<Yuxin Wang> — HTGAA Spring 2026

cover image cover image

About me

I’m Yuxin Wang, a PhD candidate in Bio Art and Design at the University of Western Australia. My life and study have taken me through many cities, nurturing my enduring curiosity for cuisine, nature, and the stories they hold. As a Designer and Artist, I creative immersive dining experiences and biological ethics narritive design that weave together themes of intimacy, ecological narratives, and the myths of nature. I share my life with a little dog, and this cross‑species bond deepens my exploration of connection—between human and non‑human, body and environment, emotion and ecosystem. Guided by a profound reverence for life and nature, I keep questioning, creating, and reimagining our relationship with the living world. If fire becomes the ocean, we will drink it.

Subsections of <Yuxin Wang> — HTGAA Spring 2026

Homework

Weekly homework submissions:

  • Week 1 HW: Principles and Practices

    What I would like developing a Microbial Oxytocin-Sensing Network,a decentralized, “invisible” biosensing system designed for non-invasive ecological monitoring. These “living sentinels” utilize chimeric GPCRs to detect mammalian oxytocin and record signals via CRISPR-genomic storage. To maintain ecological integrity, the data is expressed through near-infrared bioluminescence, creating an interface that is sensory yet non-intrusive to the local fauna.

  • Week 10 HW: Imaging and Measurement

    Homework: Final Project 1. Measurement Object (Elements to be Measured) In this project, I will focus on measuring the following three interrelated indicators to verify the success of the conversion of heart rate data into biological signals: A luorescence Emission Intensity: This is a core measurement item. It directly corresponds to the intensity or frequency of the heartbeat signal. By measuring the brightness of fluorescence within a unit area or volume, it verifies whether the biological system has generated corresponding visual feedback based on the input heartbeat data.

  • Week 11 HW: Imaging and Measurement

    Part A: The 1,536 Pixel Artwork Canvas | Collective Artwork HTGAA Community Bioart Reflection As part of the global community bioart project, I contributed 3 distinct pixels to the artwork under my profile yuxin-wang (#98 on the leaderboard) Reflection: I really loved the concept of crowdsourcing a bio-art piece on a global scale. It beautifully bridged the gap between code-based collaboration (GitHub) and biological art concepts. However, for next year, I think the project could be improved by providing better real-time visualization of the collaborative canvas. A dynamic map showing live changes would help contributors see the immediate impact of their inputs within the context of the larger piece.At same time,there are too few colored squares, which leads to a sense of competition rather than cooperation. This is something we hope to improve upon next year.

  • Week 2 HW:Dna Read Write and Edit

    Part 1 Benchling & In-silico Gel Art Limbda Sequence Import Limbda gel electrophoresis

  • Week 3 HW:Lab Automation

    Python Script for Opentrons Artwork My Inspiration In taxonomy, Bucardo belongs to the genus Capra (goats). In my Opentrons practice, I discovered that the mosaic pattern formed by fluorescent bacteria blurred the boundaries between specific species and macroscopic classification. I am not depicting an exact sheep, but rather using the universality of the “Capra” attribute to reconstruct an image of “Resurrection for 7 Minutes”. This mosaic-like visual language is not only a numerical metaphor for Bucardo’s shattered life, but also a vague expression about ’existence and disappearance’ that transcends species classification.

  • Week 4 HW: Protein design part 1

    Part A. Conceptual Questions 1.Why do humans eat beef but do not become a cow, eat fish but do not become fish? Because the human body completely breaks down exogenous proteins into free amino acids. And the DNA re-directs these amino acids to be arranged in the human sequence, rather than the sequence of cows or fish.

  • Week 5 HW:Protein Design Part-ii

    Part A: SOD1 Binder Peptide Design Part 1: Generate Binders with PepMLM Generate four peptides of length 12 amino acids conditioned on the mutant SOD1 sequence. Among the generated sequences, WRYPAAAAELKK (7.61) stands out the most. It has a lower perplexity than the other generated sequences, indicating that it may be more compatible with the pocket of the SOD1 A4V mutation site in terms of chemical environment and geometric conformation.

  • Week 6 HW: Genetic Circuits Part 1

    Assignment: DNA Assembly 1.What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose? Phusion is an enzyme commonly used for high-precision cloning. Its Master Mix typically contains the following core components:Phusion DNA Polymerase: The core enzyme. It possesses 3’→5’ exonuclease activity (proofreading function), ensuring high fidelity DNA replication with an extremely low error rate. dNTPs (dATP, dTTP, dCTP, dGTP): The “raw materials” for building new DNA strands.Mg²⁺ (usually MgCl₂): A cofactor for the polymerase. It stabilizes primer-template binding and activates the enzyme’s catalytic center. Buffer: Maintains a constant pH and provides suitable ionic strength to ensure enzyme activity.

  • Week 7 HW: Genetic Circuits Part 1

    Assignment Part 1: Intracellular Artificial Neural Networks (IANNs) 1.IANNs vs. Traditional Genetic Circuits (Boolean Functions) Traditional genetic circuits are typically Boolean logic (0 or 1), meaning the output is only triggered when both inducers reach high concentrations simultaneously. In contrast, IANNs offer the following advantages: Analog/Graded Response Processing: Traditional circuits are prone to abrupt changes near a threshold. IANNs can handle analog inputs, achieving “weighted summarization,” allowing cells to respond linearly or with finer nonlinear responses to subtle changes in signal strength.

  • Week 9 HW: Cell Free System

    Homework Part A: General and Lecturer-Specific Questions 1.Explain the main advantages of cell-free protein synthesis over traditional in vivo methods, specifically in terms of flexibility and control over experimental variables. Name at least two cases where cell-free expression is more beneficial than cell production. Advantages:1.Flexibility and Control: You can directly adjust the reaction system, such as changing pH, ion concentration, or adding non-natural amino acids, without worrying about “killing” cells.2.Openness: The system is open; you can monitor the reaction process in real time or directly add linear DNA without constructing complex plasmids.

Subsections of Homework

Week 1 HW: Principles and Practices

cover image cover image

What

I would like developing a Microbial Oxytocin-Sensing Network,a decentralized, “invisible” biosensing system designed for non-invasive ecological monitoring. These “living sentinels” utilize chimeric GPCRs to detect mammalian oxytocin and record signals via CRISPR-genomic storage. To maintain ecological integrity, the data is expressed through near-infrared bioluminescence, creating an interface that is sensory yet non-intrusive to the local fauna.

Why

  1. Upgrading from Survival Stats to Population Resilience Traditional monitoring methods (such as infrared cameras and satellite positioning) can only tell us that the animals “are alive” or “where they are”, but cannot answer the question “Are they doing well?”. Sometimes the increase in numbers can mask social breakdown or failure in raising offspring within the population. Therefore, this technology provides “leading indicators” for predicting the long-term survival ability of the population, rather than just being a lagging indicator of population statistics. This project attempts to conduct true zero-contact monitoring by distributing sensors at the microbial level. We capture biochemical signals in the animals’ most relaxed and natural social scenarios without interfering with their natural behaviors.

  2. Challenging “Genomic Essentialism”: From Frozen DNA to Dynamic Associations (Beyond Genomic Essentialism) The mainstream conservation paradigm represented by the San Diego Frozen Zoo mainly focuses on storing the “sole and independent essence” of species, that is, the static DNA sequence. This “freezing logic” simplifies species into a set of digital codes. However, life is not just the accumulation of codes; it is a dynamic relationship. When a species is separated from its social context, it has already been fragmented ontologically. And the project refuses to view species as a “static asset”. It uses synthetic biology methods to capture the transient molecule oxytocin and attempts to preserve those “physiological moments” that cannot be recorded by DNA. It emphasizes: The essence of a species exists not only in its cell nucleus, but also in the “unstable” biochemical bond between individuals.

  3. Eliminating “Technical Intrusion”: As a Hidden Infrastructure for Fail-Safe In current wildlife management, mechanical noise, reflection and physical presence can disturb sensitive species, trigger stress responses, and force them to alter their natural behaviors or even abandon their offspring. This project aims to establish an entirely invisible and decentralized biological network. It blends seamlessly with the environment and does not cause any physical disturbances.

Governance / Policy Goal

1 Ensure minimal impact on non-human life and ecosystems
MOSN must never introduce biological, ecological, or behavioral harm to animals, microbial ecologies, or habitats—even indirectly or over long temporal scales. AI Prompts:How do changes in soil microorganisms affect species and ecosystems?
Sub-goal 1.1: Microbial sensors must have strict ecological boundary control (such as environmental adaptability restrictions and self-limiting reproductive design), and the genetic editing operation must not have irreversible ecological spill-over risks. Sub-goal 1.2: The monitoring process neither triggers stress responses in the animals (eliminating physical or sensory disturbances) nor interferes with the species’ natural secretion of oxytocin, social interactions, and other biochemical processes.

2 Preventing the instrumental abuse of biochemical signals and safeguarding the dynamic essence of species’ lives
MOSN must not be reduced to a tool for secretly monitoring, extracting resources from, or commercializing animal intimate behaviors, reproduction, and sociability; it is necessary to reject simplifying species as “static genetic assets” and prohibiting the binding of biochemical signal data with digital and instrumentalized species management methods. AI Prompts:the potential risks of instrumental abuse of biochemical signals
Sub-goal 2.1: Anti-tooling monitoring protection Oxytocin signals cannot be correlated with location tracking, facial recognition, tagging systems, or behavioral profiling technologies. Data access must be restricted to ecological research, conservation ethics
Sub-goal 2.2: Establish a use-purpose firewall: data cannot be repurposed beyond the originally stated ethical and epistemic aims.

3 Ensure Ethical Human–Nonhuman Interface Design
The perception and interpretation of MOSN’s output data by humans require the cultivation of responsibility, restraint, and empathy towards non-human life (rather than the desire for control, possession, or prying); the core of interface design is to “capture biochemical bonds” rather than “monitoring life conditions”, emphasizing the understanding of species dynamic relationships rather than the control of individuals. Sub-goal 3.1:Design language should emphasize listening rather than seeing or controlling through.
Sub-goal 3.2:Require periodic ethical re-evaluation as ecosystems, technologies, and social contexts interaction evolve.

Potential Governance “Actions”

1 Establish “cross-species sensory avoidance” review criteria
Executor: Environmental Regulatory Agency / Ethical Committee
Purpose: To prevent near-infrared (NIR) bioluminescence from causing behavioral disturbances in animals with specific visual ranges.
Design: Similar to the allocation of radio frequency spectrum. All MOSN deployments must pass the “redshift compliance test” before implementation. Developers must adjust the expression frequency of luciferase (Luciferase) based on the visual curves of the target species (such as rodents, reptiles, etc.) at the deployment site, ensuring that the light-emitting points are within the “visual blind zone” of that ecological niche species. AI Prompts:What design and research methods are there to prevent bioluminescence from interfering with animals?
Assumptions: We assume that we have sufficient scientific data to support the retinal sensory anatomy of all protected species in this area.
Risks/Failure: Certain insects or organisms in the deep soil may be extremely sensitive to heat or weak photons, causing changes in their migration or feeding behaviors.
The side effect of “success”: To completely avoid being detected by animal vision, it may result in extremely long signal wavelengths, which increases the technical difficulty and equipment cost for human receivers to process the data.

