Individual Final Project: Topically Applied Biosensor For the detection of C. Difficile Endospores

slide 1 slide 1
Section 1: Abstract

Clostridioides difficile is a pathogenic, spore-forming bacterium, constituting the leading cause of hospital acquired colitis. Highly resistant to common disinfectants, strong hand hygiene (HH) is considered the most effective preventative measure in controlling its transmission; how might we provide a method of endospore contamination detection to enhance the efficacy of handwashing as a preventative measure? The primary objective of this project was to conduct in-silico discovery and screening of ssDNA Aptamers as potential CdeC C. Difficile biomarker binders, with the high-level aim of developing a speculative, topically-applied biosensor for C. Difficile spore detection via fluorescent, macroscale readout. In this project, an iterative process of aptamer generation (Python, ProtScale), evaluation (AptaTrans pipeline), and elimination (ViennaRNA) was investigated, resulting in the curation of a library of 20 potential CdeC binders for synthesis and in-vitro evaluation.

Introduction

Clostridioides difficile (C. Difficile) is a gram-positive, endospore-producing bacterium. A pathogen, the bacterium is responsible for C. Difficile Infection (CDI), an infectious disease with high transmissibility. It is considered the leading cause of hospital acquired diarrhoea. The risk of infection is heightened amongst the elderly and long-term inpatients, especially following the use of antibiotics, by which disruption of the natural gut flora may provide a foothold for the opportunistic pathogen. The sporulation, high-transmissibility, and potential severity of the pathogen often presents a significant challenge in a clinical setting.

The composition of the C. Difficile endospore bestows resistance to most common disinfectants, requiring extended periods of exposure to either sporicidal agents or physical methods (autoclaving) for complete sterilisation. Transmission is most common via the fecal-oral route. Given these properties, strong personal hygiene measures are imperative to stemming transmission, with a particular emphasis on thorough handwashing to physically remove latent endospore contamination.

This project seeks to investigate how cell-free-systems may be deployed as tangible, topical prophylactics for the rapid detection of C. difficile endospores in a clinical setting.

Section 2: Project Aims

Aim 1: Expermimental

Identify and characterise the structure of a suitable C. difficile exosporium protein target (literature review, AlphaFold2). Generate preliminary library of ssDNA sequences biased towards chemical and physical characteristics of target peptide (Python, Colab), then evaluate and retain candidates with Aptamer Protein Interaction (API) scores > 80%. (AptaTrans). Screen pool to identify folding configuration and MFE (ViennaRNA) and retain top 10 candidates for each region. Calculate docking scores (Gibbs free energy of binding) and predict binding site of final pool, identifying candidates with deltaG < - 7.0 to -10.0 kcal/mol (HADDOCK).

Aim 2: Developmental

Evaluate aptamer-target binding kinetics of progressed candidates (SPR). Experimentally evaluate stability of CFS in-vitro against mechanical forces and latent chemical stressors. Conduct preliminary in-vivo trials. Confirm LOD of ≤ 10 CFU per cm2. Calibrate ligase:aptamer ratio to reduce incidence of false-positives in-vitro; reassess or confirm proximity-based ligation technique as transduction pathway. Identify machine-based method of differentiating background fluorescence from readout at macroscale.

Aim 3: Visionary

Improve system to permit readout in interval < 2 minutes. Implement within a clinical setting. Establish a working framework for the development of tangible, topically-applied biosensors for alternative targets and applications.

Section 3: Background

Literature summaries

Cell-free biosensors: where have we been and where do we need to go? (Lucks et al, 2026)

The field has experienced significant technological advancements in the previous five years, with key developments in biological mechanism, technological integration, and target diversity described. Proof-of-concept deployment of biosensors to non-expert users has overall shown great success; the authors highlight the potential for the field to have a significant positive impact across industries. Attention is required to further develop manufacturing and regulatory practices.

