Choose one application field — Architecture, Textiles/Fashion, or Robotics — and propose an application using cell-free systems that are functionally integrated into the material. Answer each of these key questions for your proposal pitch:

  • Write a one-sentence summary pitch sentence describing your concept. A topology-optimized architectural substrate is coated with a biopolymer-based surface layer made from freeze-dried cell-free manufactured ingredients to improve durability while adding a lower-carbon functional finish.

  • How will the idea work, in more detail? Write 3-4 sentences or more. The base material would first be designed to use less material while increasing surface area for coating adhesion. A freeze-dried cell-free system would be used off-site to produce a dry biopolymer ingredient, such as a polysaccharide- or protein-based additive. This ingredient would then be blended into a coating and applied to the surface by spraying, dipping, or brushing. After curing, the coating would help improve adhesion, bridge microcracks, and create a tougher protective layer on top of the structural substrate.

  • What societal challenge or market need will this address? This idea addresses the need for more sustainable building materials and longer-lasting surface finishes. Many architectural coatings and repair layers rely on carbon-intensive ingredients and still fail through cracking, abrasion, or moisture damage. A bio-derived coating could reduce maintenance frequency, extend service life, and support lower-carbon construction without requiring a complete change in structural material systems.

  • How do you envision addressing the limitation of cell-free reactions (e.g., activation with water, stability, one-time use)? The cell-free system would be used only during the manufacturing stage to produce the biopolymer ingredient for the coating. Water activation would take place in a controlled setting off-site, where the freeze-dried reaction can be rehydrated, run once, and converted into a stable dry product. That finished biopolymer would then be blended into the coating formula, so the final architectural coating would function as a passive material layer and would not depend on ongoing biological activity after application. This approach improves stability, avoids maintenance challenges linked to repeated activation, and makes one-time use acceptable because the reaction is completed before the material is installed on the building.

Homework question from Ally Huang

How does deep-space radiation affect the integrity of stored DNA templates, and can that damage reduce the reliability of freeze-dried cell-free protein production systems such as BioBits® in future space missions?

  • Background information Deep-space radiation damages DNA and is a major risk for astronauts beyond Earth’s protective atmosphere. Future missions may also depend on stored DNA templates and freeze-dried cell-free systems to manufacture sensors, medicines, or enzymes on demand with minimal equipment. My proposal asks whether radiation exposure degrades those DNA instructions enough to reduce later protein production. This matters for human exploration because damaged DNA stockpiles could weaken in-flight diagnostics and biomanufacturing, and it is scientifically interesting because it tests how the space environment affects the information layer of synthetic biology, not only living cells.

  • Molecular or genetic target A GFP reporter DNA cassette used as a model stored genetic template for later cell-free protein production in space.

  • How the target relates to the challenge The reporter DNA is a stand-in for any DNA blueprint that astronauts might store and later load into BioBits. If radiation introduces strand breaks or base damage, PCR amplification should become less efficient and the cell-free system should produce less fluorescent protein. Measuring expression from the same cassette after different exposure conditions turns DNA integrity into a simple functional readout. This connects a molecular target to a practical space question: can freeze-dried biomanufacturing remain reliable after DNA templates spend time in the space environment?

  • Hypothesis or research goal My hypothesis is that DNA templates exposed to higher space-radiation dose or lower shielding will show lower PCR recoverability and lower GFP output in BioBits than protected templates. The reasoning is simple: ionizing radiation can damage DNA, and BioBits needs DNA instructions plus water to synthesize protein. If this is true, future missions should store critical DNA libraries behind better shielding or refresh them periodically. If expression remains stable despite exposure, that would support the idea that freeze-dried DNA-plus-cell-free kits are robust enough for long missions. Either result would be useful because it would test a key bottleneck between DNA storage and on-demand biomanufacturing in space.

  • Experimental plan I would test identical dried GFP DNA templates stored in two conditions: shielded and minimally shielded. Matching ground controls would stay on Earth. After exposure, each sample would be amplified with miniPCR and then added to BioBits; the P51 viewer would measure endpoint GFP fluorescence. Controls would include a fresh positive-control template, a no-DNA negative control, and non-flown matched DNA. The main data would be fluorescence intensity, PCR success or yield, and expression level normalized across conditions.