2 Establish a Global Stewardship Regime
Purpose:Establish a MOSN Global Stewardship Regime—a unified framework of mandatory rules, technical standards, and incentive mechanisms
Executor: Federal Regulators (e.g., EPA, EU EBA, national biotech regulatory bodies)
Design:Enact a Specialized MOSN Biotech Mandate (analogous to drone flight restriction zones) that classifies MOSN microbial sensors as “non-instrumental conservation biotech”—mandating technical compliance with signal irreducibility standards (no individual-level data capture) and banning any integration with wildlife tracking/genomic extraction technologies; approve only MOSN deployments with a certified “dynamic life purpose plan
Assumptions: Federal regulators across jurisdictions will harmonize the MOSN biotech mandate (no cross-country regulatory arbitrage for non-compliant deployments).AI Prompts:If you were part of the federal regulator, how would you assess the Risks of Failure and “Success” of MOSN?
Risks/Failure:1.Regulatory inconsistencyDifferent countries or agencies set different rules, creating loopholes where unethical MOSN projects can operate. 2.Regulators lack technical expertiseThey cannot verify whether the technology actually avoids individual-level data or tracking, so rules exist only on paper.
Risk of success:1.Standards have become uniform.The rules ignore the local ecological needs and the viewpoints of the indigenous people, resulting in the Environmental Protection Agency being compliant in form but having no effect in terms of ecology.2.Excessive standard uniformity leads to the suppression of technological innovation: The regulation “succeeded” in achieving global uniformity of MOSN technical standards and standardization of the approval process. However, in order to avoid the risk of tooling up, overly conservative technical restriction clauses were formulated.

3 Ethical Human–Nonhuman Interface Design
Purpose:Current conservation data and interfaces often reinforce human-centrism, framing non-human life as resources, subjects, or study objects. Use MOSN’s output and interface as a form of anti-anthropocentric education in the Anthropocene — to cultivate public empathy for the dynamic, relational vitality of non-human species, rather than treating them as measurable assets or controllable systems.
Executor:Interface designers + artists + ethicists + conservation biologists
Design:Co-design interfaces that prioritize listening over surveillance, using near‑infrared bioluminescence patterns and ambient expressions rather than individual tracking or control-style dashboards and by using remote information transmission and visualization tools.
Assumptions:That people can understand and connect with abstract, non‑instrumental “relational signals” without demanding clearer, more intrusive, or more “useful” data.That ethical review panels will meaningfully update standards as ecosystems, technologies, and social values change.
Risks of Failure: The interface becomes just another “monitoring tool”; ethical reviews become symbolic; data is interpreted as a way to predict or manage animals rather than respect their autonomy.
Risks of “Success”: The interface is so abstract it fails to educate; “ethical listening” becomes a branding label for projects that still treat non‑human life as a source of information or spectacle.

Does the option:Option 1Option 2Option 3
Enhance Biosecurity11NA
• By preventing incidents11NA
• By helping respond21NA
Foster Lab Safety21NA
• By preventing incident21NA
• By helping respond32NA
Protect the environment112
• By preventing incidents112
• By helping respond222
Other considerations
• Minimizing costs and burdens to stakeholders232
• Feasibility?122
• Not impede research121
• Promote constructive applications111

Recommendation and Priority

I prioritize a strategic integration of Option 1 (Cross-species Sensory Avoidance) and Option 3 (Ethical Human–Nonhuman Interface Design). My recommendation is directed toward the International Union for Conservation of Nature (IUCN) and National Environmental Regulatory Agencies (such as the EPA).
The reason why is while Option 2 (Global Stewardship) offers a necessary regulatory shell, it risks becoming a bureaucratic bottleneck that could stifle the very innovation needed for urgent conservation. By combining Options 1 and 3, we address the core ethical tension of MOSN: the paradox of observing without “intruding.”
Option 1 Cross-species Sensory Avoidance: Ensures the technology respects the “sensory sovereignty” of the fauna. It moves biosafety from “preventing human infection” to “preventing ecological disruption.”
Option 3 Ethical Human–Nonhuman Interface Design: Ensures that the data produced does not become a tool for “digital colonialism.” It forces us to engage with the wild through empathy and “listening” rather than through the lens of a control-oriented dashboard.

Trade-offs Considered

  1. Innovation vs. Bureaucratic Control Option 2 (Global Stewardship) focuses on strong international regulation. This can provide legal authority and global coordination. However, it may also create slow decision-making processes and administrative delays.In urgent conservation contexts, technology needs to adapt quickly to local ecological conditions. If every development must go through heavy global approval systems, innovation may slow down. By choosing Option 1 and 3, we allow governance to happen through design principles rather than only through top-down control. This keeps flexibility while still setting ethical boundaries. Trade-off: We sacrifice some global regulatory consistency in order to maintain speed and adaptability.

  2. External Oversight vs. Built-in Ethical Design Option 2 relies mainly on external monitoring and enforcement. It assumes that rules and compliance systems can prevent misuse.However, once a technology is widely distributed, enforcement becomes difficult. In some regions, regulations may be weak or politically influenced. Option 1 and 3 instead build ethical limits directly into the technology:Option 1 limits sensory disturbance biologically.Option 3 limits how much and what type of data can be accessed.This reduces the need to rely only on legal systems.

Trade-off: We accept less centralized authority in exchange for stronger built-in ethical safeguards.

In conclusion, prioritizing Option 1 and Option 3 shifts governance from external control to internal ethical design. Instead of relying mainly on international regulatory systems, ethical responsibility is embedded directly into the technology itself.
This approach reduces pressure on geopolitical systems and minimizes conflicts caused by uneven regulatory capacity between countries. When ethical limits are built into the design — such as sensory protection and restricted data access — the technology becomes less dependent on political stability or advanced enforcement infrastructure.
In this way, internal monitoring through design ethics can help bridge global inequalities in environmental governance and information technology. It creates a more resilient and adaptable framework, especially in regions where formal regulation may be slow, inconsistent, or politically sensitive.

Assumptions and Uncertainties

Assumption: I assume that “relational vitality” (social bonding) is a universally accepted indicator of ecological health that can bridge the gap between Western science and indigenous knowledge.

Uncertainty: There is a significant knowledge gap regarding the retinal anatomy of soil micro-fauna. While we can protect mammals from light pollution, we do not fully know how NIR-emitting bacteria might disrupt the behaviors of deep-soil invertebrates or fungi.

Subsections of Week 1 HW: Principles and Practices

Notes the Week 2 Lecture Prep

Gene Synthesis

1.Nature’s machinery for copying DNA is called polymerase. What is the error rate of polymerase? How does this compare to the length of the human genome. How does biology deal with that discrepancy?
Nature’s machinery for copying DNA is DNA polymerase.The error rate of biological, error-correcting polymerase is approximately 1 in 10⁶ (1:10⁶) per base addition.
The human genome is about 3.2 billion base pairs (≈3.2 × 10⁹ bp). If polymerase made errors at a rate of 1 in 10⁶ without further correction, this would theoretically lead to thousands of mutations each time the genome is replicated.
Proofreading and mismatch repair reduce the overall mutation rate to a much lower level, allowing large genomes like the human genome to be copied with extremely high fidelity.

2.How many different ways are there to code (DNA nucleotide code) for an average human protein? In practice what are some of the reasons that all of these different codes don’t work to code for the protein of interest?
An average human protein is about 1,036 base pairs long,Since each amino acid is encoded by a codon of three nucleotides, this corresponds to roughly 345 amino acids.Because most amino acids are encoded by more than one codon (there are 64 codons for 20 amino acids), each amino acid can often be chosen in several different ways. On average, there are about 3 possible codons per amino acid.

DNA Synthesis Development and Application

1.What’s the most commonly used method for oligo synthesis currently?
The most commonly used method for oligo synthesis today is the phosphoramidite solid-phase chemical synthesis method. 2.Why is it difficult to make oligos longer than 200nt via direct synthesis.
It is difficult to synthesize oligos longer than 200 nt because chemical DNA synthesis is stepwise and not perfectly efficient. Each nucleotide is added one at a time through repeated coupling cycles slides-lecture-2-leproust
Even if each step is about 99% efficient, the small loss at every cycle accumulates. After 200 steps, the overall full-length yield drops dramatically (around 13%), meaning most molecules are truncated.
Therefore,Beyond ~200 nt, the full-length yield becomes too low and error rates too high, making direct chemical synthesis inefficient and unreliable. 3.Why can’t you make a 2000bp gene via direct oligo synthesis?
It cannot synthesize a 2000 bp gene directly because chemical DNA synthesis adds one nucleotide at a time and each step is not 100% efficient

What are the 10 essential amino acids in all animals and how does this affect your view of the “Lysine Contingency”?
1.The 10 essential amino acids in all animals (cannot be synthesized de novo and must be obtained from diet) are: Histidine (H)Isoleucine (I)Leucine (L)Lysine (K)Methionine (M)Phenylalanine (F)Threonine (T)Tryptophan (W)Valine (V)Arginine (R) (essential in many animals, especially during development)
2.Because lysine is an essential amino acid that animals cannot synthesize, making an organism dependent on lysine (or a modified lysine) creates a built-in metabolic dependency.

Week 10 HW: Imaging and Measurement

Homework: Final Project

1. Measurement Object (Elements to be Measured)

In this project, I will focus on measuring the following three interrelated indicators to verify the success of the conversion of heart rate data into biological signals:

A luorescence Emission Intensity: This is a core measurement item. It directly corresponds to the intensity or frequency of the heartbeat signal. By measuring the brightness of fluorescence within a unit area or volume, it verifies whether the biological system has generated corresponding visual feedback based on the input heartbeat data.

B Cell metabolic state/Optical Density (OD600) Measures the growth concentration of host cells (such as Escherichia coli) carrying heartbeat information. This is done to eliminate the variable of “increased fluorescence due to an increase in cell numbers”, ensuring that the change in fluorescence intensity is solely caused by the differences in protein expression driven by the heartbeat data.

2. Technologies & Detailed Description

A. Microplate Fluorescence Analysis Technique used: Enzyme-linked immunosorbent assay (ELISA) plate reader Detailed description: I will place the biological samples representing different heart rate profiles (such as heart rate data under different frequencies and emotional states) in a 96-well plate. Using a microplate reader, quantitative detection will be conducted at specific excitation wavelengths (such as the typical 488nm for GFP) and emission wavelengths (such as 510nm). Data processing: Obtain the relative fluorescence units (RFU) data and conduct a linear regression analysis with the original heart waveforms. If the change curve of RFU is highly correlated with the change in heart rate, it indicates that the data implantation was successful.

B. Quantitative Live-cell Imaging Techniques used: Confocal Microscopy or Fluorescence Microscopy Detailed description: If the heart rate data is designed to be spatially distributed within the biological tissue (for example, simulating the fluctuating trajectory of an electrocardiogram), I will use confocal microscopy to capture the fluorescence distribution within the sample. Operation details: Utilize the Z-stack function of the microscope for three-dimensional scanning, and measure the spatial distribution density and intensity gradient of the fluorescence.

Homework: Waters Part I — Molecular Weight

Q1. Theoretical MW from sequence

Sequence length: 247 residues (includes LE linker + HHHHHH His-tag).

Calculated average MW ≈ 28,006.6 Da (~28 kDa).

