https://pages.htgaa.org/2026b/nandita-narayanan/week-02-hw/index.htmlPart 1: Define your expression target What molecule are you expressing? I want to express the enzyme urate oxidase to aid in the breakdown of uric acid, the end metabolite of purine metabolism. What is the sequence? The protein sequence for uricase will be taken from Vibrio vulnificus and can be found from NCBI accession number: TDL85923.1 MTIQNENRTMFYGKGDVFVYRTFVQPLTGLRKIPESSFTERDNTIFGFNCQISLKGEAFFSSFTEGDNSL VVATDSMKNIIHRQAANYQGNTAEGFLKFICEVFLDKYSHIDAVELTATEVPFDHVLVPKGEGHENSDVV YRCSRNERATTTIEVKRTPTGSKIVKHSSGIVDVHLIKVKGSSFYGFIQDEYTTLPEAQDRPLFIYLDFD WEYSRWEDGTGANPEKYVAAEQICDIANTVFHELNNRSIQQLIYHIGIRILERFPQLANVQFKTNNRTWE TVVETIPNSEGSVYQEPRPPFGFQGFVVTQEDVKQKKAADSTVGASR What host or chassis? I want to use a probiotic organism to act as a transient gut microbe to help relieve hyperuricemia. For this, I would use Saccharomyces boulardii that already has applications as a biotherapeutic probiotic and is typically cleared from the gut within 2-5 days post-supplementation.Hugoen