Labs

Lab writeups:

  • Week 1 Lab: Pipetting

    Pipetting Art In Week 1 Lab, I practiced pipetting process by creating art with colored dyes on a petri dish. This exercise helped me master volume control and steady hand movement.

  1. Liquid Preparation and Mixing Techniques During this stage, I learned how to distinguish the precision ranges of different pipettes and how to adjust the volume for each. I practiced the proper operational sequence for aspirating liquid without contaminating the source and dispensing it into Eppendorf tubes. Additionally, I practiced the blow-out and mixing techniques using the pipette to ensure consistent color density across my palette.
  • Week 10 Lab: MASS SPECTROMETRY

  • Week 11 Lab: Cloud Lab

  • Week 2 Lab: DNA Gel Art

    Overview In this lab, I focus on the practical application of DNA restriction digestion and agarose gel electrophoresis. The goal is to design and create DNA gel art by using selected restriction enzymes to generate DNA fragments of specific lengths, then resolving those fragments on a gel to form an image. For this experiment, I aim to produce a “boring face” (—_—) pattern.

  • Week 3 Lab: Lab Automation

    Image credit: HTGAA 2026 Lab: Opentrons Artwork In this week’s lab, I made two custom Opentrons OT-2 protocols and used the liquid-handling robot to print Fluorescent E. coli onto black (charcoal) agar plates. I produced two pieces using different design workflows:

  • Week 6 Lab: Gibson Assembly

    Gibson Assembly

  • Week 7 Lab: Fungal Materials and Neuromorphic Circuits

    Part 1: Fungal Materials In Week 7 Fungal Materials Lab, my goal is to experiment with the combination of 3D printed PLA molds and fungal materials.

  1. Mold Design Mold 1: 3D Printing File
  1. Ni-NTA Spin Column Protein Purification

Subsections of Labs

Week 1 Lab: Pipetting

Cover Image Cover Image

Pipetting Art

In Week 1 Lab, I practiced pipetting process by creating art with colored dyes on a petri dish. This exercise helped me master volume control and steady hand movement.


01. Liquid Preparation and Mixing Techniques

During this stage, I learned how to distinguish the precision ranges of different pipettes and how to adjust the volume for each. I practiced the proper operational sequence for aspirating liquid without contaminating the source and dispensing it into Eppendorf tubes. Additionally, I practiced the blow-out and mixing techniques using the pipette to ensure consistent color density across my palette.

Mixing Dyes Mixing Dyes

02. Workspace Setup

A glimpse of the workspace: the bench is equipped with Distilled Water and features various pieces of “Pipetting Art” created by myself and my classmates. Maintaining an organized area is essential for a smooth workflow during the creative process.

Workspace Setup Workspace Setup

03. Final Pipetting Art

This is the final composition created by controlled droplets. Each dot represents a specific volume dispensed with careful pressure on the pipette plunger, showcasing the result of repetitive precision practice.

Final Pipetting Art Final Pipetting Art

Week 10 Lab: MASS SPECTROMETRY

Image Image Image Image Image Image Image Image Image Image Image Image Image Image Image Image Image Image Image Image

Week 11 Lab: Cloud Lab

image image

Week 2 Lab: DNA Gel Art

Cover Image Cover Image

Overview

In this lab, I focus on the practical application of DNA restriction digestion and agarose gel electrophoresis. The goal is to design and create DNA gel art by using selected restriction enzymes to generate DNA fragments of specific lengths, then resolving those fragments on a gel to form an image. For this experiment, I aim to produce a “boring face” (—_—) pattern.


Part 1: In-silico Design

Before entering the lab, I iterated on the target pattern using Ronan’s Automation Art website and used Benchling to simulate how Lambda DNA (48,502 bp) would be cleaved by selected restriction enzymes. This digital preparation enabled me to anticipate the expected banding patterns on the agarose gel and provided a reference for later interpretation of the experimental results.