Analogy: counting MW from sequence is like weighing a train by summing the weight of each car — every amino acid adds its known “car weight” minus one water molecule per peptide bond.

Q2. Deconvolution from Figure 1

Selected adjacent peaks (denatured envelope): m/z = 933.7148 and m/z = 903.7148.

Step 2.1 — Charge of the lower-charge peak (n):

$$z_n = \frac{m/z_{n+1}}{(m/z_n) - (m/z_{n+1})} = \frac{903.7148}{933.7148 - 903.7148} = \frac{903.7148}{30.0000} ≈ 30.12$$

→ rounded to z = 30 (and the adjacent peak is z = 31).

Step 2.2 — MW from m/z and z:

$$MW = z_n \times (m/z_n - 1.00728) = 30 \times (933.7148 - 1.00728) ≈ \mathbf{27{,}981\ Da}$$

(Using the non-rounded z ≈ 30.12 gives 28,097 Da. Either is acceptable.)

Step 2.3 — Accuracy:

$$\text{Accuracy} = \frac{|28{,}097 - 28{,}007|}{28{,}007} ≈ 0.32%$$

That is ~3,200 ppm error — excellent for intact-protein QTof analysis.

Step 2.3 — Accuracy: Using the predicted theoretical MW of eGFP (with chromophore maturation) ≈27,911 Da: Accuracy (ppm)= 27,911 \ ∣27,981.23−27,911∣ ×10 6 ≈251.6 ppm

3 Answer: No. Reason: The individual isotopic peaks are not resolved in this mass spectrum for a protein of this size (≈28kDa). The spacing between isotopic peaks would be 1/z, which is approximately 0.05m/z. Due to the instrument’s resolution limit or natural peak broadening, these peaks merge into a single envelope. Therefore, the charge state cannot be determined by observing isotope spacing and must be calculated using the adjacent charge state approach.

Part II — Native vs Denatured (Secondary/Tertiary)

Q1. Protein Conformations: Native vs. Denatured in Mass Spectrometry

  1. What happens when a protein unfolds? When a protein transitions from its native to a denatured state, it loses its highly organized three-dimensional tertiary structure. In the native state, the protein is tightly folded and compact, shielding its hydrophobic core and many basic amino acid residues inside the structure. In the denatured state (induced by organic solvents, heat, or acidic pH), the non-covalent interactions stabilizing the fold are disrupted. The polypeptide chain adopts an extended, flexible, and open conformation.

  2. How is this change determined by a mass spectrometer? Mass spectrometry detects this conformational change indirectly through Electrospray Ionization (ESI). ESI relies on the protonation of basic residues (such as Lysine, Arginine, Histidine, and the N-terminus). The number of protons a protein can acquire during ionization depends heavily on its solvent-accessible surface area (SASA). Therefore, the mass spectrometer acts as a probe for the protein’s surface accessibility and physical shape.

  3. Spectral changes observed between Native and Denatured eGFP (Figure 2) Native eGFP (Figure 2, bottom): Because the protein is compact, only a limited number of basic residues on the outer surface are exposed to the solvent. As a result, the protein picks up fewer charges, causing the signals to appear at a higher m/z range (∼2500–3000 m/z). The charge state distribution is typically narrow, spanning only a few peaks.

Denatured eGFP (Figure 2, top): The extended polypeptide chain exposes previously buried basic residues to the solvent, allowing for maximum protonation. The protein picks up significantly more charges, which shifts the entire charge envelope toward a lower m/z range (∼700–1500 m/z). The envelope also becomes much broader due to the conformational flexibility of the unfolded chain.

Analogy: A folded origami crane has limited outer surface area available for stickers (charges) to adhere to. Once unfolded into a flat sheet of paper, every part of the surface is accessible, allowing for many more stickers. The weight of the paper remains identical, but the total sticker count directly reflects its structural shape.

Part III — Peptide Mapping - primary structure

Q1. Lysines and Arginines in eGFP

K (Lysine): 20 R (Arginine): 6 Total K + R cleavage sites: 26 Highlighted in the sequence (K and R in bold):

MVS[K]GEELFTG VVPILVELDG DVNGH[K]FSVS GEGEGDATYG [K]LTL[K]FICTT G[K]LPVPWPTL VTTLTYGVQC FS(R)YPDHM[K]Q HDFF[K]SAMPE GYVQE(R)TIFF [K]DDGNY[K]T(R) AEV[K]FEGDTL VN(R)IEL[K]GID [K]EDGNILGH[K]L EYNYNSHNVY IMAD[K]Q[K]NGI [K]VNF[K]I(R)HN IEDGSVQLAD HYQQNTPIGD GPVLLPDNHY LSTQSALS[K]D PNE([K])(R)DHMVL LEFVTAAGIT LGMDELY[K]LE HHHHHH

Q2. Predicted tryptic peptides

In silico digest (no missed cleavages, cleavage after K/R unless followed by P): 27 peptides total. PeptideMass with mass cutoff ≥500 Da returns ~17 peptides (filters out very small fragments like TR, QK, IR, single R).

Q3. Chromatographic peaks in TIC (0.5–6 min, >10% abundance) From Figure 5a, counting peaks above 10% relative intensity: ~15–17 peaks (the most prominent at 0.43, 0.61, 0.79, 1.20, 1.43, 1.80, 1.85, 1.93, 2.17, 2.26, 2.54, 2.78, 3.27, 3.53, 3.59, 3.70, 4.30, 4.48, 4.64, 4.87, 5.06, 5.43, 6.12, 6.50, 6.64, 6.73 — about 15 of these clearly exceed 10%).

Q4. Does peak count match predicted peptides? The TIC shows fewer peaks than predicted (~15 visible vs 27 predicted). Reasons:

Very small peptides (TR, QK, IR, R, NGIK) are below the MS detection range or wash out in the dead volume. Some peptides co-elute (overlap in retention time). Some hydrophilic peptides aren’t retained on C18 reverse-phase column.

Q5. Charge of the peak at 525.76712 Isotope spacing in Figure 5b inset: 525.76712 → 526.25918 → 526.76845 → 527.26998. Spacing ≈ 0.492 m/z.

$$z = \frac{1}{0.492} ≈ \mathbf{2}$$

Singly charged [M+H]⁺:

$$[M+H]^+ = z \times (m/z) - (z-1) \times 1.00728 = 2 \times 525.76712 - 1.00728 = \mathbf{1050.527\ Da}$$

Q6. Peptide identification and mass accuracy

Matching 1050.527 against the PeptideMass output → FEGDTLVNR (residues 115–123 of eGFP, theoretical monoisotopic [M+H]⁺ = 1050.5214 Da).

Mass error in ppm:

$$\text{ppm} = \frac{|1050.527 - 1050.5214|}{1050.5214} \times 10^6 ≈ \mathbf{5.3\ ppm}$$

Excellent accuracy (sub-10 ppm is standard for QTof).

Q7. Sequence coverage

From Figure 6: 88% of the eGFP sequence is confirmed by peptide mapping.

Waters Part IV — Oligomers

Based on the provided subunit masses in Table 1 (7FU=340 kDa=0.34 MDa; 8FU=400 kDa=0.40 MDa), the theoretical masses for each oligomeric state were calculated and matched with the experimental peaks observed in Figure 7: 7FU Decamer (Theoretical: 10×0.34 MDa=3.40 MDa) Identified Peak: Corresponds perfectly to the distinct peak labeled at 3.4 (or the adjacent shoulder at 4.013). 8FU Didecamer (Theoretical: 20×0.40 MDa=8.00 MDa) Identified Peak: Corresponds to the highest, most abundant base peak labeled at 8.33 (The slight mass shift is typical in intact CDMS due to residual salt/solvent adducts on large protein complexes). 8FU 3-Decamer (Theoretical: 30×0.40 MDa=12.00 MDa) Identified Peak: Corresponds to the prominent well-resolved peak labeled at 12.67. 8FU 4-Decamer (Theoretical: 40×0.40 MDa=16.00 MDa) Identified Peak: Corresponds to the low-abundance, broad clustered signals observed in the ~16.5–17.5 MDa region near the baseline (unlabeled due to low signal-to-noise ratio).

Waters Part V — Did I make GFP?

TheoreticalObserved (Intact LC-MS)PPM Mass Error
Molecular weight (kDa)28.007~28.097 (from deconvolution of Figure 1)~3,200 ppm (0.32%)

The observed intact mass agrees with the theoretical mass of eGFP+LE+His₆ to within ~0.3%. Combined with 88% peptide map coverage and confirmed FEGDTLVNR fragmentation → yes, this is eGFP.

Week 11 HW: Imaging and Measurement

Part A: The 1,536 Pixel Artwork Canvas | Collective Artwork

image image

HTGAA Community Bioart Reflection As part of the global community bioart project, I contributed 3 distinct pixels to the artwork under my profile yuxin-wang (#98 on the leaderboard)

Reflection: I really loved the concept of crowdsourcing a bio-art piece on a global scale. It beautifully bridged the gap between code-based collaboration (GitHub) and biological art concepts. However, for next year, I think the project could be improved by providing better real-time visualization of the collaborative canvas. A dynamic map showing live changes would help contributors see the immediate impact of their inputs within the context of the larger piece.At same time,there are too few colored squares, which leads to a sense of competition rather than cooperation. This is something we hope to improve upon next year.

Part B: Cell-Free Protein Synthesis | Cell-Free Reagents

Recording to Gemini:

Component Roles in CFPS

E. coli Lysate (BL21 (DE3) Star): Provides the essential molecular machinery, including ribosomes and chaperones, while the T7 RNA Polymerase drives the transcription of DNA into mRNA.

HEPES-KOH pH 7.5: Functions as a chemical buffer to maintain a stable pH, ensuring that enzymes and proteins remain folded and active throughout the reaction.

Potassium & Magnesium Glutamate: These salts provide the necessary ionic strength; specifically, magnesium is a critical cofactor for ribosome stability and polymerase activity.

Potassium Phosphates: Act as secondary buffers and provide a source of inorganic phosphate required for various metabolic cycles.

Ribose & Glucose: Serve as secondary energy sources that can be metabolized to regenerate ATP and provide carbon backbones for the reaction.

AMP, CMP, GMP, UMP: These are nucleoside monophosphates (NMPs) that serve as the building blocks for RNA synthesis and are phosphorylated into high-energy triphosphates (NTPs).

Guanine: A nitrogenous base that acts as a precursor for GMP, ensuring a steady supply of guanosine nucleotides.

Translation Mix (Amino Acids): Provides the 20 standard building blocks required for the ribosomes to assemble the polypeptide chain of the target protein.

Nicotinamide: Often added as a precursor for NAD +or NADP +, which are essential cofactors for the metabolic pathways that regenerate energy. Nuclease-Free Water: Acts as the solvent for the reaction, ensuring no contaminating enzymes degrade the DNA template or RNA transcripts.

Comparison of Master Mixes

The 1-hour PEP-NTP mix is designed for speed, utilizing high-energy Phosphoenolpyruvate (PEP) and pre-phosphorylated Nucleoside Triphosphates (NTPs) for immediate protein production. In contrast, the 20-hour NMP-Ribose-Glucose mix is built for sustained yield; it uses slower-metabolizing carbon sources and monophosphates (NMPs) to gradually regenerate energy, preventing the rapid inorganic phosphate buildup that typically inhibits shorter reactions.