Topical Sensory Nanoparticles for in-vivo Biomarker Detection (Sample et al, 2011)

In this study, solid lipid nanoparticles (SLN) were investigated as a topical delivery vehicle for a chemiluminescence-based detection platform intended to detect hydrogen peroxide, a biomarker associated with particular skin cancers. The Phase Inversion Temperature (PIT) method of nanoemulsion production proved successful in the consistent production of 22.4 nm SLN’s, with a tailorable melting point of 32.7C, a value found appropriate for clinical use as a topical. MTT toxicity assays showed minimal irritation in-vivo. Using an optical microplate reader, a LOD of ~ 15mM H2O2 was achieved, the authors noting that sensitivity may be improved via SLN applications at higher concentrations. The authors conclude that the formulation described is well-suited to topical biosensing applications, noting that further work would be advantageous in developing SLN’s as a pain-free platform for topical diagnostics.

Effectiveness of a Glo Germ-based assessment and educational intervention to improve hand hygiene compliance among hospital cleaning staff (Pan et al, 2026)

Recognising the significance of standard precautions (hand hygiene) as essential and cost-efficient measures for the control of healthcare-acquired infections (HAI), the authors investigated the efficacy of Glo Germ, a fluorescent educational tool, as a means to improve hand hygiene protocols in hospital cleaning staff. Glo Germ is an oil-based, ultraviolet fluorescent agent that is applied as a topical to the hands prior to regular handwashing, simulating microbial contamination. The study determined that, pre-intervention, residual fluorescence post-handwashing was present in 33.75% of the participants. Non-compliance dropped to 8.75% post-intervention. The authors remark that, alongside targeted educational interventions, Glo Germ is an effective, rapid tool for the improvement of hand hygiene compliance amongst cleaning staff in healthcare environments.

Opportunity

While application of cell-free systems (CFS) as biosensors is growing across uniquely disparate fields, there has been somewhat limited exploration of the technology as both a topical and fluorescent-diagnostic biosensing method. In Lucks et al (2026), we see that while diverse in mechanism and approach, contemporary diagnostic CFS appear to be quite understandably limited in deployment to physical, bench-top or disposable devices. Pan et al (2026) is a clear, preliminary example of the potential use of visual microbial detection methods in positively altering human behaviour. Sample et al (2011) provide initial indication that topical biosensors show clinical feasibility.

Building upon these observations, the development of a novel CFS approach for the topical detection of microbial contamination appears to address a potentially lucrative gap in the field, potentially contributing to a new class of tangible biosensors with the potential to intuitively reach a broader audience of non-expert users.

Significance and potential impact

Sight is often the most crucial perceptive sense in the daily human experience. Our environments, informational systems, and perception of truth, are fundamentally underpinned by the ability to see, as goes the idiom ‘seeing is believing’. This is particularly evident in the world of biological imaging, where our ability to measure and visualise events not perceptible to the human eye has been the cornerstone of not just scientific breakthroughs, but collective societal shifts in accepted worldview.

The importance of sight has profound implications to public health, where it is often a challenge to effectively communicate the importance of preventative methods when the inherent scale of microorganisms can impede understanding by pure human vision alone. The current West African Ebola virus epidemic is one such harrowing example. Alongside complex social and traditional beliefs, the inability for pathogens to be seen by the naked eye does little to benefit the understanding of disease etiology, but contributes to weakening of adherence to effective preventative measures (Mafuzadze and Manguvo, 2015).

Ethical considerations

The project appears primarily accountable to the principles of clinical ethics, with beneficence and nonmaleficence being of particular importance. As the CFS is intended to function as a rapid assay, it is imperative that an accurate readout is provided, this quality directly relating to its beneficence. If the CFS is delivered via a topical vehicle, guaranteeing non-toxicity and systematic absorption is essential to ensuring nonmaleficence. This principle can also be extended to its potential impact on the broader environment: the continual use and disposal of biologically active components via conventional wastewater must be critically examined to guarantee no ecological harm it enacted.

Adherence to the ethical principles described above may be primarily achieved via two pathways, testing and transparency:

  • The exhaustive profile and testing of biologically-active elements is mandatory, both within the context of in-vivo and ecologically diverse settings. Development should adhere to the standards required for FDA Class III approval. One possible alternative is the stringent integration of genetic failsafes i.e the components are effectively inert when a given reagent is absent. Failsafe selection must be comprehensive, considering all possible fates of each constituent component in the CFS.

  • Transparent design and research procedures must be implemented throughout the entirety of the process. External audit should be invited to promote critical discussion of specific implementation details and direction. Alternatively, an in-house critical review group could be formed which performs the same task, without risking the possible ramifications described below.