1.1 Artistic Mapping and Enzyme Selection

For this experiment, I assigned specific enzymes to represent different facial features based on the fragment sizes they produce:

  • EcoRV and PvuII: forms the outer “ ( ) ” boundaries.
  • SacI: creates the eye bands “ — ”.
  • SalI: creates the mouth band “ _ ”.
Benchling Interface Benchling Interface

1.2 Virtual Gel Prediction

I used Benchling’s virtual gel tool to verify that the fragments for the eyes, mouth, and face boundaries would migrate to the intended relative positions. The simulation confirmed that the selected enzymes should produce a clear, distinguishable “boring face” pattern on the agarose gel. The required restriction-digest reagents and volumes were generated using the Automation Art website and used as the setup guide for the subsequent wet lab procedure.

Benchling Virtual Gel Benchling Virtual Gel

Part 2: Wet-lab Experiment

2.1 Restriction Digest

I prepared restriction digests using Lambda DNA and 10X CutSmart buffer for all reactions. Enzymes were added last.

  • DNA: Lambda DNA
  • Buffer: 10X CutSmart
  • Enzymes: restriction enzymes
  • Incubation: 37°C, 40 min

Restriction Digest Restriction Digest Restriction Digest Restriction Digest Restriction Digest Restriction Digest Incubation Incubation Restriction Digest Restriction Digest

2.2 Gel Electrophoresis

I used a 1% agarose gel and loaded the digested samples into the wells.

  • Voltage: 130V
  • Time: 40 mins

Gel Electrophoresis Gel Electrophoresis Gel Electrophoresis Gel Electrophoresis Gel Electrophoresis Gel Electrophoresis Gel Electrophoresis Gel Electrophoresis

2.3 Deviation

The intended mouth lane (lane 5) in Benchling was Lambda_DNA_Thermo_(NC_001416) + SalI. Due to an Automation Art configuration error, the corresponding wet-lab reaction was prepared without SalI.

Deviation Deviation

3. Results and Observations

3.1 The Final Gel Art

Final Gel Image 01 Final Gel Image 01 Final Gel Image 02 Final Gel Image 02 Final Gel Image 03 Final Gel Image 03

3.2 Failures & Reflections

In the final gel, lanes 4 and 6 most closely matched the expected composite pattern in terms of band position and clarity. Lane 5 produced a visible band, but it likely reflects a setup error rather than the intended condition: in Benchling, the “mouth” lane was designed as Lambda_DNA_Thermo_(NC_001416) + SalI, but a mid-process misconfiguration in Automation Art propagated into the wet-lab setup, and the corresponding reaction was prepared without SalI (buffer + λ DNA added, SalI omitted). Lanes 3 and 7 did not yield a legible gel-art “image” in this run (lane 3 shows the ladder; lane 7 is faint).

Compared with the exported gel image, the raw transilluminator photo shows weaker contrast: the ladder lane is faint but detectable, and only the central lanes show distinct bands near the wells; the rest of the gel has low signal with a visible dye front.

Issue 1: Low Overall Fluorescence and Weak Contrast

  • Observation: The raw transilluminator photo displayed weaker contrast compared to the exported gel image. Overall band visibility was low across most lanes.
  • Speculation: Shared Lambda DNA and enzymes were frequently handled and moved between storage and benches by multiple users. Repeated freeze thaw cycling likely reduced enzyme activity or DNA quality. Potential cross contamination during shared reagent handling may have also affected reaction performance.

Issue 2: Inconsistent Lane Clarity in Lanes 4 and 6

  • Observation: Only lanes 4 and 6 produced clear bands that closely matched the expected composite pattern. Lane 7 appeared faint compared with lanes 4 and 6.
  • Speculation: Lane 4 contained a higher volume of loading dye which likely improved sample density and helped it settle consistently in the well to increase visibility. In weaker lanes, small sample volumes between 2 to 5 microliters may have remained inside pipette tips during loading. Furthermore, differences in loading dye volume can change apparent intensity even when the digest chemistry is identical.