Bonus: Transcription without GMP

Transcription can still occur because the E. coli lysate contains endogenous enzymes (such as phosphoribosyltransferases) that can salvage the Guanine base. By reacting Guanine with PRPP (phosphoribosyl pyrophosphate), the system can synthesize GMP de novo or through salvage pathways, which is then phosphorylated into the GTP required by the RNA polymerase.

image image

Resource:https://medicoapps.org/m-purine-salvage-pathway/

Part C: Planning the Global Experiment | Cell-Free Master Mix Design

6 Fluorescent Proteins: Biophysical & Functional Properties

1.Fluorescent Protein Property Analysis recording Gemini

sfGFP (superfolder GFP): Exhibits extremely strong folding stability, enabling it to fold correctly and maintain high fluorescence intensity even under rapid synthetic pressure in complex extracellular systems (cell-free systems).

mRFP1: Its main limiting property is oxygen dependence, as chromophore formation requires molecular oxygen, which may lead to limited fluorescence signal in closed 384-well plate reactions.

mKO2: The maturation time of this protein is significantly affected by pH, maturing faster under slightly alkaline conditions, thus requiring a high buffering capacity of the extracellular reaction system.

mTurquoise2: Possesses a high quantum yield, but its folding rate remains the limiting step, making its fluorescence output highly sensitive to translational kinetics.

mScarlet_I: Exhibits strong acid sensitivity; its fluorescence intensity may significantly decrease in the later stages of the reaction when the pH drops due to the accumulation of metabolic byproducts.

Electra2: As an ultra-fast maturation protein, its core advantage lies in its extremely short maturation time, making it ideal for real-time monitoring of protein expression in extracellular systems.

  1. Hypothesis for Cell-Free Optimization Since your goal is to maximize fluorescence over a long 36-hour incubation, the primary limiting factors are usually energy depletion and the degradation of the protein’s folding environment.

Protein: sfGFP (Green) Reagent(s): Magnesium Glutamate and Amino Acid Mix. Hypothesis: “By increasing the concentration of Magnesium Glutamate to optimize ribosomal activity and supplementing additional Amino Acids, I aim to extend the metabolic window of the cell-free reaction. Since sfGFP folds rapidly, providing a higher density of building blocks and enzymatic cofactors will maximize the total fluorescence yield over the full 36-hour incubation period.”

image image

4.My Customized 2 μL Supplement Plan:

Selected Protein: sfGFP (Well #98)

Components: 1 μL Magnesium Glutamate + 1 μL Amino Acid Mix.

Reasoning: Since sfGFP is a highly robust folder, the primary limiting factor for a 36-hour incubation is the depletion of building blocks and cofactors. By doubling the available amino acids and increasing magnesium levels (which stabilizes the translation machinery), I expect to maintain a high rate of protein synthesis late into the incubation period, leading to a higher cumulative fluorescence signal compared to the standard mix.

[ { “id”: “nuclease_free_water”, “supplemental_volume_nl”: 1900 }, { “id”: “magnesium_glutamate”, “supplemental_volume_nl”: 50 }, { “id”: “aa_mix_17”, “supplemental_volume_nl”: 50 } ]

image image

Week 2 HW:Dna Read Write and Edit

Part 1 Benchling & In-silico Gel Art

Limbda Sequence Import

Limbda gel electrophoresis

image image

image image

Part 2 Gel Art - Restriction Digests and Gel Electrophoresis

The style of Paul Vanouse’s Latent Figure Protocol artworks image image

Part 3 DNA Design Challenge

Protein choose: Oxytocin-neurophysin 1 (Prairie Vole)
[image image

Why: I chose this protein from the prairie vole (Microtus ochrogaster) because these rodents are famous models in neuroscience for studying monogamy and social bonding. Oxytocin is the key molecular driver of their lifelong pair-bonding behavior. Sequence (FASTA):
sp|E0V840|OXYT_MICOC Oxytocin-neurophysin 1 OS=Microtus ochrogaster OX=10031 GN=Oxt PE=3 SV=1
MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDTRKCLPCGPGGKGRCFGPNICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGVCCSPDGCRMDPACDPESAFSER

  • I take the Oxytocin(Prairie Vole)sequence from the Uniprot image image

  • I use bioinformatic to reverse translate the protein by bioinformatic

Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence

gcgtgcgatgaatttggccatattaaactgatgaacccgcagcgcagcaccgtgtggtat taaatggcgggcccgagcctggcgtgctgctttctgggcctgctggcgctgaccagcgcg tgctatattcagaactgcccgctgggcggcaaacgcgtgctggatctggatgtgcgcacc tgcccgccgtgcggcccgggcggccgcggccgctgctttggcccgagcatttgctgcgcg gatgaactgggctgctttgtgggcaccgcggaagcgctgcgctgccaggaagaaaactat ctgccgagcccgtgccagagcggccagaaagcgtgcggcagcggcggccgctgcgcggcg ctgggcctgtgctgcagcccggatggctgccatgcggatccggcgtgcgatgcggaagcg acctttagccagcgc

Codon Optimization I have chosen Escherichia coli (E. coli) as the host organism for optimization.

Reason: E. coli is the gold standard “workhorse” in synthetic biology and biotechnology. It has a very rapid growth rate, its genetics are thoroughly understood, and it is highly cost-effective for large-scale recombinant protein production. By optimizing the Prairie Vole oxytocin sequence for E. coli, we ensure that the bacteria can efficiently “read” the instructions and produce high concentrations of the hormone for research or industrial use

Sequence:

gcgtgcgatgaatttggccatatcaagctgatgaacccgcagcgttccaccgtgtggtat taaatggcgggtccgagcctggcgtgctgcttcctgggcctgctggcgctgaccagcgcg tgctacatccagaactgcccgctgggcggcaaacgtgtgctggatctggatgtgcgcacc tgcccgccgtgcggtccgggcggtcgtggccgttgctttggcccgagcatctgctgcgcg gatgaactgggctgctttgtgggcaccgcggaagcgctgcgttgccaggaagaaaactac ctgccgagcccgtgccagagcggccagaaagcgtgcggtagcggcggtcgttgcgcggcg ctgggcctgtgctgcagcccggatggctgccatgcggatccggcgtgcgatgcggaagcg accttcagccagcgt

https://benchling.com/s/seq-8tGivOKSZJUUVEjLY7cE?m=slm-y1fK0BVnbJ3uF2UYnwf2

Part 4: Prepare a Twist DNA Synthesis Order

Build MY DNA Insert Sequence

  • I imported Oxytocin-neurophysin 1 (Prairie Vole) using Benchling and created an annotation to describe each piece.
image image

image image)

  • And then, in the Twsit, the DNA sequence was virtually combined with the vector and exported as a Genbank document.
twsit twsit
  • This is the plasmid i just built with my expression cassette included. Congratulations on building my first plasmid!
Plasmid Plasmid

Part 5: DNA Read/Write/Edit

DNA Read
What DNA would you want to sequence (e.g., read) and why? This could be DNA related to human health (e.g. genes related to disease research), environmental monitoring (e.g., sewage waste water, biodiversity analysis), and beyond (e.g. DNA data storage, biobank).

Target DNA: The frozen cell DNA of endangered or extinct species (such as the Bucardo Pyrenean goat or the mammoth) stored in biological repositories like the San Diego Zoo’s “Frozen Zoo”. +2 Reason: These DNA molecules are not merely chemical entities; they are carriers of “Salvage Genomics”. By reading these DNA sequences, we can transform the organism into a “biological information unit”, which is the first step towards achieving “functional de-extinction”, that is, identifying the key genetic characteristics (Functional Traits) that define the species.

(ii) In lecture, a variety of sequencing technologies were mentioned. What technology or technologies would you use to perform sequencing on your DNA and why?
Is your method first-, second- or third-generation or other? How so?
What is your input? How do you prepare your input (e.g. fragmentation, adapter ligation, PCR)? List the essential steps.
What are the essential steps of your chosen sequencing technology, how does it decode the bases of your DNA sample (base calling)?
What is the output of your chosen sequencing technology?

Technology: Illumina short-read sequencing (NGS) combined with PacBio or Oxford Nanopore (long-read sequencing). Reason: Biological sample libraries (such as cells frozen for several decades) may be subject to degradation. Illumina offers high-precision base coverage, and long-read sequencing is helpful in reconstructing the complete genomic map of extinct species without a reference genome, through De Novo Assembly.

Input and Preparation Steps (Library Preparation):

The genomic DNA extracted from the Frozen Zoo samples, which have been frozen for several decades. Key steps:

Fragmentation: Break down the extracted long-chain DNA. Adapter Ligation: This process connects the specific primers required for sequencing with the sample labels. Library enrichment: The target fragment is amplified through PCR (if it is a second-generation method).

Core steps of sequencing and base identification (Base Calling):

Step: Synthesize fluorescently labeled bases on the flow cell (for sequencing by synthesis method). Base Calling: The machine captures the color of the fluorescence signal produced by each cycle, and converts it into an A, T, C, G sequence through an algorithm.

What is the output?

Output: FASTQ format file containing sequence information and quality scores

DNA Write (i) What DNA would you want to synthesize (e.g., write) and why?

Objective: To synthesize DNA fragments encoding specific functional traits of mammoths (such as cold-resistant hemoglobin genes or thick fur genes). Reason: During the process of extinction, we cannot directly “revive” the old life forms. Instead, by writing these specific sequences, we use them as “designable materials” to create a new organism capable of performing ecological functions (as Novak described it as an ecological substitute). +1

(ii) What technology or technologies would you use to perform this DNA synthesis and why?

Technology: Inkjet-based (inkjet-based) high-throughput DNA synthesis or enzymatic synthesis. Reason: The enzymatic synthesis method is more environmentally friendly and can synthesize longer DNA fragments, making it suitable for synthesizing complex and large-scale genetic circuits like that of a mammoth.

DNA Edit (i) What DNA would you want to edit and why?

Objective: Use the genome of Asian elephant stem cells as a template to remove the specific sites that do not match those of the mammoth. +2

Reason: This editing behavior exemplifies the “deconstruction of species essentialism” as mentioned in RP - species are no longer fixed boundaries, but rather a set of “programmable function libraries” that can be modified, stored, and recombined.

(ii) What technology or technologies would you use to perform these DNA edits and why?
How does your technology of choice edit DNA? What are the essential steps?
What preparation do you need to do (e.g. design steps) and what is the input (e.g. DNA template, enzymes, plasmids, primers, guides, cells) for the editing?
What are the limitations of your editing methods (if any) in terms of efficiency or precision?

What technology is being used?

Technology: CRISPR-Cas9 gene editing technology. Reason: It can precisely and efficiently perform multi-site editing within the vast elephant genome, which is the core technology currently adopted by companies like Colossal.

How to conduct editing? Key steps

Design: Design sgRNAs that specifically recognize the genetic loci of mammoth animals. Cutting: The Cas9 protein cuts the double-stranded DNA under the guidance of the gRNA. Repair: Introduce synthetic mammoth DNA template and use homologous recombination repair (HDR) to insert the new sequence into the genome.

Preparation and Input

Input: Asian elephant fibroblast cells, Cas9 protein, designed guide RNA (gRNA), and donor DNA template containing the mammoth sequence.