However, the application of the measures above must also be balanced with the demands of research and (likely limited) funding. Counterintuitively, overregulation could slow progress to the point at which the CFS will have limited reach and hence impact. Proprietary techniques or approaches could be divulged by overtly transparent practices which, in the wrong hands, could lead to the launch of a potentially harmful product, whether by design, complacency, or ignorance.

Section 4: Experimental design, techniques, tools, and technology
PartObjectiveDescriptionDurationStatus
1Target identification + selectionIdentify and characterise the structure of a suitable C. difficile exosporium protein target.
  • Literature review: Identity 2-3 papers detailing relevant exosporium structural features. Target selected primary on accessibility and specificity.
  • AlphaFold: Retrieve predicted structure from AlphaFoldDB.
  • ProtScale: For target peptide, run:
    • % accessible residues
    • % buried residues
    • Average flexibility
    • Beta-turn (Deleage Roux)
    • Hphob (Hopp Woods)
    • Hydropath (Kyte Doolittle)
    • Relative mutability.
  • Python and ChatGPT: Capture and process raw ProtScale data via step-wise function. Establish continuous suitability score; retain two regions which surpass 0.55 threshold.
8 hrsComplete
2Aptamer library generationGenerate preliminary library of ssDNA sequences biased towards chemical and physical characteristics of target peptide.

  • Python and ChatGPT: Identify nucleotide bias values. Generate script to create control + biased libraries for two seperate peptide regions.
  • Python: Use script to generate 20,000 randomised sequences (10,000 per library); export in batch as seperated .csv.
2 hrComplete
3API predictionEvaluate and retain candidates with Aptamer Protein Interaction (API) scores > 80%.

  • AptaTrans: For each candidate in each library, provide protien target and predict API.
  • Python + ChatGPT: Rank binder candidates by API. Visualise result of biasing via overlaid density plot - kernel density estimate. Retain top 100 (per library) with API scores exceeding 80%.
4 hrsComplete
4Structural evaluationScreen pool to identify folding configuration.

  • ViennaRNA: Score candidates based on Minimum Free Energy; filter for formation of stable stem-loop/hairpin configuration. Retain top 10 candidates per region.
2 hrsComplete
6Molecular dockingHADDOCK: Calculate docking scores (Gibbs free energy of binding) and predict binding site of final pool, identifying candidates with ΔG < -7.0 to -10.0 kcal-mol2 hrsPending

Relevant techniques

Pipetting

DNA Gel Art

Bioproduction

Lab Automation

Protein Design

Cell-Free Systems

Gibson Assembly

CRISPR

Technique utilisation

Two techniques/technologies are of noted importance:

  • Aptamer discovery via AptaTrans (Protein Design*): while undertaking this project, I naively assumed that peptide-binder design suite developed by the Pranam Chatterjee lab (and demonstrated in Week 5!) was applicable to the design of ssDNA aptamers. Only at the point of Twist order preparation did I realise that, (1) the suite was not applicable to the design of ssDNA aptamers, and (2) although a service offered by Twist, multiplexed oligonucleotide synthesis was not offered as an option. Whilst initially a little disheartening, the matter of in-silico aptamer design evolved into not only a significantly educational experience, but the central component of my project!

    Aptamer discovery is conventionally conducted via SELEX, an in-vitro, iterative process whereby libraries of known binders are effectively cyclically tested against a target protein, with weak or unbound binders eliminated as candidates prior to initiation of the following stage. Recently, several exciting in-silco methods have emerged as supplementaries (or theoretically, outright replacements) to the costly and long SELEX process, including an approach termed AptaBLE by Chatterjee et al (2026), which is unfortunately not yet publicly available.

    The AptaTrans pipeline (Song et al, 2023) is a deep learning technique that employs transformed-based encoders to score binder candidates by a predicted aptamer-protein interaction (API) value. Significantly, binders validated by AptaTrans have been confirmed experimentally in-vitro. The AptaTrans was used centrally in this project to predict API scores for 20,000 binder candidates.

  • CRISPR/cas12a: the CRISPR/Cas12a platform was selected as the primary MOA due to its transnuclease functionality (ideal for reporter cleavage) and amplification-free compatibility (may be designed to ‘cascade’ as a means of signal amplification at body temperatures).

Theoretical industry partners

Twist biosciences: Aptamer production via multiplexed oligonucleotide synthesis.