Issue 3: Design Mismatch in Lane 5

  • Observation: Lane 5 produced a visible band but failed to represent the intended mouth pattern using SalI as specified in the Benchling design.
  • Speculation: Lane 5 was prepared without SalI enzyme. This error likely originated from an initial configuration mistake in the Automation Art tool that propagated into the wet lab setup. Omitting the enzyme produced a band pattern that naturally does not match the prediction for the mouth feature.

Issue 4: Poor Resolution in the Lower Gel Half

  • Observation: A prominent dye front was visible but the lower half of the gel contained limited resolved band information.
  • Speculation: Running the electrophoresis at 130V for 40 minutes was likely too aggressive for smaller fragments. High voltage may have reduced the resolution of shorter DNA segments and pushed them toward or beyond the dye front before they could be clearly separated.

Issue 5: Buffer Limitations

  • Observation: All digestion reactions were performed using a single CutSmart buffer.
  • Speculation: While utilizing one universal buffer is convenient for all digests, it may have resulted in sub optimal cutting performance for specific enzymes or enzyme combinations that require different salt concentrations for maximum activity.

Week 3 Lab: Lab Automation

Cover Image Cover Image Image credit: HTGAA 2026

Lab: Opentrons Artwork

In this week’s lab, I made two custom Opentrons OT-2 protocols and used the liquid-handling robot to print Fluorescent E. coli onto black (charcoal) agar plates. I produced two pieces using different design workflows:

Machine Machine

Design 1: Flower (Python protocol)

I explored how Python-defined coordinates translate into the OT-2 end-effector path, and how pipetting settings—especially volume—shape the deposited pattern and later bacterial growth. I used three fluorescent strains: Cyan (mTurquoise2), Yellow (Venus), and Red (mRFP). Cyan and Yellow followed two perpendicular ∞ (infinity) paths that together read as a flower-like form; their paths overlap at the center to test color mixing and spatial blending between strains. For Red, I mainly adjusted single-dispense volume to compare the “growth radius” suggested by the code with the actual colony spread on the plate. Two Red deposit points were placed to intersect with the Cyan/Yellow geometry to further test mixed-color effects at intersections.

Flower Print Flower Print Flower Print Flower Print

Python Script:

Flower Python Flower Python Flower Python Flower Python Flower Python Flower Python Flower Python Flower Python

Simulation:

Flower Simulation Flower Simulation

UV-illuminated Petri Dish:

Flower Final Flower Final

Design 2: Birds (Automation Art)

To learn the Opentrons Arts pipeline, I used the Automation Art Interface: I imported an illustration, adjusted it in the web editor, published the design to the gallery, and then had the TA download and run it in the Opentrons App for automated pipetting. This workflow let me compare the constraints and benefits of a GUI-based image-to-path process versus direct protocol scripting.

Bird Print Bird Print Bird Print Bird Print

Automation Art Design & Simulation:

Bird Design Bird Design

UV-illuminated Petri Dish:

Bird Final Bird Final

Part 2: Post Lab Questions

Q1: Find and Describe

HYdrogel Dispensing method with Robotic Automation (HYDRA) for HTS-compatible hydrogels.

In this publication, the authors show how liquid handling automation can be used as a fabrication method, not just as a pipetting convenience. They introduce an automated workflow called HYDRA that makes thin and planar hydrogel films directly inside standard multiwell plates, so the resulting cell culture substrate is compatible with high throughput screening and imaging.

HYDRA HYDRA HYdrogel Dispensing method with Robotic Automation (HYDRA) for HTS-compatible hydrogels. Torchia, E., Di Sante, M., Horda, B. et al. Fabrication of cell culture hydrogels by robotic liquid handling automation for high-throughput drug testing. Commun Eng 4, 222 (2025). https://doi.org/10.1038/s44172-025-00575-3

Research Question

High-throughput screening (HTS) usually uses rigid plastic/glass, which reduces physiological relevance. Hydrogels improve biomimicry, but in multiwell plates they often form curved menisci that interfere with uniform seeding and microscopy, and many hydrogel approaches end up too thick for high-resolution imaging.