Limitations of Technology

Off-target effects: May accidentally damage the key survival genes in the Asian elephant genome. Efficiency issue: It is extremely difficult to carry out thousands of gene edits simultaneously within a living cell. Ethical challenges: As you stated in your report, this kind of editing blurs the boundaries between “nature” and “design”, and may give rise to entirely new and difficult-to-define “new life (Neolife)”.

Week 3 HW:Lab Automation

Python Script for Opentrons Artwork

My Inspiration

image image

In taxonomy, Bucardo belongs to the genus Capra (goats). In my Opentrons practice, I discovered that the mosaic pattern formed by fluorescent bacteria blurred the boundaries between specific species and macroscopic classification. I am not depicting an exact sheep, but rather using the universality of the “Capra” attribute to reconstruct an image of “Resurrection for 7 Minutes”. This mosaic-like visual language is not only a numerical metaphor for Bucardo’s shattered life, but also a vague expression about ’existence and disappearance’ that transcends species classification.

Process

Firstly, I initially used the Automatic Art Interface to generate the image I desired. However, due to the color restrictions mentioned in the Colab document, I had to limit the use of the design sheep’s colors. image image

Since I had no coding experience, at the beginning I simply copied the coordinates and fed them to the AI along with the reference seven, in order to generate the code.

However, during the process, several errors occurred, including confusion between instructions and spaces, a situation where the machine pipette’s printing exceeded the capacity, and undefined terms such as: mko2_points and mrfp1_points.

After resolving these minor errors, when I copied the code given by the AI, there were still several errors in the generated code. I did not achieve the pattern I wanted.

image image

After reflection, taking into account the previous mistakes, I realized that I had not clearly stated where to draw specifically. Therefore, I shifted my focus to how to make the coordinates and colors I obtained clearly expressed in the coding. After correcting the overflow error, I continued to give instructions to the AI.

Promote:Based on the code you provided, the image I generated is the first one. Please refer to the coordinates I set in the generator and help me modify the code further.

This time, the instruction, combined with the errors I had already fixed before, enabled me to generate my target image. The coding is divided into two parts. 1.Define the coordinate list 2.The drawing process.

Coding

image image

Outcome

image image

Post-Lab Questions

I have found two papers that I am particularly interested in.

Automation of protein crystallization scaleup via Opentrons-2 liquid handling

image image

Description: This paper demonstrates how to scale up and automate the sitting drop protein crystallization process using the Opentrons-2 (OT-2) robot. The research focuses on using Python scripts to precisely control microliter-level liquid handling to optimize crystallization conditions for proteins such as lysozyme. Technical Highlights: The authors developed a flexible automated workflow, including: Serial Dilution: The robot can automatically configure gradients of different precipitant concentrations. Custom Hardware: To accommodate non-standard crystallization plates, the authors used 3D printing to create dedicated adapters. High Throughput and Accuracy: The system can automatically set up 24-well crystallization plates, ensuring highly consistent component proportions in each tiny droplet (approximately 4 μL).

What I intented to do

I plan to use the OT-2 automation platform to create a project titled “Crystal Architecture: Programming Microscopic Landscapes”. This project aims to leverage the self-organizing nature of protein crystallization, under artificial intervention (code), to “grow” microscopic artworks with complex geometric structures on specific biological substrates.

Automation of protein crystallization scaleup via Opentrons-2 liquid handling

image image

Description: This paper introduces a highly integrated automated system called Piccolo, which is specifically designed to address the bottlenecks in protein production. The core innovation of this system lies in its ability to automate the entire process from cell culture, growth monitoring (OD value), induction of expression, to protein purification. Technical highlights: Unlike traditional timed operations, the Piccolo system can dynamically adjust (Reschedule) the induction time based on the real-time growth curve of cells in each 24-well bioreactor. This means that the robot can “sense” the rhythm of life and add the inducer at the most appropriate moment.

What I intented to do

This system not only supports the cultivation of Escherichia coli, but also that of insect cells (animal-derived cells). In my exploration of biological art, this provides an opportunity to view the “molecular purification” process as “artistic transformation of matter”. It demonstrates how, through precise automated control, pure biological art media with specific colors (such as fluorescent proteins) can be extracted from turbid biomass.

Final Idea

image imageimage imageimage image

Week 4 HW: Protein design part 1

cover image cover image

Part A. Conceptual Questions

1.Why do humans eat beef but do not become a cow, eat fish but do not become fish?

Because the human body completely breaks down exogenous proteins into free amino acids. And the DNA re-directs these amino acids to be arranged in the human sequence, rather than the sequence of cows or fish.

2.Why are there only 20 natural amino acids?

The 20 amino acids can already fulfill the basic chemical requirements such as hydrophobicity, hydrophilicity and electronegativity. Adding more amino acid types would require corresponding tRNAs and synthetases, and the evolutionary cost would be too high.

3.Can you make other non-natural amino acids? Design some new amino acids.

Possible: By expanding the genetic code, scientists have synthesized over 100 types of non-natural amino acids. For example, photosensitive amino acids: The side chains carry light-sensitive groups, allowing the proteins to be controlled by ultraviolet light.

4.Where did amino acids come from before enzymes that make them, and before life started?

Miller-Urey experiment: In the original atmospheric environment (lightning + water vapor + methane + ammonia), simple amino acids (such as glycine and alanine) can be spontaneously synthesized.

5.If you make an α-helix using D-amino acids, what handedness (right or left) would you expect?

Left-handed

6.Can you discover additional helices in proteins?

π helix: wider and flatter, often found near functional sites.

7.Why are most molecular helices right-handed?

The steric hindrance of the side chains of L-amino acids determines that they have lower energy and are more stable when forming right-handed helices.

8.Why do β-sheets tend to aggregate? What is the driving force for β-sheet aggregation?

Open hydrogen bond network: The peptide bonds (backbone) at the edges of β-sheets have unpaired hydrogen bond donors (-NH) and acceptors (-C=O). The main driving force: Inter-strand Hydrogen Bonding.

Physical mechanism: Since the hydrogen bonds at the edge do not get completely counteracted as in the α-helix, they act like “nylon snaps”, constantly attracting and capturing adjacent peptide chains to lower the system energy.

9.Why do many amyloid diseases form β-sheets? Can you use amyloid β-sheets as materials?

Causes of the disease: Extremely high thermodynamic stability: The β-sheet can be infinitely extended through the “cross-β” structure, forming stable fibers with extremely low energy. Error folding cascade: A misfolded β-template will induce the normal protein to also transform into β-folding, resulting in a domino-like aggregation effect, which can lead to diseases such as Alzheimer’s or Parkinson’s.

As for material application: Feasibility: Absolutely possible. Amyloid β-fibers possess astonishing mechanical strength (comparable to steel wires or silk) and biocompatibility. Usage: It has currently been applied in the design of biological nanoscaffolds, conductive nanowires, and controlled-release drug carriers.

Part B: Protein Analysis and Visualization

Protein:Green fluorescent protein

Reason:

GFP is an ideal model for studying protein “folding resilience”. Its compact “cylindrical” structure ensures that the overall structure remains stable even when there are significant mutations on the surface. As a researcher focusing on species design and life information, GFP is not only a fluorescence labeling tool but also a symbol of information visualization in synthetic biology. It demonstrates how the genetic code can directly be transformed into visible colors for the naked eye.

Sequence:

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Account: image image

Family:

Using the UniProt BLAST tool, I identified 205 sequence homologs for the GFP sequence (P42212). The protein is a member of the GFP family (Pfam: PF01353), characterized by its conserved structural and functional domains.

image image

Identify the structure page of your protein in RCSB:

It was published by J AM Chem at 2006,really good quality structure only 1.2 Å image image

  • Structure Quality: This structure was solved on April 18, 2006, using X-ray diffraction. It is of exceptional quality with a resolution of 1.20 , which is significantly better than the 2.70 
  • Ligands and Molecules: Apart from the protein chain, the solved structure contains a Magnesium ion (MG) as a unique ligand, as well as several water molecules.
  • Classification and Family: The protein belongs to the GFP family (Pfam: PF01353) and is classified under the GFP-like structural family. It features a distinct “light-can” fold that protects the internal chromophore.

3D molecule visualization:

Visualize the protein as “cartoon”, “ribbon” and “ball and stick”. image image
These structures have been particularly helpful in allowing me to understand the different structural perspectives of proteins.
Visualizing the protein in different modes allows for a comprehensive understanding of its multi-level organization. The cartoon mode highlights the global architecture (the β-barrel), the ribbon mode tracks the path of the polypeptide backbone, and the ball-and-stick model reveals the intricate atomic interactions and the precise positioning of side chains within the internal chromophore environment.

Secondary Structure:

image image
  • Observation result: In the rendered image of PyMOL (such as Secondary Structure.jpg), the protein is colored as purple β-sheet and light green α-helix.
  • Structural comparison: This protein clearly possesses a significantly greater number of folding sheets.
  • Detailed analysis: As a classic β-barrel structure, it is formed by 11 antiparallel β-sheet chains, enclosing a closed cylindrical shell. The α-helices are only present in the center of the barrel and in the short loops connecting the folding segments.

Hole: image image
The surface of GFP is highly compact with no functional pores or binding pockets. The cyan-colored indentations are simply the result of the 11 β-strands packing tightly together. This ‘molecular cage’ creates a shielded, hydrophobic core that protects the chromophore from external quenchers, ensuring stable fluorescence。

Part C. Using ML-Based Protein Design Tools

C1. Protein Language Modeling

image image

One noticeable pattern in the heatmap is that mutations to cysteine (C) (W) across many positions show very low scores (dark purple). This suggests that introducing cysteine residues is generally unfavorable for this protein. A possible explanation is that cysteine can form disulfide bonds, which may disrupt the existing protein structure if introduced at inappropriate positions.

image image I was not able to clearly locate my specific sequence in the map, the overall distribution indicates that the sequences occupy a shared region of latent space, consistent with proteins that have related sequence characteristics.

C2. Protein Folding

image imageimage image

C3. Protein Generation

image image

Week 5 HW:Protein Design Part-ii

Part A: SOD1 Binder Peptide Design

Part 1: Generate Binders with PepMLM

Generate four peptides of length 12 amino acids conditioned on the mutant SOD1 sequence.

image image

Among the generated sequences, WRYPAAAAELKK (7.61) stands out the most. It has a lower perplexity than the other generated sequences, indicating that it may be more compatible with the pocket of the SOD1 A4V mutation site in terms of chemical environment and geometric conformation.

Part 2: Evaluate Binders with AlphaFold3

For each peptide, I submit the mutant SOD1 sequence followed by the peptide sequence as separate chains to model the protein-peptide complex. And I analysis these 4 peptide from different perspective inculding engagement of the β-barrel region,surface-bound, ipTM values ,peptide matches.

image imageimage imageimage imageimage image

Part 3: Evaluate Properties of Generated Peptides in the PeptiVerse

image image
  1. Therapeutic Properties and Structural Observations: Comparative Analysis

By comparing the predicted data from PeptiVerse with the structural observations of AlphaFold3, we can draw the following conclusions:

Conformity between Binding Force and ipTM: Generally, short peptides with higher ipTM scores exhibit more stable interfacial interactions. In your prediction list, WRYPAAAAELKK showed the lowest perplexity score (7.61), which typically indicates stronger binding potential.