Waters Corporation: Measurement of aptamer-target binding kinetics via SPR.

Section 5: results & quantitative expectations

In-silico discovery and proposal of ssDNA CdeC-binding aptamers was selected as the primary feature of the project for validation, primarily due to the importance of the aptamer-based proximity ligation approach in driving the transduction required to permit the use of CRISPR/cas12a. The protocol followed and techniques utilised is outlined incrementally in the subsections below.

Target identification + selection

Three studies focused on the structural characteristics of C. Difficile endospores were compiled. Key findings relevant to target selection are summarised below.

Imaging Clostridioides difficile Spore Germination and Germination Proteins (Sorg and Nerber, 2022)

  • Germination mediated by CspA and CspC proteins in the spore cortex region
  • Germination in response to small-molecule germinants (bile acids; very specific)
  • Fully germinate while remaining encased by exosporium!
  • Exposporium has a role in adherence of spores to Caco-2 cells (specific receptor?)

Characterization of the Adherence of Clostridium difficile Spores: The Integrity of the Outermost Layer Affects Adherence Properties of Spores of the Epidemic Strain R20291 to Components of the Intestinal Mucosa (Paredes-Sabja et al, 2016)

  • Exosporium has ‘hair-like projections’
    • In B. Cereus group, these are formed by collagen-like BcIA glycoproteins
    • ‘Orthologs of the BclA family are highly conserved in the C. difficile sequenced genomes and have been located exclusively in the exosporium proteome’ (Paredes-Sabja et al, 2016)
    • Outermost exosporium contains BcIA group orthologs, BUT, lacks orthologs of structural proteins; indicates that ‘novel uncharacterised proteins are structural determinants of this layer
    • Epidemic strain R20291 likely the most clinically significant; 630 is ultrastructurally distinct, lacking hair-like projections on exosporium
    • ‘Competitive-binding assay and trypsin digestion of Caco-2 cells, suggests that spore adherence might be receptor-mediated.’ Further evidence is later presented that strengthens this hypothesis

Protein composition of the outermost exosporium-like layer of Clostridium difficile 630 spores (Paredes-Sabja et al, 2015)

  • Strain 630: 184 proteins total:
    • 7 characterised spore coat and/or exosporium proteins
    • 6 proteins likely to be involved in resistance properties
    • 6 proteins possibly involved with pathogenicity
    • 13 uncharacterised proteins
  • In exosporium:
    • Collagen-like glycoproteins (clA1, BclA2 and BclA3…)
    • Exosporium morphogenic proteins CdeC and CdeM
    • Uncharacterised CdeA and CdeB
      • Removed by proteinase K
      • Up to between 90-99 percent localised in exosporium
  • CdeC is unique to C. difficile spores; feasible biomarker.

Due to its surface proximity, abundance, and indicated specificity to C. Difficile, CdeC was selected as the primary target.

To improve clinical relevance, the CdeC sequence from hypervirulent strain R20291 was specified:

>tr|A0A9R0BJ19|A0A9R0BJ19_CLODR Exosporium morphogenetic protein CdeC OS=Clostridioides difficile (strain R20291) OX=645463 GN=CDR20291_0926 PE=4 SV=1

MQDYKKNKRRMMNQPMSTMNEEEVYTDEINSEDMRGFKKSHHHNGCNTDNKCECHDECNPCNPCNPCKPNPCNPCKPNPCDDKCECHDKCKCDCEPCEMDSDECFENKCGPECCNPISPRNFSVSNAVPFAIEANRIFDTMQFQTFTDATGPNGEPLTFETEVVEVFGSIPSAGQASVTIEKICLSNDGIVIDTGMTTLEDFDLDPLGDIVGRNCETTFEFAVCGERNAECCRQGKGKSVAYKQRGLTVAVRNLVLELRGRCGCTEFVALAFPAVRAGGGCKRRVDYVEFTFNTLSAPICLPADGRAVTLRQEYQTNLTVDCIGKSILKLECNECCEPFYELIIPNDIDLVLCLQETVSTLISEQIVVLASPNPIQPRLVDTFSKVCDFSQCGPNHGSGKPSCHR

Unfortunately, only the predicted structure was available. Prior to characterisation in ProtScale, residues from N-terminus to position 108 were excluded as pLDDT for this region was < 50. This corresponded to an included window of 108 -> 405.