Lab Automation

HYDRA’s key trick is a dispense + immediate re-aspiration routine: the robot dispenses a sub-contact volume of hydrogel precursor (avoiding sidewall wetting), then re-aspirates to “pin” the contact line and leave a uniform micrometric film on the well bottom (reported ~10–50 µm). This produces meniscus-free coatings that remain compatible with standard 96- and 384-well workflows.

In their methods, the authors explicitly use an OT-2 as an “entry-level” open-source platform to demonstrate accessibility for academic labs: they implement casting via Opentrons Protocol Designer, using controlled dispense/aspirate heights and flow rates (e.g., dispensing at hundreds of microns above the bottom and aspirating closer to the surface) to reliably leave a thin residual layer that later crosslinks.

Biological Application

They fabricate fish-gelatin hydrogels crosslinked with microbial transglutaminase, then validate the platform with imaging-based dose–response assays (e.g., nocodazole and paclitaxel) on engineered epithelial cells, showing the hydrogel substrates support long-term holographic imaging and fluorescence microscopy while preserving expected pharmacological readouts.


Q2: Lab Automation Plan for Final Project

For my final project on improving extreme-environment tolerance for moss-based DNA storage, I plan to use a cloud laboratory workflow (Ginkgo Nebula) to run a high-throughput screening matrix with strong reproducibility and minimal manual pipetting.

Cloud-lab automation plan:

To systematically identify the most resilient variants and protective environments for our moss-based sensors, I utilize an automated screening workflow to test multiple tolerance-enhancement conditions in parallel:

  • Precision Arraying (Echo Transfer): I will use the Echo Acoustic Liquid Handler to precisely array various tolerance-enhancement sets—including diverse pHluorin variants, protective additives (e.g., trehalose), and specific cofactors—into designated wells of 96 or 384-well plates.
  • Stressor Distribution (Bravo & MultiFlo): The Bravo Automated Liquid Handling Platform and MultiFlo FX Dispenser are employed to distribute master mixes and stressor reagents (such as $H_2O_2$ for oxidative stress) across the plates, creating controlled gradients of UV, desiccation, and chemical stressors.
  • Environmental Control (PlateLoc & Inheco): Plates are sealed using the PlateLoc Thermal Microplate Sealer to prevent evaporation, followed by incubation in Inheco modules. This ensures rigorous control over temperature and timing during both the stress-induction and recovery phases.
  • Automated Access (XPeel): Between multi-step stages, transitioning from stress to recovery or preparing for measurement, the XPeel system automates the removal of seals, allowing for seamless integration without manual intervention.
  • Performance Analysis (PHERAstar): Finally, the PHERAstar Plate Reader measures fluorescence (specifically the pH-dependent excitation shifts of pHluorin) and absorbance. This serves as a post-stress performance proxy, allowing me to rank conditions based on signal retention and metabolic recovery.

Week 6 Lab: Gibson Assembly

Cover Image Cover Image

Gibson Assembly


PCR PCR PCR PCR PCR PCR PCR PCR

Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly Gibson Assembly

Week 7 Lab: Fungal Materials and Neuromorphic Circuits

Cover Image Cover Image

Part 1: Fungal Materials

In Week 7 Fungal Materials Lab, my goal is to experiment with the combination of 3D printed PLA molds and fungal materials.

01. Mold Design

FM FM Mold 1: 3D Printing File

FM FM Mold 1: Printed Mold

FM FM Mold 2: 3D Printing File

FM FM Mold 2: Printed Mold

02. Assembly

Fungal Material Preparation

FM FM FM FM

Fungal Material Infill

FM FM FM FM


Part 2: Neuromorphic Circuits

01. Pre-Lab: Neuromorphic Wizard

NC NC NC NC Genetic circuit design.

02. OT-2 Building and Trasfecting

NC NC OT-2 Building

NC NC Lab Result

Week 9 Lab: PROTEIN PURIFICATION

Cover Image Cover Image

1. Magnetic Bead Protein Purification

Image Image Image Image

2. Ni-NTA Spin Column Protein Purification

Image Image Image Image Image Image Image Image

Subsections of Projects

Group Final Project

cover image cover image