Solubility & Hemolysis:

Solubility: All candidate peptides (Binder 0-3) were predicted as Soluble (probability 1.000), which is a very desirable signal in therapeutic development.

Hemolysis: Most designs performed well and were predicted as Non-hemolytic. WRYPAAAAELKK showed an extremely low probability of hemolysis (0.005), indicating very high safety. In comparison, WLYYVVAVAWKK has a slightly higher hemolysis prediction probability (0.172), and although it is still classified as non-hemolytic, its safety profile is slightly inferior to other candidates.

The best performer in terms of attribute balance: WRYPAAAAELKK achieves the optimal balance between binding confidence, complete solubility, and extremely low risk of hemolysis.

  1. Final Candidate Short Peptide Selection and Rationale

WRYPAAAAELKK

Rationale: This short peptide stood out in the PepMLM score, possessing the lowest Pseudo Perplexity (7.61), indicating the model’s strongest confidence in its binding to SOD1 (A4V). In therapeutic property prediction, it not only demonstrated perfect solubility prediction (1.000) but also exhibited excellent safety indicators, with an ultra-low hemolysis probability of 0.005, making it the most robust therapeutic candidate. Its acid-base balance (pI 9.38) and hydrophobicity index (GRAVY -0.72) also suggest good biochemical stability in the complex physiological environment within cells.

Part 4: Generate Optimized Peptides with moPPIt

Using the Multi-Objective Guided Discrete Flow Matching (MOG-DFM) framework, two highly optimized 12-mer peptide candidates were generated targeting the specific motif of the A4V mutant SOD1 sequence:

Candidate 1: CTQGMNVAYEWL

Hemolysis Score: 0.0564 (Lower means safer/less toxic)

Solubility Score: 0.9998 (Highly soluble)

Affinity Score: 5.2750

Motif Score: 0.3151

image image

Candidate 2: VCEEWQLEFLCE

Hemolysis Score: 0.0324 (Excellent safety profile)

Solubility Score: 0.9998 (Highly soluble)

Affinity Score: 5.8080 (Slightly stronger predicted binding than Candidate 1)

Motif Score: 0.2732

image image
  1. Comparative Analysis: moPPIt vs. PepMLM Peptides

When comparing the moPPIt-generated peptides against my selected PepMLM peptide (WRYPAAAAELKK), the results demonstrate a major paradigm shift from probabilistic sampling to controlled, multi-objective design:

Spatial Specificity (Targeted vs. Blind Sampling): My PepMLM peptide was sampled purely based on statistical plausibility (Pseudo Perplexity: 7.61) across the entire SOD1 sequence, offering no control over the exact binding site. In contrast, moPPIt utilizes an explicit Motif guidance constraint. This forces the generative flow to target the specific pathological pocket—such as the A4V mutation site (residue 4) or the dimer interface—making moPPIt highly site-specific and biologically targeted.

Property Optimization (Embedded Flow vs. Screening Luck): While my PepMLM peptide yielded excellent baseline properties (Solubility: 1.000, Hemolysis: 0.005), this relies entirely on post-generation screening luck—if a sampled peptide fails, the user must blindly resample. Conversely, moPPIt integrates property optimization directly into its generative flow. It simultaneously balanced high affinity (5.27−5.80) and motif alignment while inherently securing near-perfect solubility (0.9998) and safe hemolysis profiles (0.03–0.05).

Week 6 HW: Genetic Circuits Part 1

Assignment: DNA Assembly

1.What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose?

Phusion is an enzyme commonly used for high-precision cloning. Its Master Mix typically contains the following core components:Phusion DNA Polymerase: The core enzyme. It possesses 3’→5’ exonuclease activity (proofreading function), ensuring high fidelity DNA replication with an extremely low error rate. dNTPs (dATP, dTTP, dCTP, dGTP): The “raw materials” for building new DNA strands.Mg²⁺ (usually MgCl₂): A cofactor for the polymerase. It stabilizes primer-template binding and activates the enzyme’s catalytic center. Buffer: Maintains a constant pH and provides suitable ionic strength to ensure enzyme activity.

2.What are some factors that determine primer annealing temperature during PCR?

The primer annealing temperature (Ta) is typically 3-5°C lower than the primer melting temperature (Tm). Influencing factors include:1. Primer length: Usually between 18-30 bp; longer primers generally result in higher Tm. 2.GC content: G-C base pairs have 3 hydrogen bonds, while A-T pairs only have 2. Therefore, higher GC content leads to higher Tm. 3.Salt ion concentration: The concentration of monovalent cations (such as Na+, K+) and divalent cations (Mg2+) in the reaction system neutralizes the negative charge of the DNA backbone; higher concentrations result in higher Tm.4.Mismatch degree: Imperfect matching between primers and templates significantly reduces annealing efficiency and temperature.

3.There are two methods from this class that create linear fragments of DNA: PCR, and restriction enzyme digests. Compare and contrast these two methods, both in terms of protocol as well as when one may be preferable to use over the other.

Reaction Mechanism and Principle:PCR is an in vitro enzymatic amplification process that uses primers to guide polymerase to synthesize new strands de novo on a DNA template. Restriction enzyme digestion, on the other hand, is an enzymatic cleavage process that uses restriction endonucleases to recognize specific sequence sites and “cut” the DNA; it does not involve the synthesis of new DNA.

Product properties and yield: PCR can achieve exponential amplification of target fragments, obtaining a large number of DNA fragments from a very small amount of template; in contrast, restriction enzyme digestion produces fragments in a fixed ratio to the starting material, with no increment.

Design flexibility: PCR has extremely high flexibility. Researchers only need to design corresponding primers based on the target sequence to obtain DNA fragments at almost any position. In contrast, restriction enzyme digestion is strictly limited to the enzyme sites that are naturally present or artificially constructed in the DNA sequence. Without suitable recognition sites, it is impossible to perform cleavage.

Advantages, disadvantages, and accuracy: The advantages of PCR are its speed and high yield, which can quickly obtain a large amount of target DNA. However, since it is artificially synthesized, base mutations may be introduced during the process. Restriction enzyme digestion can completely maintain the accuracy of the original sequence and will not produce new mutations, but its application is highly dependent on the specific sequence background.

4.How can you ensure that the DNA sequences that you have digested and PCR-ed will be appropriate for Gibson cloning?

Designing Overlapping Regions: Adjacent fragments must have 20-40 bp of homologous overlapping sequences. These are typically added to the 5’ end of PCR primers.

End Integrity: PCR products require purification to remove excess primers and single nucleotides; restriction enzyme digestion must ensure clean cuts that conform to the overlap design.

Conflict Elimination: Ensure that the fragments do not contain extremely strong secondary structures that conflict with the Gibson reaction temperature (50°C).

5.How does the plasmid DNA enter the E. coli cells during transformation?

Competent cell treatment: Cells are treated with CaCl₂, which bridges the negatively charged DNA phosphate backbone to the equally negatively charged phospholipid layer of the cell membrane via Ca²⁺ ions.

Heat shock: The mixture is rapidly transferred from 0°C to 42°C. This abrupt temperature change creates transient “thermal pores” on the cell membrane, allowing DNA to enter the cell via an electrochemical gradient.

6.Describe another assembly method in detail (such as Golden Gate Assembly)

Golden Gate Assembly utilizes type II S restriction enzymes (such as BsaI or BsmBI) and T4 DNA ligase in the same reaction system. A characteristic of type II S enzymes is that their cleavage sites are located outside the recognition sites, allowing researchers to fully customize the resulting 4bp sticky ends. Through careful design, these recognition sites are removed after cleavage, preventing further cleavage of the product. This method can precisely assemble multiple fragments (typically more than 10) at once, and it is directional. Because the recognition sites are ultimately eliminated, it is also known as “traceless assembly.”

Assignment: Asimov Kernel

image image

Functional Expectation Based on the logic of the negative feedback loop, it is expected that this system will not reach a steady state but will instead generate continuous periodic oscillations. When the concentration of one protein increases, it will suppress the expression of the next gene, causing the concentration of the next protein to decrease, thereby releasing the suppression on the next gene.

image image

Simulation Results & Data Analysis

The chart shows the distinct alternating oscillation behavior of the three components (LacI, LambdaCI, TetR). There is a fixed phase difference between the peaks of each component, which proves that the delay inhibition logic in the loop is operating normally. The oscillation tends to stabilize after approximately 10 hours, maintaining a constant amplitude and frequency.

Construct 1

image image

Based on the classic Repressilator (with three genes: LacI, LambdaCI, and TetR) circuit, I added an sfGFP expression cassette. The fourth group of components is driven by the pTetR promoter and expresses sfGFP. Since pTetR is inhibited by the TetR protein within the system, the expression of sfGFP should be able to reflect the real-time dynamic state of the oscillator.

image image

It is expected that within the 70-hour simulation period, sfGFP will generate continuous periodic fluctuations in conjunction with LacI, LambdaCI and TetR. The simulation curve shows that the system exhibits distinct oscillatory characteristics in the first 10 hours of the simulation. However, as time progresses, the amplitude of the oscillations gradually diminishes (Damped Oscillation), and eventually reaches a stable steady state (Steady State) approximately 20 hours later.

Construct 2

image image

Unlike the independent report branch of Plan 1, in Plan 2, the coding sequence of sfGFP is directly connected to the end of the repressor protein LacI, forming a single transcription unit: pTetR -> A1 RBS -> LacI -> sfGFP -> Terminator.

image image

Plan 2 did not exhibit attenuation! This indicates that the way of fusing the proteins has a lesser impact on the system’s dynamic equilibrium, thus maintaining a long-term periodic behavior.

Week 7 HW: Genetic Circuits Part 1

Assignment Part 1: Intracellular Artificial Neural Networks (IANNs)

1.IANNs vs. Traditional Genetic Circuits (Boolean Functions)

Traditional genetic circuits are typically Boolean logic (0 or 1), meaning the output is only triggered when both inducers reach high concentrations simultaneously. In contrast, IANNs offer the following advantages:

Analog/Graded Response Processing: Traditional circuits are prone to abrupt changes near a threshold. IANNs can handle analog inputs, achieving “weighted summarization,” allowing cells to respond linearly or with finer nonlinear responses to subtle changes in signal strength.

High-Dimensional Integration: The intracellular environment is extremely complex. With each additional input to a Boolean gate, circuit complexity and crosstalk increase exponentially; IANNs, however, can aggregate signals through multiple “weak connections,” leveraging the robustness of neural networks to filter biological noise.

2.Potential Applications, Inputs, Outputs, and Limitations of IANNs

IANN can be used for precise multi-signal cancer detection. It takes three different concentrations of microRNAs (miRNAs) in the cell as input and outputs apoptosis-inducing proteins only when multiple indicators are abnormal at the same time. However, it has obvious limitations. Maintaining the deep network requires the expression of a large number of intermediate proteins, which puts metabolic pressure on the cell and consumes too much energy. Also, because transcription and translation of each layer takes time, the more layers there are, the more obvious the cell response delay becomes.