CdeC R20291 (Predicted)
ProtScale CdeC sequence profiles (Hphob Hopp Woods excluded)
ProtScale overlay: continuous
ProtScale overlay: stepwise transformation

Two target regions emerged:

  • Region 1: 234-242 -> QGKGKSVAY
  • Region 2: 396-401 -> HGSGKP

Aptamer library generation

LibraryRegionSequenceAbiasTbiasGbiasCbias
1234–242QGKGKSVAY0.250.200.320.23
2396–401HGSGKP0.240.300.250.21

API prediction

CdeC Region 1
CdeC Region 2

Structural evaluation

ViennaRNA predicted MFE distribution

Final binder candidates

Challanges and limitations

Prediction uncertainty of CdeC: the lack of experimentally-validated structural information for CdeC presented both an initial challenge and ongoing limitation. As the accuracy of the techniques employed is highly dependent on the input of accurate, resolved structural data, it is difficult to confirm that the final pool of candidate aptamers will actually be functional. A large section of the peptide with low predicted confidence was omitted from the biasing process in an attempt to reduce a flow-on effect in the quality of the biased binders.

Section 6: additional information
References

Angellar Manguvo and Benford Mafuvadze (2015). The impact of traditional and religious practices on the spread of Ebola in West Africa: time for a strategic shift. The Pan African Medical Journal, [online] 22(Suppl 1), p.9. doi:10.11694/pamj.supp.2015.22.1.6190.

Baloh, M., Nerber, H.N. and Sorg, J.A. (2022). Imaging Clostridioides difficile Spore Germination and Germination Proteins. Journal of Bacteriology, [online] 204(7). doi:https://doi.org/10.1128/jb.00210-22.

Barra-Carrasco, J., Olguin-Araneda, V., Plaza-Garrido, A., Miranda-Cardenas, C., Cofre-Araneda, G., Pizarro-Guajardo, M., Sarker, M.R. and Paredes-Sabja, D. (2013). The Clostridium difficile Exosporium Cysteine (CdeC)-Rich Protein Is Required for Exosporium Morphogenesis and Coat Assembly. Journal of Bacteriology, 195(17), pp.3863–3875. doi:https://doi.org/10.1128/jb.00369-13.

Calderón-Romero, P., Castro-Córdova, P., Reyes-Ramírez, R., Milano-Céspedes, M., Guerrero-Araya, E., Pizarro-Guajardo, M., Olguín-Araneda, V., Gil, F. and Paredes-Sabja, D. (2018). Clostridium difficile exosporium cysteine-rich proteins are essential for the morphogenesis of the exosporium layer, spore resistance, and affect C. difficile pathogenesis. PLOS Pathogens, [online] 14(8), p.e1007199. doi:10.1371/journal.ppat.1007199.

Capelli, L., Spezzani, E., Raghavan, D., Micucci, C., Zanut, A. and Bertucci, A. (2026). CRISPR Assays for Protein Detection. Chemistry–Methods, 6(3). doi:https://doi.org/10.1002/cmtd.202600005.

Díaz-González, F., Milano, M., Olguin-Araneda, V., Pizarro-Cerda, J., Castro-Córdova, P., Tzeng, S.-C., Maier, C.S., Sarker, M.R. and Paredes-Sabja, D. (2015). Protein composition of the outermost exosporium-like layer of Clostridium difficile 630 spores. Journal of Proteomics, [online] 123, pp.1–13. doi:https://doi.org/10.1016/j.jprot.2015.03.035.

Green, T.P., Talley, J.P. and Bundy, B.C. (2025). Recent Advances in Developing Cell-Free Protein Synthesis Biosensors for Medical Diagnostics and Environmental Monitoring. Biosensors, [online] 15(8), p.499. doi:https://doi.org/10.3390/bios15080499.

Image: Sporogenesis - an overview, Sciencedirect.com (2022).

Kohlberger, M. and Gadermaier, G. (2021). SELEX: Critical factors and optimization strategies for successful aptamer selection. Biotechnology and Applied Biochemistry, [online] 69(5), pp.1771–1792. doi:10.1002/bab.2244.

