https://pages.htgaa.org/2026a/zoe-isabel-senon/homework/week-05-hw-protein-design-part-ii/index.html🔎 Part 1: Generate Binders with PepMLM Sequence with mutation: MATKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTS AGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVV HEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ ![[htgaa-hw5-pt1-binders.png]] In text, the generated ones (plus the one provided to compare) were: 0 WRYYAAALRHKX 9.957530 1 WRYYAVAARHKK 13.948671 2 WRSYVVVLELGX 18.185468 3 HHYPAVAVALKX 7.987091 4 FLYRWLPSRRGG 20.635231 AlphaFold however was throwing errors with these sequences, so I asked Claude to check: ![[Screenshot 2026-03-08 at 17.05.41.png]]Hugoen