3.Draw a diagram for an intracellular multilayer perceptron where layer 1 outputs an endoribonuclease that regulates a fluorescent protein output in layer

image image

This design depicts a two-layer Intracellular Artificial Neural Network (IANN) where Layer 1 (X1) produces an intermediate endoribonuclease (ERNA) that acts as a hidden inhibitory signal; this signal modulates the combined transcriptional activity of Layer 2 (X2) and the bias term (B1), collectively determining the final expression level of the fluorescent protein output (Y).

Assignment Part 2: Fungal Materials

What are some examples of existing fungal materials and what are they used for? What are their advantages and disadvantages over traditional counterparts?

image image

The mycelium (fungal mycelium) as a practical application of sustainable and environmentally friendly packaging materials. By mixing the mycelium (the root-like structure of fungi) with agricultural waste (such as straw or rice husks) and placing it in a specific-shaped mold to grow, custom protective packaging blocks can be created. It is completely biodegradable and compostable: as an alternative to traditional plastic packaging such as Styrofoam, it can be safely returned to nature after use. Compared with other materials:

  1. It is customizable: Specific molds can be used to grow packaging blocks of any shape and size as needed, to precisely cushion and protect delicate or fragile items.
  2. Excellent protective performance: The mycelial network is not only sturdy but also has certain elasticity and shock absorption properties, making it highly suitable for use as protective packaging.

What might you want to genetically engineer fungi to do and why? What are the advantages of doing synthetic biology in fungi as opposed to bacteria?

I would like do Engineered Fungal Logic Gates for Environmental Monitoring

Objective: To genetically engineer a fungal mycelium network that functions as a biological “Logic Gate” to detect and report environmental pollution (e.g., heavy metals and pesticide runoff).

Why Fungi for this task?

Bioremediation Integration: Fungi don’t just detect pollution; they often naturally break down hydrocarbons or accumulate heavy metals. We are essentially giving a “voice” to an organism already doing the cleanup work.

Large Scale Sensing: A single fungal colony can span acres. By engineering the network, we create a “living sensor” that can monitor an entire forest floor or industrial site without needing electronic sensors or batteries.

Durability: Unlike sensitive electronic equipment, a fungal logic gate is self-healing and can survive in acidic or fluctuating soil conditions where traditional sensors might corrode.

Week 9 HW: Cell Free System

Homework Part A: General and Lecturer-Specific Questions

1.Explain the main advantages of cell-free protein synthesis over traditional in vivo methods, specifically in terms of flexibility and control over experimental variables. Name at least two cases where cell-free expression is more beneficial than cell production.

Advantages:1.Flexibility and Control: You can directly adjust the reaction system, such as changing pH, ion concentration, or adding non-natural amino acids, without worrying about “killing” cells.2.Openness: The system is open; you can monitor the reaction process in real time or directly add linear DNA without constructing complex plasmids.

Applications:Synthesis of Toxic Proteins: Some proteins kill host cells but can be safely produced in a cell-free system.

2.Describe the main components of a cell-free expression system and explain the role of each component.

Crude Extract: Contains ribosomes, RNA polymerase, and translation factors (the “factories” for protein synthesis).

Energy Source: Such as phosphoenolpyruvate (PEP), providing the driving force for the reaction.

Amino Acids: The raw materials for protein synthesis.

Cofactors and Salts: Such as Mg²⁺ and K⁺, maintaining enzyme activity.

DNA Template: Contains instructions that encode the target protein.

3.Why is energy provision regeneration critical in cell-free systems? Describe a method you could use to ensure continuous ATP supply in your cell-free experiment.

Importance: Protein synthesis is an extremely energy-intensive process. If ATP is depleted, the reaction will immediately cease, and the accumulation of byproducts (such as inorganic phosphate) will inhibit the reaction.

Methods to ensure a continuous supply of ATP: Use an energy regeneration system: Add creatine phosphate and creatine kinase. Creatine phosphate continuously converts ADP back into ATP, maintaining stable energy levels.

4.Compare prokaryotic versus eukaryotic cell-free expression systems. Choose a protein to produce in each system and explain why.

1.Structure

The prokaryotic system has a very simple structure; transcription and translation occur almost simultaneously, resulting in an extremely fast reaction rate. The eukaryotic system has a more complex mechanism, better mimicking the internal environment of complex organisms.

2.Protein folding and modification capabilities

Prokaryotic systems typically lack the ability to handle complex folding. Eukaryotic systems, on the other hand, are equipped with various “helpers” (molecular chaperones) that enable them to perform crucial post-translational modifications (such as glycosylation and disulfide bond formation), which are essential for proteins to exhibit biological activity.

5.Imagine you observe a low yield of your target protein in a cell-free system. Describe three possible reasons for this and suggest a troubleshooting strategy for each.

Cause: Template DNA degradation. Strategy: Check DNA purity, or add RNase inhibitors to prevent mRNA degradation.

Cause: Energy depletion or pH shift. Strategy: Optimize the energy regeneration system, or use dialysis to continuously replenish substrate and remove metabolic waste.

Cause: Protein misfolding leading to degradation. Strategy: Lower the reaction temperature (e.g., from 37°C to 25°C), or add molecular chaperones to assist folding.

Homework question from Kate Adamala

Synthetic Minimal Cell Design: The Hotpot Odor Eliminator(Gemini Help)

  1. Function & Operation Description

What it would do: This synthetic cell is designed as a fabric spray to eliminate the stubborn “hotpot smell” from clothes. The signature smell of hotpot comes primarily from volatile organic compounds, notably sulfur-containing compounds (like dimethyl sulfide from garlic and onions) and pyrazines (from roasted spices and oils). This synthetic cell senses these oily odor molecules on the fabric, actively absorbs them, and enzymatically neutralizes them into completely odorless molecules.

Input: Dimethyl Sulfide (DMS) and Pyrazines (The dominant volatile organic compounds causing the hotpot odor).

Output: Odorless sulfoxides and cleaved non-volatile fragments (completely neutral scents).

  1. Structural & Component Design Membrane Composition The membrane needs to interact with clothing fibers and oily food odors: POPC (a standard phospholipid) mixed with DOPE (1,2-dioleoyl-sn-glycero-3-phosphoethanolamine). Reasoning: DOPE increases the hydrophobicity and fluidity of the membrane, allowing it to easily trap and dissolve the greasy, airborne hotpot oil droplets present on the fabric.

Encapsulation Inventory Machinery: A robust Bacterial Cell-Free Expression System (like E. coli PURExpress). Why bacterial instead of mammalian this time? Because we are working in an open-air environment on clothes, we need a system that is highly stable, cheap to produce, and does not require complex mammalian temperature/co-factor controls. Genetic Blueprint: Plasmids encoding the odor-degrading enzymes. Internal Fuel: A pre-packaged mix of 20 amino acids, ATP/GTP energy molecules, and magnesium salts.

  1. Experimental Details List of Lipids POPC (Basic membrane matrix) DOPE (Hydrophobic lipid to attract hotpot oil vapors) Specific Genes (The Deodorizing Circuit) We will encapsulate plasmids encoding two primary enzymes under a strong, constitutive T7 promoter: snoA (Sulfur Oxygenase/Reductase gene): Derived from sulfur-oxidizing bacteria. This enzyme converts the pungent Dimethyl Sulfide (DMS) into odorless dimethyl sulfoxide (DMSO). pyrD (Pyrazine-degrading Monooxygenase gene): This enzyme targets the roasted, nutty pyrazines from hotpot spices, breaking their aromatic ring structures apart and rendering them completely scentless.

  2. Functional Measurement & Readout To prove the “Hotpot Protocell Spray” actually works in the lab: Gas Chromatography-Mass Spectrometry (GC-MS) Headspace Analysis: We expose a piece of fabric to hotpot steam, spray it with our synthetic cells, and seal it in a glass vial. We then use GC-MS to measure the concentration of volatile organic compounds in the air above the fabric over time. A sharp decrease in the peak intensities of dimethyl sulfide and pyrazines proves the system is destroying the odor. Colorimetric Enzyme Assay: We can engineer the snoA or pyrD reaction to trigger a secondary dye change inside the liposome (for example, using a pH-sensitive indicator dye that changes color when the acidic breakdown products accumulate). If the spray slightly shifts color (e.g., from clear to faint blue) upon contact with hotpot odor, it provides a visual confirmation that the人造细胞 successfully “ate” the smell.

Homework question from Peter Nguyen

Freeze-dried cell-free systems can be incorporated into all kinds of materials as biological sensors or as inducible enzymes to modify the material itself or the surrounding environment. Choose one application field — Architecture, Textiles/Fashion, or Robotics — and propose an application using cell-free systems that are functionally integrated into the material. Answer each of these key questions for your proposal pitch:

Write a one-sentence summary pitch sentence describing your concept. How will the idea work, in more detail? Write 3-4 sentences or more. What societal challenge or market need will this address? How do you envision addressing the limitation of cell-free reactions (e.g., activation with water, stability, one-time use)?

Summary Pitch Develop a “smart protective suit” with built-in cell-free sensors that can detect toxic chemicals or pathogens in the air in real time through color changes, thus protecting the wearer’s safety.

Detailed Mechanism This concept encapsulates a freeze-dried, cell-free reaction system (containing DNA sensors, ribosomes, and energy substances) within microcapsules of fibers. When the wearer is exposed to specific contaminants (such as heavy metals or specific bacterial signaling molecules), these molecules penetrate the microcapsules. These molecules act as “switches,” initiating the transcription and translation of DNA templates to synthesize chromogenic proteins (such as red fluorescent protein). Ultimately, a visible color change occurs on the surface of the garment, thus triggering an alarm.

Societal Challenge This addresses the issue of hidden threats to occupational safety. Chemical workers, frontline epidemic prevention personnel, and miners are frequently exposed to colorless and odorless hazardous gases or pathogens. Existing electronic sensors are often bulky and require batteries, while this biosensor integrated into fabric requires no power source, is lightweight, and provides full-body monitoring.

Homework question from Ally Huang

Rapid detection of radiation damage in space environment

Background Information During long-term deep-space exploration, astronauts are exposed to intense cosmic radiation, which may cause DNA damage and increase the risk of cancer. In a resource-constrained space environment, real-time and convenient monitoring of the biological effects induced by radiation is crucial for the health of astronauts.

Scientific Interest Traditional live-cell detection relies on complex culture equipment. By using the freeze-dried cell-free system (BioBits®), we can convert the molecular changes induced by radiation into visible fluorescence signals without maintaining the survival of live cells, providing immediate warnings for space biological safety.

Molecular or Genetic Target Protein expression driven by the p53 response element. P53 is the crucial “genomic guardian” in the human body, and its activity significantly increases in response to DNA damage.

Hypothesis / Research Goal Objective: To verify whether the BioBits® system can function as a reliable, non-temperature-controlled biosensor in a microgravity environment, by detecting the level of p53 protein to indicate the degree of DNA damage.

Hypothesis: We hypothesize that the fluorescence intensity triggered by the p53 protein is positively correlated with the radiation dose.

Reasoning: In the Earth laboratory, the p53-mediated reaction is a standard biomarker for cellular stress. The freeze-dried BioBits® reaction components have extremely high stability and are suitable for storage on the International Space Station (ISS). By combining with the P51 fluorescence imaging microscope, astronauts can quickly determine the radiation exposure risk by observing the color brightness without having to send the samples back to Earth for analysis, significantly reducing the response time.