Lang, S., Braz, N.F., Slater, M.J. and Kidley, N.J. (2025). In Silico Methods for Ranking Ligand–Protein Interactions and Predicting Binding Affinities: Which Method is Right for You? Journal of Medicinal Chemistry, 68(19), pp.19795–19799. doi:10.1021/acs.jmedchem.5c02582.

Lim, J., Van, A.B., Koprowski, K., Wester, M., Valera, E. and Bashir, R. (2025). Amplification-free, OR-gated CRISPR-Cascade reaction for pathogen detection in blood samples. Proceedings of the National Academy of Sciences, 122(11). doi:https://doi.org/10.1073/pnas.2420166122.

Makovska, I., Biebaut, E., Dhaka, P., Korniienko, L., Jerab, J.G., Courtens, L., Chantziaras, I. and Dewulf, J. (2025). Methods for assessing efficacy of cleaning and disinfection in livestock farms: a narrative review. Frontiers in Veterinary Science, [online] 12. doi:https://doi.org/10.3389/fvets.2025.1581217.

Mora-Uribe, P., Miranda-Cárdenas, C., Castro-Córdova, P., Gil, F., Calderón, I., Fuentes, J.A., Rodas, P.I., Banawas, S., Sarker, M.R. and Paredes-Sabja, D. (2016). Characterization of the Adherence of Clostridium difficile Spores: The Integrity of the Outermost Layer Affects Adherence Properties of Spores of the Epidemic Strain R20291 to Components of the Intestinal Mucosa. Frontiers in Cellular and Infection Microbiology, [online] 6. doi:https://doi.org/10.3389/fcimb.2016.00099.

Mustafa, M.I. and Makhawi, A.M. (2021). SHERLOCK and DETECTR: CRISPR-Cas Systems as Potential Rapid Diagnostic Tools for Emerging Infectious Diseases. Journal of Clinical Microbiology, [online] 59(3). doi:https://doi.org/10.1128/jcm.00745-20.

Qi, M., Xia, N., Wang, X., Wang, X., Chen, H., Lv, D. and Cao, Y. (2025). Development of an Aptamer-Based Surface Plasmon Resonance Biosensor for Detecting Chloramphenicol in Milk. Biosensors, [online] 15(11), p.706. doi:10.3390/bios15110706.

Quintela, I.A., Vasse, T., Jian, D., Harrington, C., Sien, W. and Wu, V.C.H. (2025). Elucidating the molecular docking and binding dynamics of aptamers with spike proteins across SARS-CoV-2 variants of concern. Frontiers in Microbiology, [online] 16. doi:10.3389/fmicb.2025.1503890.

Shin, I., Kang, K., Kim, J., Sel, S., Choi, J., Lee, J.-W., Kang, H.Y. and Song, G. (2023). AptaTrans: a deep neural network for predicting aptamer-protein interaction using pretrained encoders. BMC Bioinformatics, [online] 24(1). doi:10.1186/s12859-023-05577-6.

Sporogenesis - an overview | ScienceDirect Topics. (2022). Sciencedirect.com. [online] doi:10.1016/j.resmic.2014.12.001.

Stephens, C., Goodey, N.M. and Gubler, U. (2025). A beginners guide to SELEX and DNA aptamers. Analytical Biochemistry, [online] 703, p.115890. doi:10.1016/j.ab.2025.115890.

Sueker, M., Stromsodt, K., Hamed Taheri Gorji, Fartash Vasefi, Khan, N., Schmit, T., Varma, R., Mackinnon, N., Sokolov, S., Alireza Akhbardeh, Liang, B., Qin, J., Chan, D.E., Baek, I., Kim, M.S. and Kouhyar Tavakolian (2021). Handheld Multispectral Fluorescence Imaging System to Detect and Disinfect Surface Contamination. Sensors, [online] 21(21), pp.7222–7222. doi:https://doi.org/10.3390/s21217222.

Varkey, B. (2020). Principles of Clinical Ethics and Their Application to Practice. Medical Principles and Practice, [online] 30(1), pp.17–28. doi:10.1159/000509119.

Supply list
ItemQty.Cost (est.)
Google Colab: 100 Compute Units1$21.20
Oligonucleotide Pool (92nt length, ~23,000 total) via Twist1~$600
Plasmid construct w/ codon-optimised cdeC expression cassette (for in-vitro Aptamer validation) via Twist1~$1480

NOTE: all prices in AUD.