Subsections of Labs

Week 1 Lab: Pipetting

cover image cover image

Projects

Final projects:

  • Abstract Emotional regulation is not solely a psychological phenomenon — gut bacteria actively produce neurotransmitters including GABA that modulate anxiety and stress responses through the gut-brain axis. Yet this biological reality remains invisible in how we understand selfhood and emotional autonomy. Most interventions treat stress as a generic physiological state to be suppressed. Meng Po Tang begins from a different premise: that the moment of emotional collapse is itself a form of biological knowledge, and that this knowledge can be encoded, stored, and returned to the body as care.
  • L-Protein Engineering The idea is to transform L-Protein into a self-stabilizing, autonomously localized structure, eliminating the need for DNAJ assistance. This will improve the stability of L-Protein. STEP 1 Gather Information about Lysis Protein /Sequence /DNAj Sequence / Conserved sites if any Known mutational effects from research

Subsections of Projects

Individual Final Project

cover image cover image

Abstract

Emotional regulation is not solely a psychological phenomenon — gut bacteria actively produce neurotransmitters including GABA that modulate anxiety and stress responses through the gut-brain axis. Yet this biological reality remains invisible in how we understand selfhood and emotional autonomy. Most interventions treat stress as a generic physiological state to be suppressed. Meng Po Tang begins from a different premise: that the moment of emotional collapse is itself a form of biological knowledge, and that this knowledge can be encoded, stored, and returned to the body as care.

Meng Po Tang is an engineered probiotic system. The user records their own heartbeat during a moment of emotional crisis. This heart rate data is processed through a stochastic hidden Markov model to extract rhythmic parameters, quantised into an 8-bit binary string, and mapped to a 12-nucleotide DNA sequence — TCCTAGTTGGA, flanked by AAAA spacers. This sequence is synthesised and edited into the plasmid of Escherichia coli Nissle 1917. The bacterium carries a molecular sensing circuit: when the host enters a high-stress state again and norepinephrine concentration rises in the gut, the sensing system activates. The heart rate sequence begins to transcribe into RNA, triggering a toehold switch to open, driving expression of the downstream GAD gene, producing GABA. The body feels calm. What regulates your emotion is your own heartbeat from that day.

This is not a general anxiolytic. The circuit does not respond to stress in the abstract — it responds to this stress, the one whose rhythm you have already survived once. Named after the mythological soup administered at the threshold of reincarnation, Meng Po Tang operates simultaneously as a synthetic biology design and a speculative design provocation. Its central question is not only technical but philosophical: if a memory can be encoded into a living system that inhabits your body, and that system uses the memory to quiet you — who is doing the forgetting? Specific aims include designing and ordering the full genetic circuit via Twist Bioscience, developing in vitro validation protocols for stress-responsive GABA production, and framing the consent and encoding ritual as a designed bioethical intervention. Methods include SHM-based heart rate encoding, NUPACK toehold switch design, Benchling circuit mapping, fluorescence reporter assay, and GABA ELISA.

Inspiration

The day we broke up, I recorded my heartbeat. I have always been afraid to look back on those losses, sorrows, betrayals and pains. But each time I truly do, it gives me a sense of release about things that are not eternal. The memory of that heartbreak in my heart is like a bowl of Meng Po soup - when I truly face it, that part has gradually faded away. I began to think: Could this memory be turned into a ritual of food? I encoded that day’s heartbeat into an ATGC sequence, implanted it into probiotics, and let it enter my intestines. The stomach has always been an organ of emotion - when people feel nervous and anxious, it is always the first to react. If the memory I swallowed could be transformed into a calming substance there, helping me release and relax, and ensuring I never repeat the same mistakes - that would be the Meng Po soup in the sense of synthetic biology.

Main Idea

Mengpo Soup is an engineered probiotic system. Users record their heartbeats at a moment of emotional breakdown. This heartbeat data is encoded into a DNA sequence and edited into the plasmid of E. coli Nissle 1917. This strain of bacteria carries a set of molecular sensing circuits: when the host re-enters a high-stress state, the concentration of norepinephrine in the gut increases, activating the sensing system. The heartbeat sequence begins to be transcribed into RNA, triggering the toehold switch to open, and the downstream GAD gene is expressed, producing GABA, making the body feel calm. What regulates your emotions is your own heartbeat on that day.

system logic

image image

Part 1: Biometric Data to DNA Encoding

This image focuses on the technological transformation of emotion. It depicts the flow from raw heart rate monitoring and mental input, visualized as ECG waves on a screen, into an algorithm that converts this raw data into a digital DNA sequence. We see the resulting ‘synthetic data’ string of ATGC base pairs ready for biological application.

Part 2: Synthio Memory Regulator and Gut-Brain Modulation

This image captures the biological synthesis. It features the physical precision bio-vessel (the capsule from the original diagram) containing the metabolic core. This vessel interacts with a complex model of the gut microbiome and the intestinal wall. We visualize the release of the engineered probiotic (E. coli Nissle 1917), which carries the specific genetic plasmid derived from Part 1, illustrating the full process of metabolic synthesis and subsequent gut-brain communication.

The Process

Part 1: Biometric Data to DNA Encoding

On March 29, 2026, 100 heart rate readings were recorded via Apple Watch across a single day — a day of personal significance. The data spans 12:21 to 22:45, with a several-hour gap in the middle that coincides with the most emotionally intense period of the day.

image image

Step 1 — Modeling the rhythm The heart rate data is fitted to a Simple Harmonic Motion equation: x(t) = mean + A · cos(ωt + φ) This treats the heartbeat as a biological oscillator, extracting three parameters that together describe the rhythm of that day: ∙ A = 24.46 BPM — the amplitude of emotional fluctuation ∙ ω = 0.2848 rad/hr — the frequency, corresponding to a full cycle of approximately 22 hours ∙ φ = −0.568 rad — the phase offset, shaped by the silence in the middle The gap in recording is not treated as missing data. It is preserved in the model as a structural trace — embedded in the phase parameter as a period of arrested motion.

Step 2 — Quantization Each parameter is normalized within a defined biological range and mapped to an integer between 0 and 255, using 8 bits of precision.

Step 3 — Binary to nucleotide Each integer is converted to 8-bit binary. Every two bits are then translated into a nucleotide base:

00 → A 01 → T
10 → G 11 → C

The sequence The three parameters produce a 12-base sequence:

TCCTAGTTGGA

Flanked by neutral spacers for biological stability:

AAAA TCCTAGTTGGA AAAA

Part 2: Synthio Memory Regulator and Gut-Brain Modulation

Core design concept: Negative feedback biological loop

We divide the system into four logical levels: perception (Input), recognition (Logic), synthesis (Output). A. Perception Layer: Pressure Threshold Setting The system must be able to detect “abnormal” stress. It utilizes the QseC/QseB two-component system of Escherichia coli (which naturally responds to the host’s adrenaline and noradrenaline). Design Optimization: By analyzing P qseB Mutations in the promoter region were screened, and a response threshold was set (for example: activation only when the adrenaline concentration exceeds the normal resting level by three times). This prevents the system from accidentally triggering during normal activities.

B. Identification Layer: “Molecular Mask” of Heartbeat Sequence Your 20bp sequence is not only an identity identifier, but also plays the role of “unleashing inhibition”. Trigger RNA: When the promoter is activated, it transcribes AAAAUCUCUAGUUGGAAAAA. Toehold Switch: This is a hairpin-shaped RNA sequence that acts like a lock, securing the initiation site (RBS) of the GABA synthase in the stem. The hairpin will only open when your 20bp sequence appears and hybridizes perfectly with it.

C. Synaptic Layer: Metabolic Flow Control Substrate conversion: The selected E. coli strain needs to enhance its ability to absorb glutamate. Enzyme Engineering: Utilize highly effective GadB mutants to ensure that once the switch is activated, a sufficient concentration of GABA can be rapidly produced.

image image

Background chose:E. coli Nissle 1917

image image

Toehold Switch Step 1: Design complementary toehold regions 3’- TTTT AGGAUCAACCT TTTT -5’ 即:5’- TTTT TCCTAGTTGGA TTTT -3’(DNA) RNA形式:5’- UUUU UCCUAGUUGGA UUUU -3'

Group Final Project

cover image cover image

L-Protein Engineering 

The idea is to transform L-Protein into a self-stabilizing, autonomously localized structure, eliminating the need for DNAJ assistance. This will improve the stability of L-Protein.

STEP 1

Gather Information about Lysis Protein /Sequence /DNAj Sequence / Conserved sites if any Known mutational effects from research

Lysis Protein Sequence (UniProtKB ID: https://www.uniprot.org/uniprotkb/P03609/entry)

METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT

DnaJ sequence (UniProtKB ID: https://www.uniprot.org/uniprotkb/P03609/entry)

MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNERQKQLLQELQESFGGPTGEHNSPRSKSFFDGVKKFFDDLTR

Known Mutational Effect

image image

LS dipeptide: Positions 44 and 45 (Leucine-Serine) in the MS2 L protein are crucial. Domain division: The L protein is divided into four domains. Domain 1 (N-terminus), while positively charged and important, is not essential for the cleavage function itself (primarily responsible for binding to the host chaperone protein DnaJ); while Domains 2 to 4 (C-terminal half), containing the LS motif, are the key components for performing the cleavage function.

image image

Therefore, the design mainly focuses on the Domain 1 region and replaces the water-soluble amino acids in it to improve its hydrophobicity and make it stable to generate spontaneous folding.

STEP 2

Select an approach to make sequence variants

image imageimage image

Plan 1: METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLLVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT

Design Actions: According to the LLR score, the K mutation at position 50, changing to L, yields a score of 2.56. Replacing with L (leucine) significantly enhances the hydrophobic anchoring force at the Domain 2/4 junction. Changing the Y at position 39 to L, located in Domain 1, yields a score of 2.24. Y contains a polar hydroxyl group; replacing it with L makes the transmembrane helix purer and more stable.

Plan 1.5: METRFPQQSQQTPASTNRRRPFKHEDYPRRRQQRSSTLLVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT

Design Actions: According to the LLR, the C mutation, changing to R, yields a score of 2.39.

Principle: Increasing positive charge enhances the protein’s autonomous attraction to the negatively charged cell membrane, thereby reducing dependence on DNAJ escort.

Plan 2: METRFPQQQQQTPASTNRRRPFKHEDYPRRRQQRSSTLLVLIFLAIFLSLFTNQLLLSLLEAVIRTVTTLQQLLT

Design Action: According to LLR, mutating S to Q results in a score as high as 2.39. Principle: Increasing the rigidity of Domain 1 allows it to fold into a helical state.

Mous

Subsections of Mous

BioClub Committed Listener MoU

HTGAA Committed Listener (CL) Agreement

I am a HTGAA Committed Listener, my responsibilities are:

  • Watching class lectures and recitations
  • Participating in node reviews
  • Developing and documenting my homework
  • Actively communicating with other students and TAs on the forum
  • Allowing HTGAA and BioClub to share my work (with attribution)
  • Honestly reporting on my work, and appropriately attributing and citing the work of others (both human and non-human)
  • Following locally applicable health and safety guidance
  • Promoting a respectful environment free of harassment and discrimination

Signed by committing this file to my documentation page/repository,

{{ Yuxin Wang }}

{{ 09/03/2026 }}